ELFa( 4J4 (   " "@"BBH(H(HJHkHkԖ / /;0&00Qd;0 2 @00Q8$/ // @ P`D  B00 R ᙕР -LW YHkqHkmain() returnedВq   ),@@(LQ 0/j\q - L 0 $ 0 $ -0L  T  T p-H$,$HP0`L@ 0p -0L(  -0L( _ "- L0 -4L\ ,00,0 200b104 0 ,00 200b10> p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -LP@x`0 P  'H0!@ 0',0 0` 0 0' M-L0&HHH0$H@  , 0&&, $, 0`@ * 0 0 0''X(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,P| K 0 Khrx?x? p-LM@`P3PUOx3e H0 PT00 h0 \8J3 @C89?3  : 96(x?Lx?0@`x?px?8x? Q-L@(0 #x?x? p-0L @P ,00,0 R 0$ 0 00  0 p,0`0,0 R 0$ 0 00  0 !phn -PL4p`V$ 4! ,0 J0 ,0 000,  ,  0hP)@0D PT,0 0,0@p@x?x?x?x?x? 0-L@;P,@T ` H0n -4LSPp `00 0<0000@0003  00   0  dM4S0;0ShgK:4S 0 00L$H@0@@000 31C0 1-L?rcWP`S V @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVd0P0,0 00P 03Q - @p`R0 0L PP 00  0 00000\4SX 03g4   -L@pX00S/!0W3 ] 00`M 00P00Zpd3 X0  0W  -0pS0L00@`% 000PU00S`U \    8U Brx?0@y?y? -8@QL0z2>0 p-8P@L@`4 00 00S > S 0 p R  B  h 000 PXp 0 00 (y?y?`y? 0-L@LP K0( C0( 0h:' p-L@`u 1PUP00SXP ?sp  000PS p 0U 0 0 0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 0@ 0TTPPQ @Op@ 00000@TP3038P060 0 303 R 00   @800jB p-L@ NP`dU  0A00PY YR`pp 0-LP@P 0ed!H@ @0lP' 0H@ 0_ 0' -LM0` Pp @2?0S3  0BP.0  0&0,0K0,0 Kh  Kh\ 0S 000Khm  0P00 0S  0P3g4 MKhI -0`10#LP8p&@P@ 00 0000  0 0, |0| 004 PQ`0  @0@  00    y? -L M0PS` 0Sp K@K DPE 03K3[03K0p Pp]3[03K3[<3K0@0 4 @K?0K1 :`@ 000S3033 T] r3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  KF0 ,pK B3 00,0K,0K3 f @4  0+@K*K( IB#t003 P3,00,0P00!010!,0?@0p?<0,0 A00 P!0p20A 0?A0S 0% 0! <4("4! < $ +0) *(@! 0 T! 0 TW(K0!0R0>0U;0U8! P 0 0S0S00@ P"0!B20T1 0U>0G0D!010?0p?<0!0 400000p00Ġ0U0V0, 0TW0020!0100?<0!0 000Sh0Kd0 ! *0 ! 8V= - L0p @05 $P i 0$ , P0 * 0, 0 (0 $ @ 00 .0P@ T`$00  0(0 00 $0` 0e0 0" $e 0 $ @ 0lz? -LMP0 R @p  lD 0 ! 0W0U V T0`S  - 0 (0 0 0^U0VR0VO< 0RN \ Q 0S[0A0@!0?30`0200 >0!0?<0040!000`000Q! 0 TP 0 T!0 T 0|` 0S  ` 0H 0 (00j  |{?z?V=z?{?X{? -P0 RLpẀ` @H 0S0800 0300#0! < $ +0) *(0! 0 T@00 @@ ""  0! <4("4! 0 000 # 0S/000 0300P 0! <4("4! < $ +0) *(0! 0 T0800 S0 0 00 0 z 0 0! 0W 0U V T0 000 # 0!000S0 +x{? 0-0@L $0P0 Td0 T0 p-L@P4u0B $C $`P U p0R $0N $ PR R @R  pt 0N TpDz 0 0N Tp꠆|?|?@|?|?d|? p-0L@ $00 TP x0U 0 $PpDB 0@P T`$0 p|? -LMp @0T 0T@ 0T 0T@ 0T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0TP00@0 T%020J T0 0!0; T0;V 0O $0PM T0 ;d[@0 0O TM 0T@0O T0 3 DT0R $   0 S0C1 00!0R $  M T0  0P@" T`$ 00" 0  0@PG T`$0G 0  0T0 T0g -LM0p 0 ,0 G QE 0㊁8 0 0,0 : 0lppl 0P`$@(,(0 c 0..p .̠p, 0((< 4("4! l0.̠..l l j!lo ;芁 0p llp0@P0 ,< $4.4,$  0   :4PP  !K PB?P0`  0 PP! `:PP 1, : !0` , 8V=V=}?}?|?L}?}? -LM04 (@T ,0  c = -LM0) (@T :  -0L   1 <4("4! 10!, -0L @  <,$!$.!0\ 0- 80"(,#@L(P 80,#(0h -LMQ0p @Rb8` 0 0S[:01!$C0A0bA !!\Lt!`!!A' A10C0  101 - 0$N)` ,0  !< 4("4!,Q 0$\!! 1! c 100 Q0 0 m $0!00|\= p-1@L`$  8Q 01phV -04p@0aA@LH00 P0U S` 480@P81080!08)1Q0C1 -LMP@ JpP`' @0 0  B0 P` (0K0 0 *,P 1`$K0 0 ( 04P 0 P 1 81 0 -LM1! 0SP@# *AT R0001 0  ڤpP 0  a .0 < 4("4!, ! 0A \!0  ! 1/< 4A!4",/0!1 0 101@! 0!080|00 1 !?\\=B -0Lp`Q@4P @T  4 8 1 40! T 1@01P R 0S 000Q0  PU@0i}? -p4`0ALT㼠P 1@ R  $P 0\ < P P @@0<80P P8 T> ʣ  0Q0 0a<~?}?~? -LM0 @p`10! P0UQ@,PP G/c$ 0 l~? -L$M` 㯣P  㩣P NP0  PFP@ 0  00s0 00  0 P@ T0列 # , 0 @, 0 0`  40 0P 5  4,3Cp p0 0$ 0"0 0 0! U0V0WT0n< 80 @ 8$40 < (  4Z [XY00@! 0?<=0>00 <4("4!  (  4B C@A00! 0GDE0F00 <4("4!   ( 4HJ KI00 <4("4!  (  4R SPQ00! 0ge0f0d0000 < 4("4!̃, ,,4kj_ \ ] ^ i0h0, <4("4! , < $ a bc0`0< 4("4!@0.̠.$.T 0@ @ :48x (  4 008 80<4x (  4 004 4 "4<x (  4!10< < <"8"4x  4 ( ! 10# < 4("4!  10...̠ 0" ! 1.< 4!4" 10...̠ 0d" ! 1/< 4!4" 10...̠ 0"< 4("4! 10 ...̠0p! 0Q1R1SPԼ ]p0d0 d 0, 0 , d1,0 S@j㼼p\10\!\(Ko0,@0 <48 ("44 $" <    㓡(Ko莡(Ko tPT@@GR J0!0 PU@@DZ(p]=HBLBPBTBL?~?~?|? ? 0-PL@e $ d10d!@dA0h趻 0-PLU`AT R000d1 0  $ 塻0 -LM` TA(P0T1000 hQ,0 U  0 10! p0S PU,0SpQ0,0 0 $0S (00 1S X 1SX $0,S 'Z ʊ0(@'Z@P(Z X 00 0 00< 4("4!< 0Z\S0@ 1Y>0 1Y>0 ,$!$#< \10 I LS @ < 4("4!, !10\h @ 0Z? 02|R@ 1 Y>!0@\ T0  @Dh D2@|P".$2@|!.@2|0 S0Z/C1!PZ/B1! R0001 0 Pg?P1pPATP 8Ҟ 0P80 opP0) (\ 00: 1>, \  @0  !< 4("4!,10\ " @LXP @0  !< 4("4!,10\" @W=B]=]=~? -L M4 l440%00KR,0 0 :4Q1 10pW# 0`00P0 @T ,00@,@ 0 ~ 0 `PR00SZ0S40% R4 hAT$00 0P0,  @,@ 0 ~ @PU04 l10 0P,00@,@ 0 ~u40pAT$00 0P0,  @,@ 0 ~h`@PU04 t10 0P,00@,@ 0 ~K0@T, (0  0(0P, 0F0 p~$ 5$00CS00$0$00$, ) R000,0  0@ bU(K004000!  x40%e?0?X???Ѐ? p-@LX`90 /~ <0㊸P(00(0phڷ? -L(M0` $PD D0SM 0 ,X\ 0 ,Q::Q\:\ , 8 4 0 p @l3 Z0B (0P $<  Wg 4 }((K0 T0S 0CTTZ >ΟW 0@@ @gl.`#43p pW  4 0 80 , , 08 10 0@ 0 $<0@ 4 @1 *, , 1@c , T W% 0 !0 "$#(, <4!4",  @Lgd Ja 㭸B0t033 W 0 $ 0\04 $<0@ R R 4 @+0t03%5 W} 0$040 , 0400#@ @TF@ 1p0, \, A, 8p 4p 0 W 4 |\ 00 ,P@W< $0SS(;T 0CT` & T 0CT  w40S 40,0, , 1@c , ^0 0@P; T`$00;  C@U W 0 <#0! " rD /,01n{ 1p0, \ 04 T@ 1?, \u 1=>, \g! 0"4#8,@ ` $PN TL Z G0@P, \`,0@, :D8T( 0CT  0TH04 $P5 $06 p$10!Rh 10P AT 0G?, \db\]TX0 ,@, , 1 c<0rW 0$04 , bJ\D Z4P 6T 0T05 $+0<0[ 1p0, \6T |0T0, , !b*4Q0,0e"t R 0B< 4("4!̃B,<,$,O0M NL 1=, \e05 $<@90 $P` #P 4P {0 00 ..ZVd1t!l \|0`apahaXaa~`0@`003Ta@K*00  Sx_ _ pB`6 -P0 L  80C 8(R2 d #8X$ -P0 L  80C 8(R4 h #8X$ -< <0L00\0  (@ $8;80@-8 0 0@0@0 0@0@ -L MA0P` ` ,0K "[P1RC R $K2[mCX#X`+p@  1 R0C8 p (K"[p0 R2K"[0X00@ 0   00   &0Kt t0 00@0@,[H u=@  0'$p$l$# 0-MLM@P80000& 1 R+ 1 t!0Sd1 KX!0KL1AKA AP(1K R000K003X000 K  0C,K 0AKA AP K00C S񟗼H 8 (  000000000000p'D -80(0L 0 '0 0   p-0LM @+P-` x0 00> `P||0 R0C  (P 0PP8 x+r 00a=C4`#hl 0dCx0S 40< `*  `0:0'8'? p-0L P@p ; `  000嚚2  R` ^L00 S 0*PV@p $q$ -1@LP H0 `p 1 R 0 0< S\  SN  SL  SPS000H1  R Д      1 8 0 R 0 0 0tx 0 R0 R S 0 p0 `0 P0 H0  0 0 00p$' -41` BpL R H P X ` h 0GSȕ ĕ 8 ĕ @  0 0AMP(@ P l0l pᲀ\0 R    p -L\M4@KP L&03K/P3#K 8#c[Qr Qn 0S3Q  -&2 3K2#K 2["[`0 2[d h0  &2 ㌂#K3K0[[3 1C 0"Pr0!2"[0<P"KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@(K T1   D1`  T!T1QQZ@K&%05K015K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 `p["[2[D6'^=$ $`z@hQ?Ȇ?v'N$?܆? 0-LMPd0  ,V@0@800@ 8H=88' -8L@@, 000 000 0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- 0h)V0CRt 72RD >0R@2@ 0C 0h90CRI l2Ry 0R X2@@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@0@C=@0 1 01@@01@@0x1@@0D@0 $ $001@@0 1 0h1@@0 ; 0 0h0@@0 D h$0 >0h 0 0R t00 0 $ C$ $P? -MLM1 0 p 000CSp(KBKII  D ,0T `0 S` @ T c&pP@VP8K *"8K &"0h"0C4K02K#K t B("(04"43K@QBK0 5[90K  5K "*K "L @ 0 B$[4[Q04KD 0 D B0000 <  L@0 B},DPt 0 P0! 0C0 0 a ; RB {Y0 R 5[TK< 5K06K!NK !pPt w5[K R@0 80Ba6$H?'Bgfff -LdM∠Kd !8 !<(K1 (K:P> `@p10C0P P   Vp W@P0 `8< 82S W@` d 0008#88K@0 $K 0 0' 6S-LP` 8SB  qp 00Q8  X@#8  00Q`8X@   #8`@@Dt `X0 R0C  (9Tp<h?$ -LMt!0 0 @P  @ 4QPEȩuD q 0aR0 ` ( U3 0R" D ( R4 h 0X 60aP?`VP\\0 R0C6 l P0XU<'?$ -0L R xPx`x@0 $0 p0T] 0TiS$ 0-@LP@40 00 @0@0謈?' p-0L M @RP+ 0`0 P PEu\KpUt 000\01KP01K01K0K 00P$'? -0LHMp$Kh`KDb0 ZK P_ H(@"(D0#K0K"K0 0H00< 0 04P  {' Ԉ? -LTMl p |_l @zd?` B pQ  | B 4/0  ? p 3p&PE?n*T  C>T N0CT R>Tu >TA-p( 0lоpX >Tc 0CT 0T  p0l0vpX 4W. X0S x x\ - 0:0`s(K=T !=Tv =T4 =TpP 4WX l 5@p x xpBp d=T` '0CT 0TёpP,= R p  p X , pP4X 0 S <R  R 0CR H= Xp0X,2!p p Ջp0X \, pP l 5@= < R9 X=pP gパpPpqpX [wpP 婋p X X+{ pPX0 \U;Q= ;Q 2 Qp;  Q K0XpPXpPl 5 0"0p  * 0*0004K?4K P;$K NK:Q !0Q;Q |:Q :Q x:Q p:Q X:Q\ pH:T @:TE 8:T,:T" $:T :TpPpqpX 9T:p pX 9T 0Tl 5C = S @S 9 l0p%9 p5pX 8 Rp 010   ,X X0/ @9 XPX0 8R p 101zl 5 8 R@ 0Ŋp8X 0X <08 XPoX 0 Sk !⯊X0 x Zxp  ! xpJfpPr !☊p0!  x ipP xX 5 Qp;x7 R᎝?@^ ]>P x *@N`K@&@@(7@4KDK `G$K HK l x5 0x pP(X6 R l 52p 6 R  Ah6X 0X0)   6 XpPnM=@V    6!h%0@a  20C%wpl 505p0 0S/ 5 pp=pX 㽏pP4 R $5X 0X0, <5 R 05 XPX 0S >0T0 p X 0T 00bYp 0{SX |0 P\ d0 t UX t0 `9  |@h p/ h,$ ($t0 0$30 R0S   05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R0x0 hPx00x0p0\ | pPp0 T0 p0 X 0T 00b Sp 0d | Sd :|0B\0 p^pX  pP <p X X!pPsX.p *$2X 0X0, <2 X@PX p0 # \1X 0X0, 1 XPX0 p0!pPp 1S ?X 0p 1X 0X8pP"l 5 1 1 p0b-p@ q?ii i5i i i iiii 81-71$%Ci8i|6i(iii8i i #AB` gfff?B#$$'ppX 4p3p0 >! pX 'U H 0  g 0 Rh 0 4K04K0$K NK[| ^P 1Rc 0RP 0CRk PB XDhP1  : 0 R; l1 4K04KAX0 u 2 0T X 0Z1>p,0Xp ꎝ@? x }xP X 00"0X 0S00) XD #D2 RlBX0 u x"0X 02X 0000 X 00200X0 T bX +002Q' D0CQz >0QDv3Q. 0Q=(3 RX H3  lX3 u -l3 p j3 @k b3 f ZX0 pN3  Y 3 R 3 Xp<1>p,03 -L R6 l H= R6 l 0X @R6 l 0X 60 f@P R6 l (T0P R6 l ((0P(K$4xV -L0M`P? QC ,3P 3QX Fd0CQd  80*P/ @rR8 p 0X R8 p 0X\ RL8 p 0<h2  0TP (K0S,2.`K0K2K02K2Q7 0Q0ST2K?2K.`K02K00C SG, $    0!02K0"K|.`K2K p10S4 `10S* S[.`KKh<@0 fL=  XA$[P& >K 88K 4 *K 0 0  0D P 0 0@0@s|m갤[>0P 6[Pa lK0 <0< P N8 <00 0lK CM @ 0 p G,P 8 *00 @0@C= G$0   K''$؉????d?Ċ? - 3L  8sc @RR2 d 0X R4 h 2X蜢b r0R2 d X 0R0 ` ( RP4 h 42Xsc 0R" D ( R4 h @0X1 Rd &4  1 R0C4 h :XTT1 R0C2 d D1X 2S0M0 R0C4 h 0X0 R0C4 h B=CX R4 h 0X R4 h 0X~$p -L$MHH8Hh}/p pP, (8 $K4K JKP , 0R(K˯ FKZ ݬm` 70P8$ @! 0 1( 7!0@t  d > T HH7H'ᲀ0C 4'00,7 $' <07 Ⳁᲀ0d '006 &6岀 ?$K3K@@K0P66#[   6Q Q) Q +>3K ,6$K P3[SX&000  ,,埴 T5(6:@K3K 03K5 P5  [^5ࠃv5  P AM(@%5ᗱ 0rpu 0l0 De0y_0@r~  խ$000"h$010o4 4@ Q 44 $}.  |42Q x4Q D$0 <004H   D4Q$0;004  W3^ʎ04\`0@  03\0003@ 0c 00  0 0ޱ c 0Pر0 20p 0ɱb 0ñ0[R J20Y 0ᴱ 0b㯱03L (0D  0ᡱ: 0"㛱01 0㔱0( 2,2 P0À 02 P 00 01 0z0 0s0 0l 0f0 0_0 0pX0 0XQ0c 0@J0Z ,0Cp 0=0g 060^ 0/D夷@Do'???`z@0?+ $$$ 0@8?$'(j)'_eNa ^=-0 |0"32C0cPP 1S!0S!0SP~H -0L@P` 00㮘p@P 1Ĵ;0 ,`= -L@P 1嬴 0-P@0@@L 00000 -LP\`@0Sp\@0^ 00g0   -8(L`P"x lL@T0 _     qhS? S0-L@ P 0P 101 0 0h8 ة0hg? -LHMES, `Ph l0 (ھ0ᲀ0 S0 Nh0 l & l@K`pK!hK 0nPaK hK @0KdP 8\Da [0R 8 8D, 0R(KR0 Bh0 l ͆0?a[ ⃩ ?1Pp @P  Y:<$ @ @ 000CS x x x x x x x x x x x x x x x x x d :0 0:0<  P2: < : :P;Uq8[\P2@@O0 h0    h0hKⰀh 0h0 岠h0h0 ,2岐h0 0h0 }040K@@(0K {0 0B@(0K t0 0B@(K i0@ 0B4 K0& LR:00:0:0< 0R:00<0ĕ:0< 0R:00<0Ll8 0d(偵 ,0S㶃 8 P ; R  8 A  0S 㴓 8 t101d08 D" @Do#l?H???`=??`?'(? -8(L`P"x rlL@;T0 _ 6  2 . qhꬎ? -PL @`p8s3>!R 8 8b/ X!1S?!RG듍 ZPP 1 8D  ፕ`1S0 3ᄕ0P8PD "2R:0O  1  0 0@0@<0!0 1Sq<p10q "8   "0% ŧ`UP 0 pP 1<1202?Ȏ?.' ?ʚ; - LPDp`zP pE 1‚32C0c0QA20`><@ ,=A?0C @300  00S 0 0=0h 0 0P0 00@ 0 8 Ꮿ00 pᥱ~H&$$& !' -SLM` 0 ʼ8b(K0L 0  0A 0  V@K0KPK P0SK 0KPP  WpPQ 3]Q> Qb 8 \P 2  O       0Y$ 2ᲂ $ ڨ K0 K& 5֦8f Ϧ 0]2 R@ 8 Q1  1!Q ʼ89ڔ @p.Wx1 R0S( S Y@PU 0  Q9 A 0R  R1Ḑ0 1  @PU @@P8D@T 8^  yPP@101Any0@0'L?x??&&??ȏ? 0-8]L@P  0 R 0t0t P00h0X0 qP  x +>8  0hH $&$$ !}pPȀK pPՒP@Pp 1  I   9 ppH0 Q p ] 1<[1<0@Doqi X?i i|$&& `=' S0-L@ P P 0hL80L0hꄐ? -8L@P0  0 meP 00D0Q 40> 900) 2 4 ?* p-PL`@U 8.04< XV V Vph804< XVph ph? p-`Pe,:L!;@,:5=5/V847 0T8@4< 0X84> 0X P )jj@k3S <0$03@T@l7S <0$ 07@Tp -LMⰧP b0Pe 0 0@0@0/"-0?0b b0#RO <0(C\E 0 00 <7(r\ 0 00 W2@7#<07(`V  $0  B< $03 0 0@0@0 0@0@7rW'尧R:;ü:7S0Ӻ: 8(*4@0T 0-@LPLU<308# 0U -LM5P+`,:  7p 0 @0  BQr0CW 087(*@04T05 020#R KUP P0@DQ!0S*DpP  㩊'7R 5;50@DP0S*00 @0@ 10R!!  10C1 10R!!  10C1 0-@LPT,*  839,:?0h83 <30S ,2)S,* Ph 0-LM'P"s0  @@RC0<(\ ; B$0   7G7GG8 -LMPP ;@P7 0!0 0 y<凁0g 1 P 7(K<(\' $0 <੕( \,  0 00 < (\ 0 00 Z 90,0 0G,0@,0, ?WA0 @<(\ 0 0 0 ,10<(\ 0 0 0 0/"-0?00b9? -L@9?Sj7P -L M9PP0 S䙕sd3 0*R1z01*zpz0/"-0?0Qb[<I( b\pO 0 00 <(p\,p  0 00 X=1@w9<0C9(`V  $0  < $ P#$2 @R``  T 7S 0 0@P0@ 0::pX,p 䙅p (K:S0D0 0 t!0Ca% BbQH1 L! 0 Q AC1 01*pz0 D:: 0 0@0@0  ,: ,0  202, :S 9S202P  Lj 0E  2022:S 9S* 00C0 00t  0-@PL YYYZZ0 0-L84@7 0TPPU '8047 $U ,:  84 0T0TD? 0-8L#88P814` \@@T 804` ,PT 0h-`? -PL@p`ỊP#0R  0i VT'!&!&!&!'! '!'!d 884#8Xi 0f h j {b tx? Qp-L@ plR 884` \PPⓋU 804` ,`PU ㄋ p804$pꔓ? -`LP@LP#@1pR  @ᛉH$TUU* f U XU  ᆉUU Ud 804(@rj 804 $804h (@804b (@@tx? -LXÐp0 6H804P@T`$00P d804@PP T`$00P 804@PP T`$0P d؊Ȁ P 804@PP T`$0P  -LMp,  804@PP T`$00P d㦊804P $ 08#804@PP T`$0P d㊊Xʠ,0尐 -LM8pK@4P0 P T`$<<0P dgZ*804@PP T`$00P  * K804@PP T`$0P 0"[0 X 804@PP T`$0P (K -L M80 "Kp@ `4,x+ RP# d;R *X;R| L;R9 &R7 !5CR,: , , 08: F0}0@:@:<*P3*S!0D\3 }0\3 D,:@ f @0PK80 4$@TP#l:R d:8 :(*O L<:\+ P#0S \Q  "( c < Q)m}>0 `@ 0 `@,0,PP  (KR R R R R,:, }, Q , x0X3*K0C"[96@KR0X30 0PK 00[S/0[S.0[S-0[S,0[S+0[S|Zz  t+0[ 0+0Ko<7{ '2 4P w<0'07@ :(*W<{>0  0 PJ<7'2 P@L hJ<08804S $0!0@\3 St 2!0\3,:0,:Rc }R] R[ R,  , ZR h RN RR R, ,  , t <0'"8@Te 2<'?0  B  6 P@ @[@Q <0T<0$P#",:Q , R R 5CR,: ~, ~,:8, zB0\3R R Rp,: , kR R Re, R R R], S , X,  , <$> 0⟮?@D0 0@ ,,P t<>) 0H4 4P 0s<0 )0~<> 0  0 P [<0#8<)3 P@ E<0@T6 1<~> 0  0 PP@ *@\@Q <0T<0$804 ,tB 804,00r Pp,:l" h2*1`2`"1\2P1!0 0B828"$1! E  ᇠ,:.  0 01!@31_@D#H3!1(厝 0̠N0CT/  |8 ᆖ 804@Po T`$<<0o P3 S804@P T`$0 ,: "0,"D|@H|t?@`=???)nn!!`!p!'!8&!!!h!? p-LM80P4D ,*x 3S<<: 0` 0 `0 ,:" 8 <(4"4!<4 \ 8 <(4"4!<4 \840D \Kp84 0 \8@4 0\ K`=P @@㪗 P 00 @  01 0 0 T -LMy %08 )  ,:@  004 X0K 84P 0T8@4 ,0\84 00\8@4P 0Tp98p,P`04 \8),04 \'8,0@04$ \'8@,04 \8 047 T :Ss P#1RC 84@ 1\84 0T8@<4D \ :S1 84< 0XD:8@8#84> X8L 04\P#1R 84 0X :S *(K84@ 0\D*:mL804@PR T`$ 0R 05 @0;5,:9,:Ǡ84@ 0\t? -L`P㌄pD00 @0@}fh҃ꬕ? -PL@`pm<1T% 0CT-  0P⤗@4T ᶃ0T 0T0/ٛ@4T5@ @᠃5 @ Mᕃ@50@5 0 RP @@ @@i 5i 6i( -:L@@`804> (1PP P`Pp DQ- W ,2S 804> X %7Pp` !00! 00p ,  w`,:  Ap`p`  ,804H \#`4 2 -@QLPppU@4pW?`0OOP$ 2>AB?APP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0܏Bj -,0L8l02 0 ܏Bj0 8܏B0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000ĠBnjn$jxg!n -04Pp008@L `T0 T0  00C  0Td㮃 $.d㥃 0TP":P 0T 0T 0T 0TP 0T $0 T -0L`4P 0T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T ( $  T 0pWd}~@ $ pW 0@W}~ $0P0P@0T 7@X? 0-@L Ɓ04 00P T0h -0㈠4p0  LT54 QT  $  0PT  0T  0T  0Td㩂@T T! 0  T0S\ SO!M!N!N!8O!`O!lO!N!(O!  $ P" P!0000  T  $P00 0  T  $P00 P00@0S0 0 T !0 T  $P  0T  $0`  T  $Z0P  T  $0@  TZTU000x W0a 0 S0 00  0T  $q0@  T@0  T0@ 42P ("(Ÿ0 S[00 SY QT Ớ< ᷚ lPlf 1 R0  010@000?`\TQ0004(Q 000|ym  $0 r0$ 0440 0S0 j0 @0 0 00\n?j$jxg!x?`]!PD!X!??@?$?\?З???|?qBn'? -@L `pP 0TpP0 %TT0 T 0T 0T 0T0 T $i= -LMP@pP 0`P  0<<0< 80@` ,0 $ $0pnBqnBBnB 0-LMhPd0d@ @0P @0S000,0 0K0hpnBnn B? -8pLW`4@P t0 0@00C SU!U!U!S!S!S!S!S!S!S!S!S!S!2Ÿ 0i= @0TP 00 T0 T(40 T0 T03 0KSpږ SpGpӌ0Sd p0 TdH $ 0Td; $0S 0 T$ $ 0 T0 T 0T 0T 0T 0T 0T 0Tn $00 pTBn -LM@`p~}^PU  $  0 T00 0 }^PU  $  i}0 nn -LP `u~p $  $@ $} 0 nn -@LQ~t0  0t0} -LP@A~T @}0@`@<0 R 0p0S `}@谀 -PPLL 0RH 8p~@堀`T Q):W0  t0 o[}0 0040 TK}T*tt ` x p0 0Rp0x T< l0  2@ 0X蜶j\a= -L M80`S4@删  $8 , 8  $PP 0  0, Py0  , 0  , t0 0t0| R,0Ha, ,l08"20  $R  $p lP 000 0S^ 00@ 1 R4  $p*  $0U :x t0 0Rt0x T<m0pP0UP, 0 0 00 TPu](K0, l0 20,Pw 0 00  Tl000 00|l0 20,^Ꜷj0j -L M@|0pPtpx0p0t0G|<<0W ``U 0p`K?`z@Ș? -LM⬑P1p ,  A4`p|t0 0-|, 0R/(K|0Sʤ0 0 H0S t00t002 000 H0S H@TP0 00 T  HR #KPP @ D 0@ TTK00 T@Do܏BPa= -LM#p0`0Q(@0P4,0 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@C|0@P0C|0 8WApp0,00 T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 00, T@n,0 T0  ,T)4,0 T,0 T0,00 T 00, T,0 T$0KS0!0, T0, T܏B?j -LMŸa48@, l ሠpPP(K0 \P`2Wh T2W4 @0CW6 42W I1CWd ;1CW$fP 00#3000000000 , , T0 00 0 0 0H1WG 0W0 @00, , T1W 0W000 000 000000|0  @@0@@@,  @ LD ,0@$P@@a0 0܏Bj]t@yt ktzt lt - LA8P4pt0`  0  l0 20 zt0  t0 0t0 y000 T<㝖܏Bj - (LM(" P4 80 0qW ^z8P@UB ytX5X% 0 px   8:ePIGz , R; t0  ,y@(K$ $ 0  0 0 0T 00 T $0  0tt4  0S ,Zy@\#3 ťt@P t  t0S  ,7yt@́tX3 0 0@;K<<#000000900080006020y0, 0H  :A0 4@` Q,l!,l!l!@k!@k!@k!@k!@k!@k!@k!@k!@k!(k!X2 T2  @0T0G 0KSږ S㇀Gӌ0Sb 0 Tdz $ 0Tdz $0S00 T 0T 0T 0T 0T 0T 0Ttt00,{x 8 l0@P8 $0 00 TQ!܏B]!_!\j+BBBj@B p-0 00 LR`#ڔ0SP00S PU@ 0@G, 0B,8P<pTnldpPj$jxg! 0-LM0@SP ! 0 10 0 R<0(\  $0  B 0(0$0 08| -LMB=P0V/,1 1b !, ^'`    """Ƞ  (@T t!t #"BLP1 !/b32Cc,0 S9 1 (`#rBV 00@  0 h00 0 R00Q  , $ $!,""̠" B=0` 0\(K*| -LMpA  $(,    $(,"(*"* R   $(,, """Ƞ !(@T G/ #"B 00/-000b 0 0P( 0C3`j\,  00 @ t , 1JP 0L$Q00 B=0( 0\(K|0@ 00CSs!s!s!s!s!s!s!s! P P@7P,@nPX@l`0 $H0AhSwu!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!0 0 Rf Q Q0-L@P v  0@nT  08#0`08#0@jPj(x! x!0x! x! x! x! x! x! x!8x!@x! x! x! x! x! x!Hx! x! x! x!Px! x!Xx! x! x! x! x! x! x! x! x! x! x! x!`x! x! x! x! x! x! x! x! x! x! x! x!hx! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x!px! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x! x!xx! x! x! x! x! x! x! x! x! x! x! x!x!      -Lp0(S0:  "4""\,H,l,00|@0 P` @ T0Z Z 0 04( 8"(<;!#!? ##Ƞ 0rJ Z Ƞ ,4Z0 8 00 0L0Ba21C0aW  Q  R ,{0 0 颋. -BmLp@8 0\(P320 \4 0\PL QD00.\8SM0 08 \ -BmLpP0O/\8-0\@Q/0\R/p0\-T0\@Q/<0\R/$0\p8 8  -LM(0B}(Ⳡ`R(00@  ,0 Z, [,P<0, \ 0H \, P0L \l8S 000 p-LM8@SS0 `0 0P 00 R x8t t0g/B(\ 21C $0  B x0 00 R| -`0L R B=0 0\B=0 0\ -,0L8B8  \F -0 @B8`Pp4 P0L< \ 04 \ -0 @B8`Pp4 P0L< \ 04 \ -B}0``@PL ,  4 ( 00 , 40 p-BmLHP@ ,8 0 \pP!!!! !(!!!!!!!!!!!0!840,($ ? ???$?,?4?? -LP@@udT Bm0tp ,PdT  4%#61 \1 0m60@010!8!(1(!10@!0` `rtᢛ0 0(3 0#2   X0] 0 D0C @<0D BD0s pl!!?̛???8?\?M=]=!!!h!!|!!!!,hf? -LM0@S  # 0 30 S80(\  $0  B 0 0$0|0 000CS|!!!!t!!!! P P@7P,@nPX@l`0 $H0AhSw!!!!!!!!!!!!!!!!!!!!t!!!!!!!!!!!!t!!!!!!!!!!!!h!!!!!!!!!!!!!!!!!!!!!!!!h!!!!!!!!!!!!!!!!!!!!!!!!h!!!!!!!!!!!!h!0 0 Rf Q Q0-L@P @  0@8T  08#0`08#0@jPj!!!!!!!!!!!!!!!! !!!!(!!0!!!!!!!!!!!!8!!!!!!!!!!!!@!!!!!!!!!!!!!!!!!!!!!!!!H!!!!!!!!!!!!!!!!!!!!!!!!P!!!!!!!!!!!!X!      -Lp (6"L#T".d"Ƞ@0P`p@  X0Y Y 02 04Ƞ8,Ƞ< * 0"*#"#? ## 0P 1 0 0   !4^-0, I DY Ƞ ,4Y 0 8000P0Ba21C0aX  Q  R ,{0 0 颋.@P!!!! ??Ԝ???0 0 \0Q  QJ@QZ@40Q  QV@Qd@@@ -LM(@p5X ` ,(@4TP (#!B10 (@T ,40$00 $   (@0@T(@@(@3(aCZ 80, P     A 4 ""80"(0 (K| -L M0pS0 1, ,  , P @0S 00(`V $00 0$00 0    ,  Q8H00(\  $0  B 0$0 0,0(0(K| -@A , L[@Q \00HS 0\ 0R B0HSQ.A ,  0-PL[`8@S 0h_0 tE -LM0S @A(\  $0  B 0$ #80 0@T/ 0S(@Q`0S  0(pW $0\ 0$Q 00 0 S@oD| -0 ML48  $0 0 CP0p`P  0 P ; (K ",0K0 0P *,P " 0(,  04P  0P P  08,   DPn 8 R0 2MP ;S ;!R   @ 04 3@P0 E4@@@ 0 80R,00-  .00/   100 チ P0@0$ 04  @P ⧤i|0(\g  $0  B _l╤ W\␤ RL⋤M<↤ H|???ؚ? @?`???? -LM0S PA(\  $0  B 0$#!B 80 0PP1 0S+ pP@0S  0(`V $0d 0$0Q0 00 0 p SoC| -LM@0 p! 0,0(0$0#aB0  0 PP |(K|1!,0K0 0 *,PP Dޣ,!0 ,  04PP0 0  PP ã忣0, @  vCP W`ʹV d00 0  0 PP` 0喣(⒣ P|???ؚ?@?? 0-PB LyB 0@ yٕn@AC@TGG40PB0 -2"LQ`B 2QB 0@1!8!1!10@!0` `Rm႕1!1(3!1#2!ђJ , X0~W1  D0C|!@<0D BD0TACC- lP 00hۢ C-Bp@$PՐ0P DU=0@@ Pǐ0P U=0@@㺐0@ T=0pq?ܜ?M=]="T""h!4!!x!P"!,??== -LTM0h Pd {7(Kh dp0 `K  @  : @@ B}P$a 0 ;C*@,0 T0Zd Z B}GBM0P* `, + 0pT Wdl0 R8hL :0h-[0S0#0Q0 00,?,?, -LKM00 H! ,0 /0 0@0@ 048<0#, ##$0(@T ll4 00 #<0@4  ! ?  a 4 `( 0CPC0\p 0C  @0  0 48< @<L1 0PD1 ;L!D1 a(\<   $0 L! 0$D1  L1000 ;P@ <D! , Ÿ -00.  /00H10 048<#8:#:0 0 RH BmTr0*,0",0@*,",PP@AJ͈0 8 @!K |1!1 .0*0CtJ͈@10$ K(1 1L \pB]04@*, 0\pT0 -B}0x`@L*,P ,8W0*W,0 \P0 -B}L`@*,0X ,Up0 0 *U,7 \P0 -B}@`0LPȠ*,,0!,,D 0*,78!,\0*,0 \ -L@``{ZdV( B]p*,0 ,PdV 0*, 4$610 \1 0m葞0àA0 S p m i PA c0 %]W W S   M0 %GW A =  80 %2lp 0SS Z  ^0 mWh=e=, -pBM@BmL `pX r rZ *!!!!!8pFl8HS 9d%'l(RRA RC R 1  ^0}Er  08p8p0rUBM0P*,l ,0`*,44 \l(vl(hd0 -LUMtȟ0, T1 0p@P! H  HPP  0q(P0820003\Q4 4 8S @! \7` VXþʌX 41S S ڬ8S S<  T1T2 àd1 h hd@7a4'4ǟ|0C`P B AD0 0 0P0`P@@TPS6P z?C@?@41&067 0K͇ D@Do|04bԙ??d= -2LIM8! 8 2pp, 0C`  B >C ADP0 hŸ  04 P`@2P 4"z?C0!$2K͇ 0"40240C$ \B=0 0\_ -B]0`L@p ,0 \W 0l ,8#8:D \0, ,0 \,( -0 @B8`Pp4 P0L<0 \ 04 \ -0 @B}8LT`4 P0<4 \0 84 \  -@B]LLp`@ ,\80 00 \ p-0P@B-0PL`` 0..\\8 |Ph PhB=$ 0/\pf -NpLP@l0T T6BT8 004 \1`V@>.4 6.02/\>.4 6.02/\>.4 6.02/\\ > 08".\40. 08/\ -0L`p BMP*,0 1# 0*\HBm08PAK ,0 \@ P 3"$3",3"43"<3"D3"L3"T3"\3"3"d3"3"l3"XTPLHD@<840,? ~ z v r> l h d i_m=m=''' -LMP@@q>dT8 B}0` ,dT+  4 8 \@0 0;  0J>@G>dT B=0P ,0@$xs(pО? -1LP8p 4101   0P3':ࠃ0A1 | B= 0`\p0 0< C<S0?,"^΂ 0 0@T0QNSA: ^00S ^1 <7D`P dT1  @@ !d00T <7*0`0S  T0D@@  % < -L` @z< B=0|#,p3 R 0C !R 4BMDS0#\0(#, 0#\SBMD0 @&T r@ 묂0S( "@D ;50@ @  X @"/ ;60 A' @2 !R[BM0QE/,0E/\1 R^ u0SG 1 R 01 R s 1 Gk @d1 !R0 R 1 R0 +O $H 4F x00S`0 S@0X00S S7(m='55(6(''''=( - K0@ L7 bp >P 7 b ? @7 b V W2 RrR KP B=0", 2 RRR zKP vB=0L", B=0,"/\2"2"P \S WF1 1P \f BmA0!\1!Q> W$1!Q!!0Շ0՗00.0  B.i:R 'KF #Rb KF  ;00! 20 0 0P \P$P0/,0  WB=L :00/\P$ W9(,:(''5'(p01(VUUU 0-LP0ox0@PP h0h QT@TT0hz:0'p0 -LM }2 p Pp  0 `Pb !M,0K@0 0 *,`P ~Q 瞝(,  ;4`PI  @;`PC (\ 0 0; 0,p 0 p 0Z 00p  BAD0n $0 0 0 ~  nM@`P L L:~(K02~$.~|?@?L?h? -LM` `p 00 @p  0 PP  ~$K (0K 0 0p  ,PP } (  ;4PP  ;PP (\ 0 0? 0,  $}}|@??L?h? -LMß5PA0, ASu 0BSxlp"r"r"r"r"r"(r"r"r"r"r"r"r"r"4r"080 0022< k< iR} B= 00  t00S* 0SS   S .4 <30K2 K4K.x. x ,4,`1K0pK/K.K-0KB=0<0!00*40Kt0p( BM0LR*,0 1#8 3*\, 0Rw(K080 8 8 < B]0AaK ,8000 \B}H0 00tl8S2 @P 0Pt P0tl0P00 S̀ ,#,430K2K1 K0K4K-K.K/Kw.4 <_  3 K40K2K^@P 0Pt P0t9U@Dok= -LMp: 0C0S P h |`P*000H: RrB]8j0(*\0/,@>/\+9\@0 0; +<\`P9O0 ᜶UXIX 0 s@ B$ \$9T@@7dT B0h/,0 dT1| L<`(| CB=0/,d|~>/\@/08\+7\@P ;P +<\@'0\'0\@ ;P  0d'\\GB] g @\T,7,'Q00 , @@p7dT B0稦, ,PdTpd&000/,@0}0/\u-B;\ 4&0\@  &0\ r0.7`PE\ 0P+@; )00 0P*@\E 0P+ 0P+@0 *00Bm$`^B缤 $1\@ @0\ P 0\)U@0 \ /0\@ /0\ @$@4\@@6dT B]0c/,0 dT >/\@0!.\]M@#P0A0S @Tt3 A QRT3R 0G@3S 0A,3B 0T:R0S0"0001 +0S.2 0S  S 2\ @2x"Q` r2"Q(8p0 0rBM뤁0",!0 4!\(10P i`P',0\@/1\0  `1 05;@05( 8S   D\0 \0 @21C! c.  @JT?8(l(????l='p0?(pp|'x(z(|(''5D'80' -PL@`po41T* x1T4 p1T  m4P@4 3<10S01T4 0F@4T3@505 0S' 5@ @@@  ;4P@8S 5A0AS@0F@0н5A0AS4@Di i i ϖ1i 0-0| LQP@AT@05 0hg<Vyq00 @0@0'? -LM` p` 00 P`  0 @Pe ",0K 0 0`  ,@P yT p`,  ;4@PO  P;@PI0, ` !P;B  L @  2@P/ Z, ` -00.  /00@* Ԑ!  00 0  @P; x;(Klx`xXx7@ (\ 0 0; |?@?L?h?П? -LMH $`0,0 H1@9L! l|D 0SZ P 000S@ 0 < 0U0b 8ȟ R 0041 p8pZ 00ULD8000H1P ^"40 0@ 0 XV 0$0 &!4"0 0 H'00S0 0x0PS0000SmD!LW\HD嬢  H!0PP@QP 00P P!T 00 0(10G=  ?R8 PT0!006&0 0  0D0<1 S!4 0 0(P,@U+0 0  0PE 0 U %!4000/"-0?00b0 2  00  !40@U00 0 0 09#$ 0P TU00H 0L$,B010(@T 4   b00(\  $0 (\ h4 $0 P!T0 001$D G  ?8#= ?  c?Q C<B="0/0\@ß, 0Rs(K8 ^ 000Z*000(444#02 2000008s8 $30041 U30 0< 01 <1 2<   @`0 S8P0$ͣPPH7@ 049#$ 0@L!80཈841 bH R<; أ13H][7@O vHQ|"1  0 0<1!0!0 0= K00L$1 H1KK L,1 ( w.lH1 0HnH00H 0   0@P!00P P!T 00 0(10G=  ?R8 0$7@!HQ b LSv@Dok=<|''''k=?<<<0= -LM5P=@S`0p"  1R0' '  $8$80C0C$8$80 0 P  - sPV1  051 RY > RU. 0@ BT0S*8S. 0@ BT&0S* 00S:A BT  1R0! !  11D0C0C11P  - K@P 1R04( 8(  t8t80C0Ct8t8 Γ00 @0@5;5' -LMP0 0B=0"00180 00/3<0 ,8<0,  01!00,0 Q4 F p01ထ0 @Tp ) (`V $0 0 $4y!00@ 0@010 0  0G̀0/"-0?00b, AR08< 00l 010G= ?R0 02<0   84;8(Ko|'' p-8LS@0` hP8 0# C80p@0SA-00C0C00/0 RD -LJM B=, 0P/,6 @ @ *00T@! D1 50P6 R D~@D N?K0 4 Dؒ 049#$ %0(@T ^= 00# 0%@00@Q@ 50H1 (\` ^=  0  03 0 48< { ;㐡P $(\A 4A  $0   崤0@ $4 4 0p;P< h$ p,0H!0-  .00/  @D10 04:#:0 0<8  @@  81081  0@F3QP 0RࠓࠃQL00 Xx3 ࠁRG  00h#0\3 0 S<3 0C 09l  S| 3@D0CͅD0> q00 @0@w0S<",""Ę"L1   @TL@2<A ,+f0 [0 S00(4ڋ$q ,0 ,P\0 2S P UZ#0  0N \ @\@DJ0NS` 2"0 P`0, [0 S, (K20  @H>00!0+0!0tk= -pHLT`p` X"T"4"4""TBM0Q!,8\!\B <188pl8S '[l(RR' R) R }8p   8p8pT kl(l(h(2! -< A  ,Ye -0LM PR B}0` ,8S  0h  t 0\@0 0; -, 0\h"8S S0 -B}0haPL,,p@ P,0\   @" %(+ .       @       ~ 0-LP@ac4P 0p 0 |" 330 2S Q <0 5A0AS 00k=  0-0@LPc<@3B @T]80P0 BB--L` P|2 2RR8  ]QA_A@PM-U 5 I6 D@P_h1P/UN>0@H1 @!@1(18!810@1!0` `%;Uc1!1(3 0#$3 0(#3 0 #3 0#2 ` ( X0E% 0 D0C @<0D BD0 0hp?'==m=M=]=h""0"hT"(")" *"*"`/"0"o"2"Л""!,<.<? -2L M P `0@@7,dT B=0*,0@s dThp0S!B**("(B! ! o!CL  ("(0P,,("(0^ $,       tL  ("(,iTLLLz("&+ 'U -0LSPp #0S L+("(+@ @@Tc_M00:C d3@T0SPcSDc@0 @pT Rc 0BS c@0 @_5T RJu .U2@T* D @B2"Q  5 1T2 0C R02  $$"h"- -("(Z  aK00 :C @Y TaALD00:C 01@T|aJ109C \1@TdLa K10 :C ,1@T A 1@Ty@ \p X Tk `<`< H D꘺Tv+4{=D{={={=P|= <<x|nO),'Nx=Nz=`z=5 |=5$TTPPIz{=aq -@L  ' ("( ("(,h, p-LPL@ 8`("(  phsQ 0S0#R Q 0  x=0 $ -L@h Q0-LP n? 0m/00m?@C q0d f"\0R 0S 0m0hRyn?p "("(RTP 8#8 0 -`L] 08# w= P-Lড褡 -LM0,  㰐Რ\Ppp` `0eS0cS@`VP0V ( 8B(C62 ~0P, P0-:@C,S 0C8:0?S?0?0 Q p-LP!h@f@P P  @{@Tp 0-41"LRP 00! ,0S:0C *0b10 0?A2c>S@>@OL G$( ,0S t h \ L @ 4 ,0hP |gfff  8( c31 0P @PP p-0L` 0   8P@0Ch h0P@@\P* phc(PK$H H|  0- 0LSP X@ @00\T@ @ 0tT0 -Lp@0P`  0S 8$#:# #("(X 0S/ X (" 0S"ڼ ("(, 0Su t , \0SH XP T 8 L$H=08#8T " *=08#8" b/=08#8b/ 0S@ AQ4,\0SC/4\封0DS;#HM- ("(8X#P`0@ p  |e w0 P@^ X`(08#8^ $z*("( YO~a'+ (-L`"X@p  4 0@(T"X 0 S R10lAC 0CS? 0C@m@S@P @ -(0L("(0*(A- BRq0 /h 0bS1b1P# &L#$#&Ġ& 0`@ -pLtP@`T@ @P P,@ dU`U 0-H0L0P@0 ,$0 0 $#20 00!  r 3R0000   -rL@z@0@P00000 Q0C @R000|xkN -Lp`!HPY04 4 0P(U"H -H0L0@pPK/\`,0K/ -L0L0P`@K/\p,@0K/ -pL P`@!1 $O\H@0 \0@1 0C\ -L M$  0@  KU -L M@00 @K--- p-8lL@` 6P#8B.X`40, 0`4 XVp",P+@P P -@31CLp`PP PP@0AʝT  008#`08#H0Baಝ(0 R 08#Mbf -0LϠ̠ 0( 0@0l 1 \ -@0L 0( ,  P 0-LP808 @ B,H@@T05@  0\ -0L  -0L MP@ (pK`. N"K J@ 0! Q @- TK p-L@cP2U  80(0PP  @pp`UdU -LpA`@ 0#0PW@ @p P@D  _ @X0@ KdU`U p-`L@Ph y;T s 5@ m(/,P U hp蠯 -@!XL<p#X`!O K  E ?,9-O`Vp \,, $, ,  -LM0@  *KD0 P *K> D` 0< 40 Y`@ @I@I``T@V`F*K,K 4080 T0 T@@ D,0[  + [2[08S9p 0^S ,0S>0@``1@T  6`P@ \ KQ0@11Sʜ\J01">R 40`1l@ 㼎` RLs\`80R4 `!0 ⩎`|CpL??Hw=(?w= -2p"LQ= Rb0x"X0/(HD"0X0,"(@>ʠ2,ʠ#$N 0R10% R. R "\!1P\E \0@T@ T0@@Rxh10d1P \1PE P[81P* 4[00 110!S1 !1 1 !111!11010,@0T@000 10!10 S000! 10t0110p 1T0!1| 01!pC?` l?P S ??#|#""\i#4}#\#"X"""",a#L" [}=0? 0-1@L!P>.(<#$R *\B @u[0R (n[0\ 0 S 0 S5 0 S4  Z[0\ R[010 ^0$ 0 :#600|0 $0t0 1G.0!2X0 $0r01s01t0 2P??}=t??#rt" -X1@LPpP% P 414!Q à 0n010   0S  R Z ZZR 0n01`0 C  <\0Pp@ 00 0 RL 0004 000v$C}=??ܢ? -LMp`P  Z,K ) K2[ S 2"B 0S 0S>*P Z`BR0 ,t2)[h"0`2[ B0 8 #X,2[(" SZ 2U  0 S R WZ`!1 B PU 0X 1   @t0C!! PX0/0"0)[0P!P1 @@T .`P ) K!a[ 1 !PP 1P) [Z)0[S4 #0  Z`Q YL|0 Y`CC8 `<4?vtu=P?lCu=t?r???ԣ? -`@p0PL.,1 010P,00 X |0 R lY,8\0,,0000 ? -@P0Lp.,`43.\.,0S@@'dT @ P dT^Y<? -p@圀0P`L.\,0. 0J/\0.,J/, o -@pLP>.(0`@.\P,7.0S8Sw1 011 01 -LfP p0@P.\`,0.0., @`0@T H0H J/, $0TX< ',? -0LS8S!tpt0P@.\`,7.0., T1 01 -LM8K`P@m  pŊ#[3[,K0K@P ,@ 0P C[" 1R 8#H2[3K3[CK3K :(K,P0QTQ,0S0 A0C A@,0 0 ,0 0 @ 8#HT,0 0@,0 0 00  , 1 B !H, 0 P | -LM1p@ Nx1t!QI )PKX PP 0SA p P;)0[( ['[&[ 0  ?0? ??)0K( K'K&KP"[2[[00[00S 0C1UA% KP[! a00B1Zc?0 b c!B0 E$KZ =P`0@0 0Hx p-PLW8`S ph80 S $@~00B (h. -@0L <4,4!Z Bp`JRPP0 88 S L23:I^Oh1@`0 4`NX0ZPF) V/0 88 S-*Q ^`N304 8<̠Č@ Č#<\0ZPFV  t>Wd9W 0H1W8,W('WĤ?@?\??? p-L!@`mPP Q !ePPpWp Wp?? -X"p1L0C #a.4A\VP"<4!4 <Y/\P V@Qa@L.1,С\Y/9\@.d1\X @P8!<4!4 <Y/\P \X@P`J/0\@.0\@@ET `吀0J/,PU ThwV<0J/,  JP(fV?@? p-LMRP`@"iT 0 $(, <4!4"<NS  9Vx0S  `@/Vx H0(Vx0S @ @Vxx蜥?إ?p?? -LM1!pQL (!1!@P!X`(10! 0S6 1@1 0S< mO(K 0PK' # 03K02K 02K@,101)1cP`P*Tv v a K0  (K0Sڸ"p0Rv ("(vh<U1@01x{zP X? -L P`A 0ps P sU@ 0b P bU蠀0 Q@0.,1 S 0`` KU0J/,P 0,$ 0&088#8#8ESF0C8#Ƞ  0b8#Ƞ\ 08 #(Q"(0S%48U# U USp9S:0C8#Ƞ -S.0C0C88#Ƞ #Ƞ U 0Uppp|0   P 48U# U p U (0U pp pt?| - 0LSP 0@R`p R0Sp0"R 0@`p i0S 0`00@ p@0@`pRP |? p-`0L`hQL[\@\P0S 40 $~00 @TpU -L!Ȱ`oQ6$ᘠp 99 B1 0t 0Ph0h@ `$P~ Q 0o Q(08;8蘧?$($,$U -LP`p0.,@P]/ 0,0$00 @0@8 0 -0LMp0(`\P $ $0  B 4@T , 20 w0/"-0?0@bV4` U -x0x` tP00pL ,J$JA1 \8 0 U -L`0p@R0h0 1 ,:#&RS R @  T xP T \!TT0h0 0\@$$0h0 1 ,  @  T P T  0h0 0 0\ 3 $0 01<(0@P0PS `0 $L}000S n00U@\T?ԧ? -QL`0p%3$001<,0@P0PS 0 $}Qn0 @U XYx0x  QL[T@TP0S @0 $| 0 @TTT -LMp, , ,3$00PPU0 "10 0؁<(00@`0`@  0 P , 0PU <$0@h1 `V@, k (K,  R, ;T00@ 0 P @ O,@@T a 0fQ<\00 P0P 0 P p OT L 0fP 0P U0,  ?$?L?\QTT -0L M`,0(\ $ $0  B 0(@40P0Pp@ p@U@P0(\  $0    00PK K U -$300 1L@ 0M  0 㝁0(\ 0 $0  B p0ppp@Ph` 1 1\$OH 0\$(tTlTpT\T -p@Lf00S* S0  ,P` 80UaP@=107\0\  , a00PPP `@`u=dU 0- L M0@'PK0C$ KPP Kl0l  ,41C  c<00(0 Pl~ -!L M0p0KC$ KP1!Q |1  0 R'c0CX!@P \`,8#87   w00S/ S0 ( 0\(K6$000" c`P@#9 \$l 20a #9 \40, ( ?\p!Cl?BC -0@00L ph|eH0 88 0  @R00<<OW81|1 -L0M`@VD@T@D6,D@T(())("( ("(h`  ("(D<4&, 0Szp ("(zz ("(zp [P7 zz r ("(xp%h D ("(,$ ("( }0 ("(t0 ("(kZ-gY.cX _0S t*("( Sdk ("(LJDb@$4 BZ` @ ("(8z# ("(z2@Kr03K0K2KAC  Cp  {0SPP@0VC @ T @D0Ÿ,C @Dt ("()("(0SU@ᔢPBKp 0 @TPڶ%[%[(%[(K "f@BK @TP࡟@DBK@T. /   ,("(h`@ ("(H`@ ("(`y,("(ppP {;+ HPW$HPEpUW  DpP {#p HpW$HPpUW  ,bv=vv=)Rv="x -8L#8MP@0  *K< h~080 40 00 0"p0"烀<8@`H4 R Z  !*K N~X_X080 X0080 C)(02R   2@8@0 z10  !*K 0pW4000S40 0 8(K)h @P *K ~ C,1Z 080 @@R} m @ C)(p0R k [ @0 @80 *K}Z)(CV d08 8@0 )H 7*K } CC08` 8 w=v=v= -2@0L`CqᢄTP p:%40pP21C0`0gSp 0-P@L:0 p-@LP`~P P  ph phLt? -LM< <  @ D 4, P0p81  0! 8041 H}Y qI D4 "  3300<X6 4$`V $@P0@p0U̅p 60 40C C4 00 @ Ep EkEgEc ?)#,UX"#TG##""F#"(#@8#8?.Z\0 0P@X`0>@8#8?. iBP d?x= -L,Mp "JKT tRKW3"ЃR0P0  *]"3R` +#U@ ("(R @T`\S@ ("(R8#@6#8S!h1P1 T R`@T<8P#X/ !0"8#h@6#8 S11T<8"#X, ("(/"@2R $[;(K+$"*"$[ $[*#[5$[$[$[0"[C"[zR"[ RT h1T0`!P0.BX *K5KKK0KCKzK@TK0P/(RP {00 2KT/h0X3[X  5y2[  zEP ?? -L0M,0pS s((Sk'W JG0'(X 0`P`'X@(98#88'@,7.0D@T@D7=<0D@TBM0V&(T 0/(P 0SBzp ("(z4K Ds03K0 3K03Kzz 0S 0 ("(0  ("(z ("(z{z8#z 0S ` @ ("(050%@P/X`(:8#8/z ("(zj$0S0 ("(0 ("(t} r03K03K 03K,0S RY ` ("(R6CO ("(C,Z-VY.RX N H@8DQ8 X0 cy0tZǡǡSӜSLLH#< ,(D(# $@2.0D @TRbX0"X@T0"XP0/X@x2<0D @T70 ("( )("(0SZ @PLK` 0 @TPC(K褑@LK@T.  0SS) S' SS9 `@ ("(`,("(쐟@LK @T0UC Z,,("(~@ ("(uiL  j)Lv=Dv=04v=x -L$Mp@4<.D@T@D>K^@TCS0#(H 0#(/(D 0Szz LS0 X 0S@9  40)T ` 0 @P)X`(98#8(55d (5 0 ((P 0 /(L 0S S@ ("(0 P@/X`(:8#8/H 0S 00S l'h+'d00SP Wl'SQ> ("(Q,0S RC. ("(C X 5P@Z-/Y&+X '00Sڜ\ |& 00SPl 4& 00SY %-XP 00Sژ>X @t%T0 㣤X `PF x @Z6-Y$X 00S $ a00St4 X$ N00S }$y ;-XP o00Sڼ| b@#]T0#TZo:`Vt3/R00000#[I@L3@(K/B00 c 0Ÿ S T@D0Ÿ6C @.TBRP0"X0SHd 5Z 0S1 00S60P@,"X`(88"a@BPK @ T\ X (Ko!H` 0T0/X(KL0/Xl1 0!XQH 0SHx& CC ~\ X ` T  0T0 `0 0P` 0@/(0T 0/X0X0 \0 w=w=w=) |VUUU " ??" 0R00 /x6!` -1LQ@p- 8#8 TI``! 0 PX`@V)>@8#8?.Z 0aP@/X`(00/} B= R! @0P` 0 P@/X`(;8#8/ Ey@0P`  -0L  -`PCL@&U! 8p+pP!l8S U%  1Up0 U B ( 0p<+ :蠘'|0vp0  l(R R 8s}?80B 9 l(Hk(U?lU -@L)w3+s0   l hd -L(Mp0"JKP0 l0<@E@U08%(98#8%X0/(T*KP5KL`KHCKzKRK0K 0 CB0/X. x 3[# 52[#z +#*#08@ #[0@| ,L &"(`$H D (8@m.#0a /"Rb 0/X$[*$[5#[`#[C"[i"[zeB[R@BK{00 R2KX 0!X0 #[x#[t#[p#[l#[h#[dP (K! ("(W/!Rt1e#[ DG3[T! 0ApzX ("(z, 0BSQR 8FP  !??`aˆh@|+ -0LS`p 4$Q 0$Q DP PLU@51,,("(5LD2S 00S=ڸ2S 4$0 $X,("(*("(# ,5 d ("(5] ("(]0S &3+0 3# 3.BX0Sh  "0SW  PB@2S u ny jP fP# b2Sd [{ [ \Wzp ("(zN  t2 p*!l2S8 1!P@/X`(?008#8/X1X!/:X L!C&,>!,!:" !6#!2$!.l] P Zp 8 zP ("(zz ("(zQ ("(Qx !P +j"?0>c7~g p-0LS@`  R RP D  R0 B RRuPPPPPp  R0Rx ,0S 0S0,0S63#Q "3R,0S Rn?  ("(R_0S03 L .#0SL/#{00Sm"n2 @ 00S:sy ,0S: L2 |2(R> p00SXX"ILL"EU @[ ,(; {."50S/!.0l J,0S! 1 1(R,!  X$P((ph60*&("(6iG+  c ("( ("(> "("(R5~P |uxpC02)> 0-|0@Lp .,  0S 000PU  -2pL"`2.BX "q& m0 i>,eXBP P^LDU@DR/:X0S A2S u y P  P# 2S;  .2 *2SK 5h!#&3+2SB </X*!2S Q0  i* P Zp [{ \ z 8` 2 &,"?0=<P |ˆw -LMH 00 `P@C ,K e, <(4"4!<S  X R,0 3 PpL@,0S  X RH@& HeH e [PPp@@< (4"40 !<0D <(4"4 !<0 (K@ -LLMc0@ 0 q/PP 2b3 0RK1S 1S= 1SZ 1S  RR R0BSvPA3D] 0`pKS0#@,"2!dKs?_P d0!u0P  03 0`pKS00@!2!dKu?8Pd0!p0P  RR 0BS020`pK@ 2!dKw?Pd0!i0uP| k`pK@ 02!dKy?Pd0!i0XPb N@Do??@?r=?????,? -Lp(h ?OP ,PP4 R0C R h0C#P@ B\`,20#PP q2c吣 .3\PPcPPPP;PP00 0,# X$ 0S 0"X@ a.9X0 "X@ "<Xx2h"J/9\@1$PwD4 0 \8"@T?C P7 Tg 0 @P!\`,6! !0 !X 0.@x1PP>@TX1PP:1 81@P50 !P0X!P0y}? t101; b/1\@ c/4\x 00000C x1 l1`1Ph?VUUU~,U4U,0,  B,+ -$LMP$100!0#0#?A3c03@0C @@C  B  B  (!=`P ~`P\3  6`P`P`P`PD2 Rp(K31C01C=80@ `PM`P (`P2p R5 `P`2`"1!X2X"1(  0P`'Y<2\$B @0AB-SQ` r15 j0S㠀h 068 jN@pzp1/Wᰀ@OH ,3:X`0T1  0@!08810@(N-B(3 "1!"1!3(  U x X00  oD0C @<0D BD04T ,3   |0BMbpUQ#A###@T#S# ?M=]=?hU "(U{#Q#P#Ы#!,UU? p-1L`P+0@@0T00000I00` 000T0L 0X 101p08U0U@U -QLMPC 0 8@?D1 R(JM4@ ` 1` R0zO 31C01C=80p( KP (0` RZ" 8@=8 BQ@8H8@ L0@!<0< .B,c\U -LP@P10SCm8` <P m{pPDO0 iiL  @0!00 $1 R3 P8Z@0;80@) 8S,  mV@0@,T p吀0.,]/T`.N  XUHkg0 ? -Lo -L@ 4P 5A0AS 4@ -PL@`pC1T* 1T4 1T  AB4P@4 L10S@1T1 0@4Ty@505 0S$ 5@ @@@  B4P@8S 5A0AS@0@0r5A0AS80p0(4@Dp2Ei i i ϖ1i -LM8`@(KSs0J/,p@ 0K/, 2P0@KD0 PU 2唂%A@r@!U 7KwK,07 1  PP-UJ/ 0\@2 0 0@\T @V P@(c@0PY408@OIk1 R9 x1 R5 0T0U  ' P1P!0QE8|AQ0-,-0XD 1 ->_SRU V-D@l0@X0PDq-VUUU 0< [hP0e @P -RLMp, (R@@agP lP= T`: U  0"100"P V `^U#`00 `V# P  V1@`F4V g,0LDP`T, LDP @`, L0@TA輭? -0@Lg ` P p11$$00WW@D4(D0@T PPT1Q@CRJD0&PU@DZDg@PD 0  ^ 0@ 0H0L i 0-PL80@40 <R P P 0X1000P100000S####0, 1r00 0h000XPD00000hm000KPD oPPD0ePTDP0 H0P DPT0B0B`BxBBHB -0Lp@D0 0 Q50.P`•D0\ PP 0S0 0 `` VPDDgiJ'i; ? -0DPLp`U@L0@T"@L0@4TLgi -L0MP,+0  Q`%8 <  D 4 H TDPp@@  040<,K < 400@K @P[00,@ 00 < H0X  L% aH0D 68Ǡ-0 0b @H0L 40S,08 001100 f  0 0 pptl`@  p00B 0pS @ @ 03 < LL0P\ 004 0\ lb pt2 P l—0p Xlbpt2 P l—p 0XmjB$#j p-LMlP pt2  B l2p (?0@# s# <S x``` ` `  =2S! 0=2Vx0=2xlB pt2  B l•8#8p X\20\2xȮ?? ?0? -LMl@ pt2  B l2p (?h p-LMP0U`0@PUJ$ l” pt2  B l2p (? `0S x PP 0Sxh 0-0L P@=2S 0P<2S00 -L@mP 0h -LM@P0`="R  K0 Dp0H ?L0<$K(@K @P( 040$(0plPt0 $0  0 0 R 0 0 0 !1?0P0S0SP-(0#16S,0&,000a>000, R000000 !1?0P(0S(0S,P0 =2S, 0 ,(4 0000 =P  - 0p`L<0@@pP4xQ p-PL@` 8 0 Hph> p-PL@`p80Hph- -LMRp`4`.R 0K0S@C QU TP,@ 5<*U   0010#Q Y@, Z, 10"0 0  U ,00010# Q#0,0@0S@ `X00090,o"@Pfoq?ܯ?$0S0$0 0-L@P0h0 G p-LM H`T  X@ 0 87L040 05Kp 0K&PPPw@   ,0 0 ( (@ ^ 8 -LM408 0<0 =P}<0s<0"00<0<04 @0 ,08@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 4<0, ^0, P<0@ B00p*0 W!`<apP- ,#(0L",A P p4,<0@ 00 <0@ `(08 08p090(Ko2(K<0$(Ko6<  (Ko0 ? 0-LPrP@0X0 p-LMH`T X@0 8TK0$00*Kp 0KCPPP@   ,0 0  (0 ^ 8 -LMP04=Z10  , p8@`P& 0 &$ 170<0@ ,, 00C 00 2`$PL@M008`090 ( -L@P 0h -`P(0 SL4p8@jP 00$1l00< @0, 00 00C 00$P202L@0080004 -LM<0 <0, 0@,0<P,0\GFǠ0E0@8 0 4 @4:#:zc>0`P*P S= R; 00 NQ `PP0E  0`"0X$0<\,  008 00QPP4P!  0 0R@$PR @(K00C 00 市P`2$<\ -L MP`%8 0+p 0<0 ,8@P, } P $4 0D4 $2 <0 $084 ^080,000   ,K@E,0P , h0440<0@ % Q10<@ 0, 0 0 $`0L!,PD10L@0,0,0, ,0 , 02,0, $`04 08lBpt2  B l—0p \0S <2S F (KP@ TP0 H0 ,! ,(0@ $BMb 0-LMHPT 08 fI00K0 0K[P  ,0 0  (  ^ @8 -LMP0@= `Z0 p ;80 S9 P2 pW4[ P, Q 8 0 40Q # 800 0S00 00W#h $ $8 $ $X@ (KP 100 P1 00000@ @  <00  PP , R E RP 8 (" , , D0r00 (Ko;$000(KoLBdBB|BBĒB-0 =\  0 xt0| h# -LM=BT (KX20X2084X4H40 0H2U%Z P" $`V 0SS Pl0S 0C0b20000#>80 s2Z P40S`  4P$0U00 W 0SSQ 3N 4 @00b@0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 cY@ 0L0R@$0 R8S?X20CX2^$pW@V$0S 4 00lB pt2  B l˜p 0\80S 0 000@q@0S800 @cR08 -$HLT H0S$8>0(8 Ge @P 0-@LPP 9PP ~LQK0許j -L4M⨚ , 0p="R =,+ )0*T d<0@ %0& P('$Ry .0:R <R R R 0lB pt2  B l—p <\00@Z, 0R$(K Rk  R z`9R 0RU80R _(9R 0R 0 R H9R} RV8VUlB t2p  B l—!pP ,0 L#Ġ# XK WKVKU@KX0KNV8V!0NPPS񟗆$$$$$$$$$$$$$$$$T$$$$7R RmU000zx7Ru 0Rr 0sRn 0o7RWVU8VR!0NPPSLd$$$l$$$$$$$$$$$$$$$$$$$$$$$$$$$$^Ǖ= 0=lB pt2  B l—p <\)lB pt2  B l—p 0\@d=^l— pt2   l2p , @TlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\8l— pt2   l2pH ,T`K@( jM8 R0K$40#  $<@Q KO0KP@Kl— pt2   l2L p,P 0  @P ! 0 0R@1@!  T0K5M^ 0N4S= S* SH(U@1@# H8 C4  0MU00U  EU0 0 U 0R0* R# R  k U`1 `#@f TP1 P#p@e LT@# Lx LP \ J.  D@Do#  #BܒB~=D?BBB(? -L@P 0h2 -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!DW"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m 0-=2LSP 0,@0h -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"|smW@IX2V0CX2 lB pt2  B l•p 0\4 04 l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`,\1@`mlB pt2  B l•p 0\hY=`\80\8P`z $\(E`0\8rꔰ?h?T?8? 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJ=2 SlBt2p l•p ,4 0S 00h` -LM@P ` =2S  $K0 40< ?@0(K8pk(P060( 060(202( 0(0 $LpU(0W   $P(0 S00( 8090lBpt2 l–0p \0S <2S <2S hP@ (&$0 0 ,!@ $BMb -L@P 0hv 0-0L P@=2S 0wP<2S0/0 -L@P 0hP =2S 0 R<2S30/8 $(8 80WP (Kx2|" ,LB[04P I 090P < 090P0 0@9P02>U 0 .P@0E?01P E 0R904 0 @RJ1?P5@TZ |y8[$3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,0 l—pt2 P l2pL , L, 4@ mdlBpt2 P l— 40p\d lBpt2 P l—p 0\@ l—pt2  l2p ,@ T%@P@T ]l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  4l—0@0p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  "`l—1p@ \lBpt2  0l—:pH \lBpt2  l—P 8p\lBpt2  l—pH 00\lBpt2  l—,0pL \0@ Pl—`pt2 ` l2pH ,@ T0@T 004 0THPH L lRpt2 ` l—4p1 \lBpt2 P l—p 40\B?@%I$0B(#j$ -LMl`ppt2 p l2p , H T81S[ l–pt2 p l2p ,lBpt2P p l–0p \@^l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  Dg lBpt2 p l–p 1\İ? p-LMPN l• pt2  B l2p ,d B`0 @`0P 4 T </ 0`2xV0`2x?`z@??? -QLMp` Q Q P,0=2<2l0<2pt2 p x2l– |,00 p\lBpt2 p l–$0p \lBpt2 p $l–0p( \T8SPHT lRpt2 p l–@@0 p\{lRpt2 p l–@0p \lBpt2 p l2p8 ,l–XH pt2Pp  10CxN>C 0Cl–0b "!HQ0p4 \lBpt2 p X8! l–1p@ \lBpt2 p l2pH ,lBPpt2 p l–pH :\lBpt2 p l–P 8p\lBpt2 p l–0H p\2<2 0C<2X(T(P(<2l0<2Ppt2 P l2p ,PHpT lBpt2 P l–0p \2<20C<2l–Pxpt2 P l2p ,l–Tpt2 P l2p4 , Xl–pt2 p l2p ,@lBpt2 p T(l– 00p \%I$0U0 !3  22a0S1 0-Ll@px"0\lRx"p0\06SH0H064 010 0-Ql2x"@P@L p,l”x"*0 p:\00 =2S 0 &6D0 0-@LP6S\0&\0`0V`@0h2 0-PL@640F0h& -`LQPp 4@T0004 L00 R0S R06 0 -L@KP 0h p-0L P\` 0S @R60 0 @ 00<phWp -@LTp`; 0S8 `PU# 0 0l0tA\0\0\0S `Pd@TQ d@T Q`d@TQY000x&\01x2 x0\0Sw @? -@P0Lp @0`0C@0 R 0S R06 0 hb -@T`Lp\D 0\@0P0 ;0C 80 0 , $(\LpC 0\Q 0Ph p-T`@PL\ 0D0 D0T\0HPD@D0 SH@P0\000ph 0- L$0PS0$000@|0h -0LSS`2 0 00S7 @T0 Pp4 <D 0o 0S P%40S %%88 8pc4@T@p ;0 %""0 000i<"888S@P @000S@$@$@$@$@T% pPtl 0,40U01#.#8*"*8 #Ƞ00PpP40Sd@T00i t? 0-0L PQ 00S @ tl 0 1SRP0hVQ0h\ ꨱ? p-0LP`CT0S@d0 R hB0D00 C10` ph0D @\  1R11d\0@6mh 0@00I hAm`@P<ẖ?Ա? -0LS8 p 0D<  70$ PW@S4PW D<@ 0"D`0 &888 D  0mP0hm{mܱ?0 00S 0  -LMPl2x"p ,!BP x0S QD\P*(0KP`}4(0$, 3  h (0Kl0p@t6S\06\ ` ^``pV\ R`0`0`0 \ j:lt 00x0\0`0d0  KP -LMF`T V@4064 G:040K?*$0K:PPP@p$0 P,@ 8$0K<0@@DP6*U40@& -LM<P@@, `@ F0  T.p08 80W2-6-0\4 < 80 ,   @p3, 0<\4 !4 0PP] W00< p>80 0c S@1p301 :J$JJd @@`pW00, RP <_P6 8:#: \ &0^ 0004S804E I @T4 !4 W,0S ,p D<4 0` P(K0<90D4 0, P -LMp`(0 S0S 0S @R06 0 @0 0<00 K0 S*0"*:! ,ʠ (!4 00Y4  4 K00PU< 0P*@0, S00@`>  0^$0ʌ@ D P 0 $ 040$0 ,0(,  $::5 0(0%,0   8,0, S @(K1914 0d0 ٽD@0S< @ @l2x" p,@D 2P 0C" 00C3 R PS0Q80S+<\<@N\L @2@ 0S00@ h01@0&0\0@&\0xS`0`0@ 2dPc 80TD@0<0@0<  嘠@6@0&p$@ɼ@<2S0~$@w @?ȳ?? -L@Ph -LMP0`="R @  K0  4p0 < $K(K? P@P @(0$ 0 #$0S <2S 00& 6@P@h<2S 9P@  |n$ -L@P 0h -LMP0`="R @  K0  4p0 < $K(K? Pa@P @(0$ 0 ż$0S <2S 00& 6@P@ <2S P@J |n$ -L@FP 0h 0-0L P@=2S 0"P<2S00 -L@!P 0h p-PQL`@pi*U 000ESQ 000 0ASQ0pp -LL0M , 0p="R 1,+ )0*T d<0@ %0& ('$RD9Rl 19R Hڣ R 9R 09R00@^P, 0R9(KL9R R R RTF 0A?CR< "8R, RU0008R T`K( :6 R0Kl—p, 007 0P0KQKO KP 0  @0P0 00S@1@!  TK:V 6VUx"l—1@  p,5  A4 XKW0K6 SL4 XK U0KVK: R 85R 0TFǕ 05R 0Rr  06 0< 0t |0x@0e {@PHn$` A-LPQs$r$Pp$Dp$h <2lx"0<2 p0\2l•x",2 0p\&lBP0x"0 p\l•x"6 p\6Sp`6Sx"l2A@  p,=S`x"l•@ @0 p\6pSW 26S@6S~x"l2a@  p,=S@x"l•@ @0 p\<2&0R<2@6Sx"l2a@  p, 2@0Sx"l•@ 0 p\6Sl2px",l•0`px"0\@dT\ l2x"p , @l•10px"\@dTH l2x"p , @ <20C<2P0=2l•px"2\lBx"@ p0\@ydT l2x"p , @2h<20C<2h ( \?? 0-@LPP PP n QK=0許j 0-=2LSPX20QX2 @T|2 6S n 6SX20CX20m06 -LMl2p $l™xp ,l2p ,l™0`2x"0Cp\ l™px"0\@dT l2px",@l™`02px", PXx$dx$v$Hx$<2姏 *0<P, A0"0R2 ,2 !Q l™,0x"0 p\e 㕛P 0,0  3k.&00H 70 ` @4 6@T' P? `0,0 ,l™p 0\s 0,0 ,;2<2 0,0 ,@:!0=C 0Lp@Dp @@@\TD ;0C`@0P1TpD 0 P@PD PPLp\TT"P@Uf:@TP!0 >@P P :0 @0 0 LT\H@D@D ;0CFl™P0x"0p \n $n媛l2pR@xb \p, 08 10l™x"0@ p\dZb l2x" p, l™x"6 p\BD "P001"PDBx??B$p? p-T0L@`TP @T :S  @Tpn -04 10@LP  >00x*R90  q@-@p+ P`^ X) 0!"4# 8̓ \0S \0S  R` VPPP \0SX P Pp0: p0C*:p0: _0C*:0p30 P  0 00@-: Q3 @00S)% 0S$+ 4 0R0 40S  40S0l04*lp  >0@  P:TJ00Sp0 Q 0 0Sp0 Q@-Q 9Sl$$P$ $l$0@9I ) \ 0@)9I 0@)9I 0@)9I9S 
 -RL`0  R* Ó \^0\. XIr 0! "4#8<W*9X ",0( 4;2( +>pP "% Q 0SS 0QBTX ",0( 4;2( +>$P0"@ !405 6478`:p ?;P L<$+4"2X)540674 8<2X)! 0"#4 8̃ˆX405 6478;P8p 4 ? 4 8\,Q0P , D8K00K0S@P`P`D0 @@ DKB2MP`0 K q?c`XP 0 S S 0PPR,0( 4;2( @$0" 2" %! !!W? Xz -`Lp@P3@S X)` 0!"4# 8<P T+ " "202 0-X@ 0 9PL)p  /09`#R 0 `p30~$ 0-LP@@=T0@ -L M0 4 X, 04 8 P ,$0S ,0 S S] SA p0,(Kp0  08< 044 @0 0@, $04``p4 `00p` pX998< =>@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@n̴??? 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X R1X R0K! 00P000SU\p 0(3ɄK0p 0* ?? 0 -L4 8<S@? 0-@LPı 0 0 9@)0h 0-PL㯱IT R0009 0  0 -0@L$.0rP ht$`? p-@L`P U 3PS @ XX PppP lQp0p0p0:lp0*R *R lQp0p0p0:lp0 *R*R lQp0p0p0:lp0*R P5P Q00090)R P! -@L R 0S0S PP  0S00 R0  00n 0-@PL YU 0)9  @2)>0 9Y   @)2@9 P R0 p-dPL `R@ 0S0S  R  P00ppn -LXM@ %ҕ,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8,(K茵? 0-LP(0U@  0h]`z@0@Ե? 0-XILPL @J08 H~ 0 48 K,: @DoD~= -1L M P U( 0 0@K& P& p3S' hiV#`V P0 48<S@@T (X P @ &( 0R$K Xp qn@DooT~= -LMp)(0! *@@"`+P 48#\, @ n 21C0a1 @ w  CP0 48Q Q QD H ὓ0 $ (,3&  .&'& 048 < ?  Pa0 48<@(0) *4+8<SL, 0RM(KO0 0 PP0   n0 $ (, B% 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPPX @Dot?L?`~= -LM Xy@W ßd9 "10 0 0 P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@00 \% !" 4#`8D \<0P@P0hP-Xɚ! 0"#48 8<S8 048<0###,  0 P@0 D0h X@)H@8@( @@DooԸ?~=P??4?? 0-RL0 0h 0p? 0-L M@P90K0 p-d9PSL p  㓋|I`T X  Xp\@T \ 0Pꜹ? 0-L Mɠ@P 00K0 -L(M0P ,0 P0 0 L0 \`P <KP|yW H D @ \q P 0P048 L2 $(T\= pWH0SZ  @Qx P|9St \pq $0( 4L8T\r P 9 X WW \q0x pP 0P L1U% $0&'48 0S> X)0,0 p h0 㟣 Q@ @8 R 0 S@RlQQ 8 R 0 S@RlQ٢T 0 xY,h 0(Ko辉0S*e4P@щ <],\ $P2"0CR202 0S00<ᗉᝢԻ??B8?D?V -LMe\pK 0, PP P  dS@, 0R(K  8G@,}KY@P ;@U 0DmP VP@ 0 HmV.K0@mP 1 S  t02(K (RQ 0 @ 0mW/K 4"  @  ! 2  "<K@K  ! b ͇ \1`02 hK"00B@(,"042 wB<K8 +H0 F@X@ 㞇m0a 0 0 0 /0C B0 0C B0 <K     = B1#4!2 1",,(##Ƞ0702>? ;90: =!"#0123456![8 1[ <0@!1HJ0!XE t@XdɀɀL h 0 " 2|9P"Oj"R' 0S0202=@X PنֆZ цt  Q Ɔ@ ‰@Do??~=?qedA??ܵ??ؼ?? P? 0-H1L PR "R6 0 P0 CT\T R R R 00|)R \0S\0P Rt0 0hB0h9 pgP X)p 0?$?? -L8M0pXK@`P 0( dɔ\048 L1 $(T\ j( 0Rc$K"1   P dTX1U8@K `0` P 0 4 8,R* R R 00+04 80 0 @00 @ @ @Xh 04 8,P00 $U@DomarcX?BKdIA 1 .K<Q pa 0S0$0 $yK! VPNŸ 0jPC0 @PK048 1 $(Y !0 xjSd 0ojStP垾L1ZL K 0 0P 0$  0RjS*VQ M0A  (@ z100 $0@@Doؽ?qedA marc~=CRAM0?p??? -LM0  80 لpd "10!P040 Q|iV0` + 0㨀00 ,0  0 \ 4P0\X0048 L1 $(T\ `V X0S\`VjY e0(K0U \ 0P,\ \ 0\0 4 x. 8dX 0,0 000 ꌔBmarcCRAM -L0M0RX ,0 `S Rp@T  OT0|900| APt0\@X0, LK 0PKUP4!P0 KiP2 h P0 `0 0S @00$@S p TqT  XpW@d, 0TR(KT0P T 40T0 PdRT T@DoqB?= -L,MOǟp0 Q,0 P D ݃PQ6  V hу0h9P PT p ?UPe? | "aV*@ P@VP# BP L@K 0 -  `  vP `tƟ, 0RE(K  %pd 7 " P2 P PPp@ P! X)540647/8 <S f` a` \` pW`d婼? (I2Xʘ0\`9 9I @ P0  )9P R0 I``P@( X 0 4 80P 0#,##8  0X" 048 <  " "4"Ƞ 0 @ t9S  3#-i 0@@ T0 SU T * N1A p q`P \`SQ$ P_P0S`9V X) p X)0VhIT |:S P @T\:Sq  Pj `#V#`F h` X`X `<@  ~@X | hp2 lP59`SQ 0:X `{@ p uQ#'X) p P` 2m, 3S PX @p0SP&$<$$$301 20@X  p X)p0 H SP  9X) p ~Pp PX  X9 p0l X @Do Ⱦ????о?,?=п?`$$?X?x??D?=;`< ` \$ L`?( \P#0@P0X30(PC0:9@8d >@=P;`p;`Č?@ȌP304(3PC 8mH TPH00X0L,T"R B 0SP0TL202,#L R,# h8<# KC0s 0h0  CR @C00D  0@ QHX( 8_80L@K0C80(3T 0&(T 0`@(@1 0rH3 & 0l @P @Dl3 0|Sl: $X( ' 0@!r(@01 0H3 0H#0(#0@ P嚀p`Č$@D3Ȍ( ($X(  80R TC  TK0@4@1 6K` p ~T< # 2KT>X<# <# LZ]8cH@LpT $PP~~U@~`W0P @$PP~~U@$CT $PP~~U@4Q4C 4#@~T@3S ~DCT ~T, 0<R;(K03S(3    ;P((0h0 $X( l 0SC*Q0ST@c Dc 83S @`$?(<L  %P\ X A P , 0RZ(KL@K sX0X #?`@p嬁 ČɯȌ9 0:`8̌Pp弑 帡 ;币崡 嬡T/ᣀX 0OOl 堁  p㤜jOK0 0OS! 1 jK\~K<@  ! !sc ʃ|qK  ̑ ȡ sKPQ a   ! X! ڌ1h!1d Z*AY& @ QUKjKpWP`P`B2MP`j/K Uc0`Ap 7Qd p p CXQ 1 \0Ku 1 KӠKPKpKDP1`@HL!TQdqрK吁ڐKKРKKK K0KPKq 0@0 0少@P004Pl@!A:lp0q*@P P됁 00|$x됑 0 __밡40QX)...̠%H%%<0@4[堐0[夠X9 @壀妠᧐Č Ȍ89p:`< =P p ;>@l ?$(Yx t .K ^KpWP`P`B2MP`^/K Tc@`hQ,q刁0T0W Z  0 PVhA A9S@ OKp`P0PU`p80<@X)]0\^_ 9??L0 t: 0 0)000 `:\*(0( X:d* 0 :p*< %%%%|%%@ %@-X)@ 0!"#48 <9 p-`LP@h0S  R000<0 0 n8P 808  <0 P4@Tp qo?? -@P`Lp00  (00(00q0  p$00 Q$ * mX ,00 0,0$0Q$:(0Q8 0(0,0 :SEl0SB Tl Rp0p0p0:l p0 4P (0SYl 0R0p0p0:4p0p0l 4 ' 0  <l9S L:Sባ0  0,00,0 0) 0 0u  W h0S 808  <0 P0 0P~Wy*4 ?0???? -LM0Kh#P`X)0K0P 48<@0 , 0 00080  PP 00@0"0000 0 0*0 00K0@$ < $080$ 2@ 4H p, 嬀0  )XI`< 4 !0 "# 00< `1X Rp;(K) 0X R02S ! 0"4#84 <S 4 02II 00 0090  \0D0) 0` l00l0 h0SC <00< P<80Y|đ 0@ 0S S PX9 !"#$ ( P8 0ZA 00900 000C00X)p (h?%qH?`?d? 0-L MXI! 0Y"4#8 0 K00SPڀɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S> UP % %| % % %P %\0<' \Ɏ$ K0\0<&p 0s\0<\0< p 0,]L 0   S ??X$t? -LMP@`)q0X@T) T %8% %H%`% % %V V =)0X)p 0P%V0X`t0p9 0 T Ů Ki0FSV ViV V? $ -@PL ;k -@PL P P M-L0Rp`d KT qX9%:&,%%̠&&H? 9;=>@8P<`쉇??X0 t:)0H 0 09`*808 \:X*000 d:x*(0( :p*% !%%!% %%%% @-BA 0 0#^0 " -pQLP`@h@TX@D 0AZS@@W.T`{WP?`y@l?0@ -LMP 0 ,0 I@PH XA   !0@000000 0 000090000000K: 000@`H<`8`4 0,   1\ D 9 !`pl00l0 P <0 0< @00<000(K }P%q 0-PL@ R000<0 0 8P8 0< 0P4@T0? 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X RM1X RI0K! 00P00 R$ @R 0S$0SR4U %@%(%@%%d%\0<&p 0\0<' ɄK0\0<%\0<p 0 ig??t? -@P`Lp 00 d ,00,0P H< 0h$00 Q$9:(0Q9 W0(0,0 :S^l0S[ Tl Rp0p0p0:l p0 4P (0Stl 0R0p0p0:4p0p0l 4 @ 0  Wl9S L:SN m0 5 l0,00,0 0D 0 0w4(00(00q0?  p0 H< R0H0 W# S  808  <0 P<0 07eS4IW ??0??? -LM 00K0 @'@ qPP匐X9P]!\ "@ $#( ^_唐 ZD $0`KP P0@Y0@ 0H l h  d ` 唀`P0Hd 0c@ XBd K QHQPL@K`pK X9T P lK H0TKXY( hd d K ,L| x 0S @d K P 0Ld K x R0 S\ X0   |K| x  T@K0 PE06NPU>E DKT p t0##8 K 0 )|0{1 X Rz P KV(KL XLKX0S `P D ˠ| 0 p`/P\ 0 `"PD| 0 P `\ 0 PL0K0S @L0 H@ 0w @K0@ P@ P DPPDP p t 0 ##wdK\ X S026 |KMD `\`p| ^ 0  DPc` `WdV| ^ 0x\AG  D@|0 @P >aVP v 8|R㎌됀PX 0 0@ 00l 4l*p :嘀  0 0S S Pzᾋ?H?(?? -LMP@`T9q0X@T( T < % %L %| %L %L %| %V V ᘋ)0X)p 0\PVX`t0p9 0 $ ! Ki{VP? $ -@PL  0-@PL P 0PPX9\] ^_  p 00 M-RLP0`p/0S/  X)p0^0_p\p]pX PE] \0^4_ 8<40c@o  1.#@$,#Ƞ#$T$h? 9:;=P>`80<@K ??@-00 0 9 0@ QT8XH808 `:40*\:, ,0X*d:$ $0h*|:=%@0 0$00   0 00 S Se S $04 4cQ00S4 0088 0 ,"?P1SAO.!0 T8XH0@0 0s $0000$00 00 8PU p$ 0 0  ,0 < $<(<SO S 0 080 (K400  0K@ 00K0 @00 ,@ 4P@U^ p 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(D#Lp4 0 , j<00< 0 $ @ 0@ SV 08<04@00 ,@ M0sm 0480@00 ,@ >0 40804cQ? -@P`Lp00 C ,00,0$00 Q$0(0Q00,0,0 :S)l0S& Tl Rp0p0p0:l p0 4Q l 0R0p0p0:4p0p0l 40  ,Q  o  (00(00q0  p`P 00D < `唈@0 0??d&%?? 0- L0 y@P@ 0 <0<0rP0P00@(@ć00h&% -LrM#P@L K 0`, A A  PPppzK>PLs@ 0RP$.K0RP1 S02(K01SSx  Mm 0@P- Lp`AT !PmmU@@V@Y lP00S 0"0 MR;, 0R}(K 0pPp`405 6478<sc m\`!0p@0@` \ v y/KATS @T, 0 48<S ZL Kp`  LL Kp`L K`z`x";p`rL Ktp`j0 Q; p``L K0`Z$@DoqedAp?0????T?h= 0-L,0\@00P q P0 X) 0!"#4 8<90 P 02 Q " RP0#2 -LrMt% 0L K@, PPFyK=PP$e 0RQP :@T $0 UQ:L K,, 0 R(K.K0QP 1 S L K\@ 0+Qh:@L K$02(K01SS L K@ k\@1@P`0LK h@PX)LK5406748 <00@4P!(@,P X  8BH0  ]1X0 k@m0a 0 0 0 /0C B0 0C B0 @p X = BP0407 P!@! " # 00123568 9 : ; < = > ?  :"2Hn0"Xi dk48Xy01`d99 ! hɆSk   |=* Gk @ 8Ak00!   08   Bh90X)h)(0*+48 <0# #Ġ#+)*(0PY jV@ Pjj@W j\^L KPZ j@Doq?edA??0?ܵ??l?? =P? -LFM@`KO_Kp@1 , @KQN\Ky *\ @!  ˩\, 0R(K@Do= -LzM@`TpP@K z K肏K,lPU @ @lU@ -LM ,( h9i)Pj 4k8|WN@ P`?< L#?1SDOpP3400  D0 ,`P P0U|r pTXpr ^P☕0@pPq]@8& p 0^0>' K^0> ^0>p 0H@T `9`X  T????? -LMP@p000 `匀, 00v㸐,0V0,0 P H< P H< 0 ge0m$00 Q$<:(0Q= X0(0,0 :Scl0S` Ul Rp0p0p0:l p0 4P (0S{l 0R0p0p0:4p0p0l 4P4L C 0  [l9S L:SR ,(Ko0 700 0,00,0 0F 0 0@u(00(00q0A  p0 H< 0H000 Z X$ D00 L 808  <0 P᧐0 0ᢐD4H00  ??0??? - 0L0 0l0*lp :8@T  @T -LM00K0 @|.@ PeP`X9`]!\ Pp"@^ $#_` p( Tp $Z 0`KP 90@Q0@G 0H@P@ P ĀP0H ㄐ 0c9C  0 Q 8@Q㣔4ˉX0 0K0 @P0 L@ 0K0 @ \ P儀KH0 D@ \0K0S@@0 <@ @_8 4 d@ `P 凔ˉd ` `>@ VB K QFQP@=봀`X9pPKK l h lK KQ t p p(` ̂Y ʄ K e=H K  ^=8KX 80K0 @ P Uʶ 0K@  Yʦ 0K@  P l0K EP6NU>E ;|0 x B X \@0##@`KDp WGڴ 0 0 @ 1X R02 X 0S `V  @D  RO P R $ `Pp)90 KTt D^-`@P\p | K ` X t@K00TPˠ ppPpPDp@_W dKt0KQ d `  PK`P`P ` T``T` H0SP  tPP tP } 8@/pPvTt 0Tt | K pKt`Kp @pP5PYt`K| K p @p#PGt`K| K p @pPP6tKT  | K  P#t0K| K @`@  pPtK| K P pPY Yh  ~F(KY@ 0SPU@ `VpW@^3 X"Y .dQwdKt p rX \P0##@@P P@ P wH\ @  t`K| K Tp pH\@  FP 0X]T^LCK@0 pt TtPK`| K `T`ˠ  @@`pBPfD\`0@X) R+ \. ; 0 t K T0C0| K  P@`DP0OUʓH\XY RPU \^K0@0 @$ t pTNt@K0| K T`0` [` P`P Pt@K00| K TP `PpPD`VL`0@X- ^/ Q2 PU5 ; 0 t K T0A0o| K   P`DP0OUH\ XY ^P Q R PU\HPH\H^'!|pPW 0 0@ 00l 4崀l*p :帠 0 0S S P S{g(????n?4?\? -LMP@`{9q0X@T( T a%b%b%8b%b%b%8b%V V ){)0X)p 0\PVX`t0p9 0 $ 岙 Ki {VP? $ -@PL 4d 0-@PL P 0PPX9\] ^_  p 00 M-RLp01 cX)0^0_\]X PG] \0^_4 8<40c@o  1.p@Wp3$,##Ƞ#$T$h? 9:;=P>`80<@y$K?<0 : 0 0) 0 `:\*0 X:d*f%|k%d%k%Lk%") -L MP`p{, 00 E ,00,0$00 0S$00:(0S1(0,0 :SHl0SE Ul Rp0p0p0:l p0 4Q l 0R0p0p0:4p0p0l 4l9S L:S% ,(Ko5z0,04@ l@1(00(00q0  p $ ላ  ?0?? -LX9 Y? 8 9 : ; < = > &X y908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8<  29?? -LM  0_&pp% -LM) 0_&pp% -eL`Pp< (00p04S80,0d0804p 00 , 0@07< w&((0"4#220$00 (O 0i9=ԔB??WEVpp% -P L d&@ ԞpP` |1TI p1T) *`[P1T* H1Te/-`(10S ` 0 Т`P 剦`P0T$ ῢ0 00" 0`0 e]@ 0ce/H] 0V 4,0( m<`jrdAhdsd edAk~gdpp% -DL!88#!]P1 wp" D0020p(P00`4Q!<00@aT@!0   H<00d@0w@ Tw o辘0 <+0400 @w@ oBwH jԔBؔB 8 8-#TLL%p`P 0@# Нᐘj 8 8-#L@(PPp 0`pP u0S  0p0 pPj -L@_0③PPg 0@^SD喳 0H@K 0p SpP  }G   t>  0@^SiP2p/-t b l\h0`*`l0QP8=@Dot?0@lo???l?l???g(H?ho= 0-0LSP@t   0hx   T a0@S( K$ \R0S  0S0SQ+0@a$0Lv U TA00 01 m(KP0SJ }1 ^` nt!0S PPBXaTU Up0K0 0@ =00cP H 0 3,U`$0S@  @ 0a0CS0@SV P0P000 R  a0BS(0K +00B R0:S 0:S_0PE$0L000C SP0 \Yo|o?j% 0-@QLPJ @TZ0 Q-L`ሀp@00fT*P 00fS 0c00f000f0(o,o p-@@@`08PcL0`000p(o,o0o 0-@QLPJn @TZ0 0@-L@~S~Ч%%@%H%t%%@%%@%%%@%%ت%@%0%@%%@%4%%@%%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%%xx6 Q 0@^S)\V Q0q0 R:@0 00 `P0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q* 0004$0Qd帄0\ᔔ $0ST t吤T000 0 S\4T00S0  0 0 @04#0S*cC3Q`3 be#C0 0Sn0RR0B B  0S 0S S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p쑟000 0 1R R 1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @J ,o$o(o0ojęjjoj?o -P@L@PpP`P0P @D@PPP P  00`0o,o$o(o0 00o4oo4 P00 0 Q4#5șj4oo0șj0̙j -L 000̙jșj -Lt T8 !0@]S@00@ SE0P03P0cp0 QR`TWpD@T7pD0u" @/TA DaDU9070T0pDU A D00DR Sa0D_TS0oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@8M0J0hSp P@>\P_P 0?SC꘲%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%<%4%,%$%%%%% %%%%%̲%IJ%%%%%%%%%%%%%%%|%>P D +@<P*@.P @  j,o?8oo0?0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝo#o#o@=1s s080 080ԛjj; 0: 0Pკ@-44 0@0 0 @* @@}4#ojU= -LM   0y hx(%o -LpPL@N^ 0~, `0P`P`h,^jj4o 0-PPLM5^K< }40 0@0@^8jj4o P0-LP `1@T+00 -LM ^00p̠`0@hP \hl 堀0,0 ( @],K\] P@P\0 0S@0%050%\]$KwjoЛj̛j4o4#o4o -#LM0pŸ @ 00, :Bp PP] 00 0bC2S0c0S U 2@xP x| T](K`0D"\B"\ s \p 00,0&:#0 1 1b 8 4 @ `P`P`P`}p=8K !\!PP``dq儁$A00SA 4] 0 0c bo"oFS0c aR bV00S0 "^08PP C4PC2P C1P0PPUh] 0XXfP0@pP pt 0KpoERvo4#oj̛jЛj4o4#o -LlM蠟0P`(0 %UpK8K pK8K*eC*EU@1@#,F 0dPU`<X( 0R$K x@Dok#o= -pLM0lK @,0 P1 ^_KD0 0# 0Q \!$0S:  @06|[KJ~\@  | v|\ 0p P`<p@ P`x P$`p ]\ @2` /@, 0R (K^_Kn 0Sox@Dooj4oj(= -LP`p  >PP  P@1J# BYpP  00 RA?P PpX >yV -p0LP \0R E@ <s00 hs !ԁoa0l%oo% -LRMh@0T`$0 $ 0RM K  > TpP1Q$  Q@1J#U YK @{ X@P U{9>X X@PQU@ YK@`d ydPKYOK@D@?@ {{{@QPw@Do4=C-0 pR 00P`U%  p00 N @ l3)^Q<0PU hl 0> n1 ^2R P R 8 - Ql08! j00Re R0O4P`P` 4P8`Wl004PXP X< <p* K<0PlD"[0R <X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Rx 0Pz0K |K0P h `@800 j H0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@lL4 K0T0}@0ATV ^< t)#D06040H0D 0  H0t0P#D@0 :@^^ `P`p4P8`2@8P 8< d UL0.S#%@DP@ L T pX :LPH;8jHt TN8jt0< t"D060<t X@L0T04 K@P>V UF40H0d1@0P 04 O0tt H y\@ @p0plLP! Pl0*0 04PXP 4h 0K 0Pw h0Sl* ;0S9@0U5:0S\ \ 0S 0S 0S0P  R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00KP0 H00@PQ -L4M  $0 0<0 @K;   1KB KDj -L4M0@ $ @K <0 3 Kj 0-L M(0@ P b$p!0S(0 K0S   00 p $ (0!I(0 u@ F p-0L@`P5 P00 x |00  000p0P x0P 000pP00 x |0 3.Px(P 0-@LPᆘ 0h(? p-0L4M"`@l1Ph P 01`l1D P <LK( 0P H0 t  Kp?j 0-L8M @( ,0 xP!0Kp!H 0@ $ K0[S< L@KLK0L@KH0 0H0 ꔝjj p-0LS@P p R R`d IP0 <0p`8>P0 S 4P ???0 <#<0@0  p-0L@ S 8&T&\&&p&&&&&&&&&&&&&&&&&&&&&&&&&&&&& Ǘ"P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ $0V0$0000p?u@ZoZo -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\ &\ & & & & & & &0 & & & & & & & & & & & & & & & & & & & & & & & & &h@`T  y 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`p@`d0\@`0pd `㸐 ᓿ@` pd@u@4?ZoZo0@- 0P840 . p-LP\ 2=SL` ` R1 CRR6 1S0S&000/V0 ?! 3Cp?! 3$CBpB2. +P0S / P ꌶP -LM0@00 !@K -L0ML @00@ 0 D0 H -@A@BAH p0#L@0S40 80 @3 H 0#280 -4 @8 D#0<3H0P`(S,cH0438CD0h @ <0 <@T'# d1PS L0 R UD38@0c0L40 00PiH?0 @L0 <30n-(K@Q  0@@ 0PL0K0D~Pl00H @PT  0@_`/PP``(S,c Tk0Xg !0T"b0`L0 04020O (,#d1S& O,Q!0S< ST d1!S000 *0K  p 2[2d!R!P_`e!N0* K *0[S2 / P PPPW !/ !/ PB0K D0PP_`)4,@02!/ ,CRqu@ -LP 0 00e>P0 h]> -<1LM4@pK(1pP@!, @uT00B`@ dW, K P , 0R'(KD| K0x t |@ PIK qPd| K0|@ x t Pp P000 c@Do?|?ā= -LpM40Q|,0   PKA⛼`dA$0h 0 @ 1|0 !x 04 t 0 4p 0F l 0 0S0h0 4 h @ 0d 0LK0`0 0\0  0X0 0T 0P 娲 h  K1 P0`P , 0Rn(K01 P0K0 @=10 @ Q0`K PK` ` ؀ Ȁ 0 P `P0S` 0!00  K 0 r=`P000 i=`P 0!  0^=`P 0! 0100 嘀K  P`P@00TP T   P0P@T P`b@Do?؁= -"LXM"d0K, d p5PP pB, 0R](Kd0h Kd PP`@K4 ᶻ `4[ 0RKYPKXPKHP @P    00000 n04 8 h X T*"!Bp2P@@00 Y 400 00 X T*00"!B2P@ hY@0 4 00   0 <.>, 00 0^nP`U TG*AT1 @f0P  00,80 (KT/*. A.0P @@0 0 Y D400 00< 0S0c<0la0 , Nc@_@[@bW@y[&Z&PZ& -L0M 0 ) K0 3SP`%PP!10C8S1< R (KBB ''  0@{P &01 1\$ @pL 0 Sm*5  0YPbp\ @0SY SLPL L 1S D L0SYE D l3 410  0 D3FP 03\ @)pKp 00K \PP)0[002Sa0H @<0 80  pQ QH  Q 2pSO0 @<0 80 QYx P}tDP( L T{ L 0@  c4 8K@ &HD 00" 0D00) [ 008D1 %_ F80!1{80! 1w !10>0>0 1!D4 8K 00b>01 ! ^x 0L0lQ@ DA@ā P(0K!    h 1t>00>0 Sa1Q>2=12>303h0 5X) 0! 1 1 hKP Ph DA! h0\ . 0C0b!0@@DA  ! 1Sʴ#[R@@Ё R @8l h Q\)  0 cd hKlK d0KH\:h0\d%* d b 00b$1#[0d0 hdA  d   P |S@Do= -LHM@aD1V@$0 p 8Q$K 0P tP b${ KY${>0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 幹|o -L@P @1S<@ -L$M (18 @ `@ 0SX +P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S% T L  0L0  T LL @T TT D H 0;00 0 40  8 = 0 0%   ,*%,K.p,%W0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P L0 @(1? 0(1 #?< #0 0` Ȍ. qΌ@P 00 `.Kp -LM pR`$K0.>0 0`. 0 @P`0 `P0@ `  0`0 `P0S   . . 0`Y` -LM @R`@" 0:#:S%0:#:S z'zW 4P @  @ Ȍ PqΌ00p @P K0@ 0-LQ@ P21C 0 P  QP P0\0 ?!00P0 -0LS`P pP2C@0 0 000 R00P0SPp p-@P00L? @!"`!Bf 0P?!`p p-1!1!0@ 00>0>0PL 1/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPpPZ&W0|q06q -0LHM,0 0@ L0 T0$ ( TK BP T0 }P P $峁 K寁@M??? -L8MA 0R<0 0 !M0S $0` a1(K *0!@0P0 `PW ,0hx0PUL +0@c 00 其0`Cp0K 8@ 0p |X.@F 8Ku80 PKD KP0 L@ Hp P% P OPU 0- ,04 KJ 0@cs 4K3K2K00 N<@ `F<K F(K,+($ @Fo? tj(?8DokIonJoIo 0-,0L 0, T 00CS0@P0S 7,0, @80h`6IoIo>k>k -,0L  , \ 00S0H0 R 6404 @,0( 7h96IoIoIoIo>k>k p-LM@ KI  0PQ@c=YB@DB ]BT00U00S Kp0Tڀ0`[Td0@AAP8 41Cc0A01cBB p-lQ`LP ,0"  L1 R* @00CS@0,)LQPp0@0S0 0S0S 0MPR&R0@P `80S ph8@00CS@0pAU000 0@@050S0S (0LPQqIoBIo!33 -L "x0P l l0@@@7\0\QT00S巴<<0 R@h;I$S|p'Io>k>kIoIoB BIo?-A" J1S 1 0<S RZ20Q^1S100S^0Q:0P(0 p-0 !L$ Q$b1@sP 0<!0 ! 0U 00C0p0 #  1 0 10 0C0p 202 (("@00 0-0LS@P P R000  ! 00C0q0KoJo p-LM0`P@P P \-P Kp 00 0 0$( $ 1K0 , $01KP K0900 00KPP 00CS 0 00K@P01K09 0 -LM`Pp Q B  Q D00BS 0 K0S@$@P K40K,@ (P 4@ 0P K  ` -pL2`0C8#8S2? P@U R 00 0 PU@Z000S0202S''P P8P@P8h8q'00202SJo 0- @LqTP @00 P {,\jX00@2000CH 400  @2$@0Jo?j -LM,0,0 q`H PK PH,0 P24 0SbH0@ P P 0qQ 0 0 @߫ ۫ ׫ ӫ,| 40sc Q@PPQ 0@S 0SG PQ 040< 8 @ Q@PPQ@ R 0s  ' PQ@ <@cTڃ ?@cTT '02P" 0R q' 0Q'    wJo? -L Mp 1R,2P4 , !`' @A GdA@   >,0d70SP020V400(K040 042!Pb, a' PQ0 ' @@B@BA 000d@@B@@A  d00202S';'80'10 -`LpZPP ` 0 S  S0S<0 ``0BS 0-`$@4   `  -LpMPp"@P ` 0吀K0 0  0`0CS 0 V  KVVP@` p P` -L `qP@1 00qW 00 000   Q$  0R0W0S 0WP( 40U  1 2 1 1s 0U0 P00 1 21 0-@ MLPPPPT 0PJq804 P@Aq0@K0 j?Jo?JoKo -L(P p, `^@3vP9 00R2 0s% 0` 0 0  00 0101 1s 0U0 P001 21 3 R @0R  q -LM0 000p0$\ 1! Y 01 0!,0 X0 R4 8 \C:0BF  c03P? ᇟ2@`v`  V1@K0 SSBC  c03P< n2@pI00 0$ P1! Y 01 0!,0 X0 R4 U Y(K@020Tp 10 pR@ @Tp 10 pR@ ڷ2,^  1 @2 1 1s1 21 0$ ^ 40R00$8 0 0$B -L0p `@a@ @0 @P0` P @g (K @>0`0`,K@0 @P0` P 4, 0, _Tj -LMp4 8 @P 8K` ɡP*840 @10@0!0P,0 P@8 ,K ,P8 0,0 B0R,0 P8  ᢡP'00K@ (K4K  㔡P`@Z`J,K ,ТP0 ,0@T0P,0 ` J |P'00K  rP -L M"0(0, `PP 0pWx W P8ic g(K0  0@PPL0$0! 0@;00 0 PP1 I 0  0PP ~@0 Pp0 ,K ZPP:, 0h0b 0 RP/Pq@ P41<  T T (1#29P0 pS00S 0S T P P @ 0S* P80  0 _8`bwPT$1 !SP#P3R0! $0S UcPaD|ojj -LM0X T2 0\" 0 P2 pP (KTTJ,` X"c0? 0 @ lp hp p d 1 ʟ8" 0K < 02 ," ">K K Kq 4r q q (r $2 QTbP P" 0@\Hb(L'b<? `X  RLB LBP0S 00S00?  R? 101 0,1 ', X2PU Hr , R 0 HPH 00@`d,K 0` bP00KP p?W8pGHr LW0S | ! 0H"0 00010L00a0 !0S00 pr 1  !81 P p041 K>0#6`001t0,!0. "&h0d 1>0#6l0(!x $1|0P00H"1cL@KD2 @ H  KL2 $P = `P0 %QaP \aP" 0@5L'<?  `p?Ppp 00C { FO @ C#,ahT0S0# X00 cT2C 40T"0P@@1`1HT,00 Q0Q `80  P`=0 00 0  T",0Y#L'.\ a 0P"@T2( ,0S KP D"\2 K ( PsT,0  F!<?G 01S# L R  S  1 3  1S30D 0R K  101` p  &$T2@F?T0000000000000m#`80P@0  0 000 0 00,f 040 P4  X,; V`T",T244 0Q90Q6`~5< K4K X@@Ph18KdP& 0$ 8 P'h8 <00<040@4 408 40$ 4(00(04  00CS 04 <4 y, <4 o8 Do$j(j|ojj0ST0  Q 0(0 R 0 0 0 $ R0 0$0 0$  w=1 D^P0SPG x]PB@ R 0T 0000|0S   L~P  R?4?dUokjL?Bj>kXjTjpT?To' 5$Mo Mo Mo`Uo\UoXUop@B\? -LM 0   K -LM0@H ( $ 0@@K& p-L MP0L S`@Kp0 $K0 $0 0 僗@P 0$0.@ `m@& p-T`T0@ TL 00PSP0S@Tp輰jDMo p-d0L@`TP p  mP $ `P@0pcDMojd? @P-kMoİjMoMo - L0 0cC61@PH`DH04 Sp \31C R0PP00Ph@ $0&h7MoMoMoİj -L(M p4 @. ,2W ` x 1Pw(K0W `a`RW `ASQE, 0S @00,0T0l E W>0ÃɃH!>D0C64 P@00 6R80  0PP @@@OPP"  Y0 0cC61`0 0@ 8 0 iU *ii 0U :^  , @` 4_(`MoذjMoİjXjMoMo??L? P>0 à 0Rl PR 00S 00 p-0LP`@V0D  Ppph* -0L(!(M10 p  `@0   PP0S (K*@8K" 0P * p38K1+  #8K* p38K!+8K*P q= -L @ hP -L@ h AsP -40L   @fPhq -L@ hs QP<0S8<0 -LMbp<0 P @2Pp8 p (K)0 N @V2`00Dp004P,P0Sprp4P 4 10S 00<000 00*  4, 0 00S8<0<0<0 k? jWo R0"  p-L@ `}P ph -LHM0pSPPQ* d`KH @T r@TT\ K0@H ͊S s K@ 0t@d`KH -QLM`?Pp 0R P0P@0Spf00C0 0p0JS D'8'@'@'@'(''N 0SE @ 1QI 0SA Z  1 ?Q 00SZ0T1 U+(  d0a. .  0 ?|0 t0 0S@0S0SPT a 0dU$BBjj p-LM@(`KP 㕉P UKp p-0PL0\ Q0^00S0 @TcP@ o@`T .@Tp0 0\ Q p p -0LSPp S& S P:Q  hP; P @T ` @T`V0S0 000@T `,00 Q @TV  s`0`Uo p-0PSL`4 S SP=P (^)^ 0N0ppp0S0 000\ )\ ,0@0 Q0^ࠡP QP P )0^ࠡP*0`Uo p-@LPP0 <0l1&`P| P0Ta&p0 Q p|\ 0$    0 apXojjXojj0@-P0P@0P0B2Q 0 0\00j0@-P0P@0P0B2Q 0 0\00j0@-T0P@0P0B2Q 0 00\00j -|0L RBQ P@  0P0SB{0j|Xo 㝍?k㟰 -LM,0p `410 @ P,K0!!.P/0Q$ P- `Q #U00V0 SP`@P0@St0t0P 0P R0S<  0 @XoXoXoXoqXoXoXo -LM$`K O 3bP$ pQ[@P P TR00W0SR00Q0#S PBp@P ]XoXoXo-!P0"0CP0 R 0 00\  0  X R0>T!00T1T!R9Xo -LM$PK*`q )0TzP@T@PV 0x倀 0@,0 @T ,0TW00V0Sp`XoXo㈯ -@L 0@?k|Xo -LP00,P0!00 @\\0$@\@T1   SB !1R,40S23 , 0 R[?Z`U @, ,  !03P`R F J, ,[?` Z @W,  [?P  @0`@%$ <8,qj? -LQ@Q 0,  10 OP,0 1 1<0 -L MP,0SmR0 Ar[ RY1P RS ,0 1 (P1#@aQ,0 g$ 1H10,0 1, ^ Aᩦ 4 F000 I$00Y00S @T T @T,P 10`S{ Su S@C =T (KoY ( y40S 10S (KNHu, 4 A3k000 Ae,bAO,@  0S00ʅ 0 R 0,0 ,0 ,  @$,p34P00SM0P00S@ @A1[?㳀H(Ko,%12S201Ņ"0 ,0K X 40S 0PX0S ,0 ~,@,P ,0S@ X0S@ 010aAAj n - L N -x0L@T@T ,0 ,̥0$ 1  @T`Uo -LM@,  P$`0A s  hd\`Q Ki!00000 10! !1 1 0U1 0!10101 Kj Pp-L`P @T U  ,0 j@Tp P-L@?P  h -LS`p) T1@TN @T 400S, T00Q0S 0PP W f@TX* R P$ PU PU @t 40S,0 R  0%P W 100CS7`Uo -LPp`P P U 0 R Q 00S U U U  hlP @T0P \ 00S U U U @T U  -P0 UL@p #R#0R = B @M`P  0S  B`P ,0 0P  U r R 0ir 0i b0i @B$$10CS$10$04>Xo 0-LP >$J/@<0$10Xo 0-$0L$!PR @$@0 -`L$P!R po0 @ ! 0 !1@ A T101!0R1Ms 1P 0R 10P0j -L M<< X4@0 ,J 0@@KYoD' j?Xo p-L`P @T @Tp@T R0000 0  R0000 0 -pL@` P%P W` P 00  00S00@ P0-LPP@@@T:P T 01 R0D00G? 0-LM0PS Q@ R  R 0A@S0@ 80SK` {P  0 B0 00 0@@ 0 @8S0 -pQLPT\Q 0 0CW .\, @ R W`1`!P$0 70S( z^ 0 f0 0 0pf0@ fW0 @P0S  0{ 1z ${q -LM0 K -LDM 0P@, H0 D@ PP #0S CPU0L0 ` P`P n`P`U`L` pP `#P P3P @1`,3 P3P  "P`Vj p=KB 2R20L g"D@m2P Ppm,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0`TV @ (wT @HK mP A @0 B C  D! EFG@@DW00`C,00, 0PR=(KU 0`V Pp P P@6m,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0~`TpVn(@DoȱjooбjԱjo`z@ ??= -QLM@DQE i`PC X:@09 100CS8,0L5 0  0R5,0S) PZP"@P᠐@@ P( K0E0"@E0p0@P (K@@, ` 0y@@P-P  0S 34\^ yQ0S :P00 (0q -QQL Mp`1Q1 $0K`P) @$ P ~$0( $$ $ ,0(0,@$0 400$84$<8$@@<`: K(K`P ``(0@ ( l(H }(0` `\  0w` -@LPp`lT  0R U T  hx  M-PL0 0S R K P ex -PLM0  0S R  P  KOx  -QLPMQA0FS-'P Y 100CS,0 0,0S (K  l P00P0 =1X 4 @ PHK`0 \@ p80KlhKP 8 TP h0 dP L 否PV V V< Dx x H@0xp0 p t 1 0 0!^,0 A aYt,Kt wPbp00KT d  @P80 l80KhKP `@ \P X 4 h0 L VPJ0 R= :#:jc0T0 d0 0@P8K lhK`@ \P 8p 4` h X` P L0 :P.V2 0S@-0S @T000Y(, wP ,0 0T ,0 0 0 00 Y(K00 t wl宾P@LJ , mwP ,0x 0^x ,0 tt Ypp n D0 <0VV07  00 -LM0< &. pbt   0@ 0$@(, 0@ @004@ P`8P<`$0@@0D@ 0@H0L@PP`XP\`(d,,000h00x0000000 00ˆ04ˆ0|<0S0 -01=L  00 40=9 =X2 01A !P0[0T  <0@1A8 !1 1!$!$0S1(1$0S1,11001 M?3!C/ 0 0 jF N j  j0S`00`00 S`00`01 0BRS' 0S X01 `01 h01 l01L1@0@1 0!x00| 01 111!2!tQ  iX0@X1\A0SP0@2DB100CSL0@1A!!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/!0O2B/ "0O2B/"x0|d1t P= @ @ $0@H2LB \"04 l 0S04 p 0S04 t ,0 Q p00|0S00C|00@P0T@0|001 0BSR 0 08 K0K,8K !1(KT00X 0X2 \00@d!l01 A?B -LMRD0 @ D  Q8 PU `V&U0@ qR1,0 <  & ?< 2@@4 0 T2 10S, 0 R( WVTf'|f'hf',f'Te'f'e'|e',0 0 0S p0S,0#80SVI00000 , R 80SVN00000 @T4 RU040 1@0 R @0 Q @ 00S 04 R @,0  @0S @40S @<0S  (K<<  uP8  e`F8 < <  uP8  e`F8 @ R 0b0 SD  300 100D 0`UodUo -LhMp o/rW| 0@  (0 0  00  0@ 0$@ 0(0 ,0@004@$P`@PD`,P"080<@,HL 40P0T@<X\ D0`0d@Lhl 00CSJ i'j'j'j'i'j' 0 0 R 0@80<@W$x0@p0t@0 x 0|04 0@0@L  LQ ` g 0 0 K\Pt0O0@pPK`2D!0xP`  R 0F 40x10 00@A40=9 =1g R0 !(KZ 0y0000$04 t!$0 l! p$0< `d!@h$01 !0@1A 0 1 0$L0S? @1AT!Q $1S# S S 0@X1\AD0@(1,A#0!,0410 8!40<18 @!3D1 H! 0L1$ P!(0T1 !|D0@(1,A#0!8041#D!(0H1 !mP0S 0@1Adj -QL,MH0 Q `oV RH @  @  0@V8 (Ko =oV01o?#TD <0 n TK T4  DX4Y0!0  H0S 3#H8Ph7@T P4 4  4 @T 0S @ R030#Z0S 0D\D< FsP@PfJ@ 6@T , 4 ,0P ,0S 10S S 8\*0  Q% @T80s{ 6@T 0 4 ,0Q0, R 10S S 8\g40 Sd @Tup\ @ R030#Z0S40040 \ @P030#Z0S40040 0<\ @P030#Z0S40040  RP40040 PR0Q (0@P030#Z0S 0D < D,rP ,@  f, @  JDp\ @P030#Z0S40040 \ @P030#Z0S40040 \ @P030#Z0S40040 0<\ @P030#Z0S40040  R]P40040 PRU0Q (0@P030#Z0S 0D Q< D0;rP 0@  f0 @  J 0D9D,< #rPQ,@  fJ, @ F 0D#D,<  rP,,@  fJ, @ ! 0D D,< qP,@  fJ, @  0DD0< qPa0@  fJ0 @ V 0DD0< qPY0@  fJ0 @ N 0DD0< qP(0@  fJ0 @  0DD0< qP=0@  fJ0 @ 2D Ko`Uo -LdM 0P  PH U00 0(KS񟗐괁'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''0BMS ''ԃ'''''' 'І'''h','P','4'T'8'8''ȇ'T'̅'''''p'L''p'8''''l'D'''p'L''x'X'8'''0'ԋ',''l'H'(',' ''Ȋ'',',''d'@'$''ԉ'''d'Ԅ'''''<'x', 0R(K 0 0 0ʟ 0z̠ : :A :p l:3 T:,L 0@r(ʟ 0Dʟ 0;ɟ 02L 0@I@ 0 P00CUSzl 90 Su @_`pd 0!ੳr494)fL 0[]ɟ 0Tȟ 0L 0Eȟ 0=ȟ 04-2 \8+ % ɩ ʺH0MK 4 410 ǟ0 L@b0W0P0S 7 ꌧ0 0K PW 0S0ŷ S40S 7 ǟ 0mƟ0 L@$0W0P0S 6 6F@ 0PFP0S _/L 0@ ,Ɵ 00 Ɵ 0'ş 0~50S00<1 <1  O?KXn5\ 5R/ d0 S<0V] KOK elSL 0JL 0"Ağ 0P8g6L 0/L 0&L 0dL 0<ğ 0 Ϡ 4ß 0ß 0ß 0ß 0ß 0zhß 0q <3A0CNK 08 ^P81 CRS0L 0+  2` 2|hp 000QL@o@T 2@e{L 0@mq 0i 0aL 0MX 0P1^ 1R  0(>$ 06 0/G0|D(@Doj4oU=PU=HU=4jjj4B0j8Bojxoj Ba [oZoZoZo$BYo[oIojBojqԁoa0(Bj4oooKoj8j4jTU=j$MooIoqjȀo -0LS@`p3 0S$0S  0PS'0U 0S PPp0S00S0x$#0l:"0S T4"p0 0*"i#"꼴j??p@$?? -QLM0p0 4 ,0 (  0 Q0$ `0V 0  P0S 0S 0C8S  0J@0 5R 0Z P0S`V`0 R , R $0DS 000!,K4K^!Ȁoj@?T? -L M`p\00 @0S @200 0S00Wi 0 QP `b @ 0,0 Q0S00a 00 P W[ ` !00S  `1\ 0S 0S T 8CR0S00 S00 0S\  ,00 R S00CS0l h8(K`Pf 8CR00` *!Āoj?Ѐox?Ȁo< c080 4K 6Q 00B0 S>?( K Q02\ 0A1@T (0 P @  GP+ @TZ \ 080 aGP0.S a0BS8 a0BSW0B$Z@Doox/@`z@?؃= -L MPp`r* ((0"4#220 $00 D,KP 0 @?(K, 0OP ,0轣P 0t $` ,0 I,册0<  0,:,w p?qedA ?? -LM`00PK  0 FP 0RK00[S  00C S00•0SLpQ @@Q jFP101@Doj= p-0LM`@K Kd0 _PP"0 K0 @@0@0  K0\S QT0 QL0 QD@0 0RKp $k@Do!&l1h?0L?= -PQL`. 00S`S%p0@T@T 0S aFP00SgP020$ 0440apCWPE@Ѐo -L@P TP0@T @T 0S$~@Ty?Ѐo?0@ -LM0x,0 ` P@T $0s (0r @TU 4@KOl EP RTL <O(8000(,(00000SY PP0 7@PK$88@#D0a'$BE 0KF@P VPPpT00S 0S V 0Sh 0SO <, 0R(K R 0S(0 @ +O&P0&0T0U0SwƟ0s0Sg @pPP0೼0  " 40 $< 020$ 04 6 %ş00a5 0W 0S! |$ 0#(("#4@! | ,40T,((0 "4#Q r  D0R85 $p + 5 "88 #$0a0""ep 4 "88 #$0a0""SQPpKMV H0Sx |CxA @OxCPIx(<DP 0u03V0STU@E( K0^*S@ K0 PP 0S$ 3\#     @xQCx\JDP X,0S] S7 @"0 0삟2TPPp㸀K 0NAPP XDpDPa 0K,P 0S \ @ T@T@T $0s (0@TCP  ((0"4#220,00ă\ m `@P 0pP@ P`p幙M CP pW (0 P @ CP @VPP}n@ [,`@P 0P@ P`@DooooDk8Do$kh?D?B?(k,k4?'??0@??0?@??`z@ B?l??h(@,?t?=??㨻 0-P@L,00S,0 0h`E -LMp P,00Cs,0P 0K3,d 00`Q`=Bl0 B1h @BQ=9A h =C lh l0Z00K`0d@)U /PP`P`80 0@80<@PPT`  (y(K /HP`P`00 0@004@HPL`@0 0@@0D@?B? -鰀L0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0x  0rjjj$j -|0L0@S PR 0D00  0 (0 BR %oooo(? p-0LM`@ T P@T $0S m(0 0 (0 0R Kpd0K KpP(0(00(0)o@Do = -,@L(00(0D? p-LM(0@P; e 㩹P7 X,``00 U@0 000@ 0$0 P P 020$ 044$0$0s H `P@00S xooo'oL? -LM`D 88#|p 0 @P,  L00! 10  @, a0 ሀ<  R `U 0O  < ?0 R0Q4O0@ @L Q: U:0`)p@0@P@8 P00, 0P 08 0Ep`,@P 0 04 0@` (K< (0R 0 f($=Ti(?@?????? -LdM\@ <0 p  <( 4"4&, Pd< ,$ !$*,R[04!48#8S R20Y *0P!QE 8 040 (@LP@ ,(T 00, <\0 4 l0d 80\<4 l0 < 8,t X <0, L̠H  X0|,P0dT0T\0Dd0l0Čt00$80p40t0D0 (080 ,08X0 008`0 408h0 808p0 <08x0 H08|0 X080 0#dX0#T`0#Dh0#p0#Čx0#|0#0#$80 D #t40$H #$L ( ,0"l0 #\"L408 #"̌<0H # "0X "P >P e/PWEVoo -LMp8  0 RT$l  (PUl l(K0@ 0@ x   K0p0 p t0 0@ T T` 0 "50 A$,0@(@0 00 904 00<@cPl x$0 PH0ohPK@ |Hx0l s 3 @00 H1!4Sqa 08@K|0 @ P9  Ri @0@@T(PKT` 0 ᛐ50 A$,0@(@0 00<@9000bP4l $0 ᇐ@K0H0 K 0)l 0sH 0S S0S  $0 oP> p-LM@(@K`PX0K P  0 oKpX=8> p-LM8(KP`@ 0  @K ` oKpx=P> p-PL@X0`0 Foph*D> p-LMX(@K`PK P X0P o@Kph=D> p-LP@`  X0PpX0Pp -LMRp0 S`( - S& S ZQP|1@T (  ( T0S( T0S @0T 0S (K?ZQP0z03Q0SPP P P dM30 R  ? d?j -L MX0` $@\pd  l0 *@T P\\@TP @@0S  0A@m  h $0d 0a $K`[ d $0T`@T   XP  0 AF ?؁?x?0?? p-@LTP` `@ @`T@T  @`T@T  @`Tp -L8M⼢ ( pWaWW "24 2`Vkt0Sd 80s 8Kd" d X P@_e$ @ @@@Od $ P@P_e  @@@Od  P@P_e  @@@Od  P@P_e<  @@@Od h P@P_e4 H @@@Od , @a W `V aWd X0 `V( 0R"$K L 0 g8K ( qx p@Do? @\@$?j(@?H?P?X?`?h?0?????????????D?l?D= p-L4M`QPa l0<M X0  @TY 0 0S0 ``` 00C 0L0 0CH L0h0Q @ H 5 \ @00C\ R000  R0@0@0 @Kp08 0S0 R000  R 0@0@0|tLK 0 (` @0>0S! ! ?P11"p"l00``0SS\60D D0D0D 0 0 C0oo\>j? joo8(9(:(9(? P 0Qp21C c 꼖o -L MtptP`@F ` 0S 04:`V pPKL?ko ?> 0P \| 2 1C cU꼖o -P1LH1\@1Pp  U00S`@! 1 Q X00S@Pp PVP$1 VV$W 0X0Q0S U   H PW \ 0U00U <000 R {iX괠ooj8jЁo -LlM  !OQ ,   pT T x p PX x%PP00oP h0  h@l0 0x P d0 `@ x t  x t@ 0DZSH\(\(\(](\(\(\(\(\(\((](D\(\(,X(X(\(`Y(X(X(X(X(X(X(X(X(X(\(\(\(\(\(\(\(\(\(\(V(\(\(\(\(\(\(\(\(\(\(U(\(\(\(\(\(U(\(\(Z(\(\(\(\(\(\(\(\(\(0[(X\((V(\(\(\(Y((V(\(\( Z(\( kl00l0 l@ l P 0@@ P` `  $ll l l@ P0 P` ` ll l  l P0 PoV dP l00d@l0 00T00,Kp } R5 ,K2p 51`:R ,Kd`Pp@ `0U  S\  \ l@\\ l| h\ @bTZ T W00 S 00  v @DT`Q Z T W00 S`@@ 0 b |P @eTvZ TW00 S000  N @Dh P0 bh x0l@@l@ 1>A Pp00  c`p0 l@ 0Rp p000b ap  bd`Pt@00Dx!0000@ Qx t h0 x*P 0@ \t d x@0P!0t 00A 0 \?d0 x x l00l0 l@ɟ X ^ PP `l0  00l@@  ` l@ ` !x0l@Ll@ bxl @ l \x0lPl@l @x0 l@ l Pl  P0P 0O 1P0P0p0 p7Qd0P Sp [ #+P] p@dPd UdP\ \ P@`@ `` l@7 X0 lk P 0@P`@ l { PL0 H@  ` 0S6 SL S`H@L0CK&@@CD R Z T W00 S   [ @Pl 0 P`l 0x@ X 0 t@ ` xl  l x+` PP0CKP p \P C0KP P0 `\PP `CP0P@00 `ctPx PCKp \P CK|` Rx0x@ ` xl  l P0P@0h0 h0\xP0 -Pu`` <  @D|T@W00 S   pp PU):p0Z h\ @bTuZ T W00 S000   @D0 @D`0 @Dl h \0@cTZ T W00 S 00   @DTP  @Dl2 ZW TW00 SB   $,Kp %2X> &BP p0`cp0  cJ` rV U-Kp ,K,K @ 0 }0d 0}QP` @Dp@ p@00 d0 P000T0S  Rt @ ;  06t 1l  cl@` P0 8CXo dl Nl @K P@08#X` (lNl0@ P@0 尀lHl  P 0 L H zl l@ P08#X` l  l @ P@08#X` P0P` P 0@P`@ P0P` P@0Po P0 5P0 L H 4@DoT??8?@?0?=(?? @8Q pL0H@0 `P  P@ l@2A \@QLK<@00`!0@^S!0@^S^<,Z9 TW00 S  j !0@^ST@W00 S  [ !0@^SZ QpT)/P\ dP?\0 H@L0CK!@b 7l@ P 0 8#8@L0 H@ HL0CK "Jl \P@0 P0 L H ^ Z TW00 S>00}  zPx 0?d0 P0x 0P0 -L@MQ  K" 0(@ K 0 K(90 --0 L M0CQ0  0( K  ! K0 K( 0 0-LM@TP 0P40@ R 818 jo --LMP 0 ,0@ R ߼K jo -@Ll? -LT@ --80LM Q0 K贛j --LM 0 K --\0LM ,0 0 Q @@ 0  0@Kq p-LM`0@< 3PK0 0\ >3[P @ P >  0RKp@Do@= -p-LM ` 0@PP PJE00 R0PP >rKṕo -p-LM@ `ҹP 0@@ @% ,0 R0@@ MKṕo p? --`LM0PSP pAO d P PL0 R LI}9R,@ 0@L괠o?0@,j?k -@0 LH@00S S S  RhLhR?4j? -LM  0? -LM,0P20#R0`0!!R b1!#88P$H*0pK@ 93P1[0 1K3P  -0L0S  c1 #880S$H:H1D0H1,[0  n - @LT`pTځ @ P! 01 01JE-鰠0S㨀 p嘀` @00 q0 pP A8Pq 0S2  0S 0N0BDj@jBHj, ,0,0Q0 ÷ \jTjXjo-000 \ 0   \jXjoTjp@- `-R PP0R @/ 0B RS2R0  T ! 0B RSR 00B \WBa0BSA0BS70B Tp/0 S a pp XRxR @@0 @-PaLQ`pࠁ@@@a0LS*\0 0@0 S008C8!0000@ 8 R#8 P P PP@0 -p0E L`q0Shq(\q(Pq(hq(Pq(4he,hb$h_h[B@?T??@0S400S S IF C8}(t}(}(}(}(4QT"(1 T0`!10 0 0c0C1 0S/0cd0Y:g0hr0ho0hk0 e@dA"OpZ0 LR@@M8J@jBDj\B@B?`B?h???t??? -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rp,eQ sQ dQ ,Y h00T 0 SW@@A@jLjBB? p-LM0P S S` S S S S 0 S S S S S SPx@KP @ |x0 S S x ?? -LM R R00P R R P R R  08 R R# R R R R  P R 0S=8@ Cx`0 08 CHT#h"P0  q"8P#800 08 CHT#h0 8CHt Qs (K,`KOPs A>HjȀB?,? -<3LM `R#$SP3 P8CxnTNT U@yTYTYTyTz (K(Ko 8C800 nTNT xT@lyTYTYTyTcD2 Rp @P( p Wp 0S$ QY` P0 sp p0ps ㆘PZ @ +,@ x0 8s dPCu08s<lY0 0%0(Ko[(KocvW@aA00c10I0 0c10 |:(KoiP! , P,  ,L(Koe@jDj\B@?0@t?BBȀB`??h?h?`B0?@B?P? -L8cY(Cx2B  "0`S* @P 0PS# 0 P0 ;!PW WQ W0 S0SSPc0ISFЇ(ć(((PQ0SD@0@S !PWc0ISl(T(<((cY0   0@004|00SS P@LjB\B@B?Dj? -LM`p(@0 S SPP S@S(K,KP0, R ڜ?P QPqP |2p 0  P,00aZ<tf 0?o@jh??B? -L0MLK(8B(` T Cx)#3 Q W ß0SأP @$0 @S P0  C $0PPS @U ,PKpa 0Pm,@t H# T0(i PKtKY,0sq aT,",p RP 2"PP@ PE 71U @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0VP0  P0S S0WpT(KH@,@T0S @P 0S 0(P0  P0S S0UP p0@S 0S 0 P0  kP0S S1pTA@jDjBL?p?BB000 ,,KP, 10 ",K& K(0K$@P,"[2[n0@ @P,,0@ & K(0K @Pf"[2[,f0@ @P#,0@ & K(0K@Pc"[2[,M0@ & K(0K@Pd"[2[,=0@ & K(0K@Pe"[2[,-0@ `j?d?jD? BH?B(? `f0@0ᠶg D``^#`\P000f#?8o 0-@P@L QD@@@<@@P 0Ⲹ04 0, 80($ 0 -LM`P@Ppp@P (K, ,K8 Kv@P@,0 ,08 ,0$P,00K4 Kv@P)00 0 0000$p0  hSh03,30""21C09#8>gfffON0  $ooR  Rx0x0'' Q Qx0x088 RAⒶ -0@ 2L 㰈0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Qo$o p-QLM@`@00CS(<(H(T(`(000 PI@Kp-@h0`0X0KH02 0傤 @o oooo -` @0L0C0 R0 <00  0 (H>ho$o 0->L@ C$0PT;:h0h0h (h Hh ~D00 8 P0$0 0P0$oo( 0-LP 0NVP>T0 -@L`^ỢVpH 00RUV hp t0`0t00/H0U 10 XH  qB ? 0-@Lㆢt0P0t00hء p-LM@vP`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0uPP ᡡxtj p-`<X 40#"B LP2L0H 0b 0H@>T@@Ӄp$j 0-@<` 40#"B LP R00 0S000hb$j 0-@<` 40#"B LP R00 0S000hC$j 4 0p-#Lp"B @`!r r p<0P80<`͡00@$p0P80$jj|j -L0MpP(K$3 "  1ˌ3Š"10A0 0cK0S |0S \P \2 U+ 11 A0@QR  PS000S Sv S 0AS00 @R  R Rm R | |0R:,0x ,0`P\1 T@0BRS 0< 0K$0< 8 KT,1N͌\40, N=L L0 , 0^8`4 =N` N8` 4 108`S40 S( t 1Z31C0!02 ;5,.ϠClF/<@nB 0 `@PL L0Rl:4 40R  Re PXL@,0TpqQ,??B???h?pH  P``0O0@d  d H>V0 H>{  0@d 0 d  H P 0>eHb 08#(,!0 Q0A8#(|A0H\XSPP 0@d \ d H Pl =^P!P(P'P)X)P2 l 0@d 0 d  NH PJ>SD @ o=H@ p-LP@qt0`   U r὞p0 p 0-t0L   % P"20# P0  @@T 0h0@T00 P0S P ^T @^? -LMPP (`$pKW @P $ ' @P`H @P $  @Pt0:t0L0>0> p-`QL@ Pg dP`Up -LM2@0 SP 50 ^ B?@0CS+1 ? R   t0 ! X0N>O2n @ :t0\ 8CRㅞt0 :t0>%`(pKⰎ > PP ( PP0t 5*0t ᾝ.8C8Ac Q.PPQJPUZ=? -LM0`P0 ,0 8" p4b :t @0  82#3SဝY  Gy\#0 R|  VR8 0H0XDVT V(ڠ0@ "?0M @V' 0>H .` . 0O0@d P d p`l?ʨ0H0X VR  ^NVP)0p`FH0XÝH0@X#82Tt0!0t01H R`1l#OK (P@4Vpp4b ŚH0C㟝H0@X\,  |0P| 0y w$0!s1Fp0S7  㺚 0@P< T  4QK, 0 R(K  4 Q 02R#굜 #}개Lػ4K  o@Do\jq= otjodj= @j p-L@P1` (Q)Q#t0 >;.t0.?phtq t0àLp <t0HQHP ٭(Q HP$j Q-L@ t00t0t0 0t0 0) P P 㑘 -t L @0\%0 t0 0)P P mzQ  q, 3 2CHt 00t00 Q>|  00CS0 tt踛jSo -`pLp@0 㨀F@᜛  0@D  D 9@P ✠$ !,t 00S s PWP|@  =?= t {RyW  b @h0(PTh ?R](0Sڜ0  P HPt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ XzY| t h 0@$  $ i0 t@0  Xth0@t t    0R50,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   }t@(0 h0S&  .H0Stn  0S 0SWt W W@ p p(0 S|PPPY T 0S 0S 0S >08#8S>>>t  ^0SpSn l >(B8CS@1@#Td@DpT]0p  x t  (Wt{pp !W|pl 'W`pi W Xn0|S W 050;|[(0 0S050,| ޗtWctW   ^tɌt z Tx 0>(xW 0S tWW9 tl 0W tW   >Rq iQc0>t>tW  |@i P0 P p ^p P P 0 @POp0 P P W 0@0S tt/ W   t}\Wˌtxoq0̌#"B0t )W}p ^W~p}  R @>0S(| |ooo=$j p-LM4`K@P0t2Ɍ0t[Pt09t0Kp -4LM0p40 0P00 < @ 8p ,p 㨠嗙@Z0 0S\ ㊙@w0$($?Aas P0S Pi8 R , R,0 8 0^t 0  @0#P30#pᯘ8\ 8 0#p  0S00SW#W00n㨠p<@ kᐘ0 0S, |0P 4 $0!41@0S  Q|"2@=pPu =(0S( d` @P%0T: 0TT X</pP<0S X` T 0T 0T 0T  T` ܘh1@/ b\),8 R q8}(KT =  S| V  !1pP 0PCʡ#W  ] 0%>0S8\, } 8 埲8O80S, 8F0pݗ#ppחpqBgfff\jljodj`( -0L@  (0 P0S0 p-`< 40#"BL PK@ ᠗0 t0191p 0Sp$j 40 -LàL@`$ApP@ .H0SPUWTm fPʤ0  P tT t0 P$j -LTMPx0 U`$ G:U t:U J0U `:Uk CT:U H:U $:U 0U+ p(K:0S 0 S , |0^ $01F0S/ )9@pP 9U'0CU*0CU`9U (0CU D9U# 0Uㄗt @  5,0t Жp8U 8U , p8UD 8U$ 0U 8U0 R  AP|pP\P8US 7U v:80Sr;8t 0S$0SVt剖pb'0Zp\ pZP W0S Z t0(0(SpL  @0h 'D0 @0CpKl0 p H@ @ 3@pP=X \xc 0 \`ap \b\KW(t0@tq <àL&t0 iQ0CU 0Uٖt0p;t0/ d6U 6U˖0St0t000t0t0KP6U H6Ul0p006U 0UH~0 Q$,0! Pp 0Qp| p5@ p`Tp#*l0Sm 㒖l0U20x   pP   l0 ԕp@  PH  | 㠓p0 @T0S QQ 00CS0 0, 0p00 00 | 0 8w  pq91! 萕pi1t0p;t0凕apP Y `pUH0p0Q0 0S x0q 0 R,0 l0|#20 p6 p2@ Op(x08x0 @8x0  x07x00@x08x00 x07x0b(0S0S  pP{t  0    00C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0Ak-H0P R 00c!0R#<0Ak p-@L㚔`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@ʓp 0-@LPf0S US 0S\ a aR QPb0bU00S0 00h螓000 0 -@L`7p^P V  0 PbU0Pbდ 0 b PP 0eS0 1S00PS0eS0 0PSW p-@L0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0&p -PL`V@-Q@)pQ$ 0S`0`Q@@ P J  P 0ay0 0S00`dd0Vp@hQ   -@LP # >qxP 0SB >ex000 p-@`LP >xV`0 0 0P  pUB> tx -pQLP@p1A Q( Q* `0Q! 0Q a a0RPP `P  0a 0 0S 00pe 0Wl R 0   p-LP@ `R4 R0S) 0 0 0P \  a 0 10 0 P000  0-p0 #0 00  V0p -LMpᵒ0S" 0S 0R p$K@@KP@K $Km00  ,0 0 P ]]q,0 0 0S ?] p-LM`P, @T \Q Q 0 S ,5Kp`]at -Pp L,0` 0 @T  <^ 0\ `^` -Pp L,0` 0 @T  <^ 0\ `]` p- P,0L` 0 @T  <d^0 ,\ `]p`p80 P0S0SP,o -L@PP*0S( BT 4P: P0-LP@0P QT 4Q R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PU,o p-`0LP`U @ T*$04@S  RPUpha,o p-`0LP`U @ T*(04@S  RPU}phD,o -LMQP@#P P EP U Q4Q0S0\ E 0 $K*A$Kml 0-0 L 0P0S@ T* 04@S  RPU 0|S00p0 @h0@d@ TժPP Ѫ0ぬ40h},o@jjjиj|ooAk0oo )Ak )$ 1S!P@j.R0>> S9>R0!03Q>  p-PL@`p21C0Nnpp@-L!La0P 0cS@(010,1  1 ^  >!R 30bS01\> ^21C0Pp0S5@ 21C 0Qҁ0S0 S*0>p, 0 0cS00IoojxooBk"!B >0>\P 1 0 STQ X0\"!B >0C>T@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  \0S   @00cc@ 0b1  \0S  0  b @ L0 0c 0-@PLtl1!dX H@@ 1 @L X PTDH ` \0(0 "": ,0 4#t<#d\;1?8?????????@??@?l??? ?@p p-@L`ٌTP\)@P P 101$0 a 100ppPo4o -LM@Pp `QP P R*P`bU1f0Z P 0j0!: @@@00傌\0!\01\\ 01`P`ы0 0 `0 P  rP&0!0g00,0 pZ 0j0 0 PPS,00< -LϠMϜp0 Q10 K0 l`P} W0,0 ,@K,n@@0@0 0 0\0!\01\P \0``1`P^00W  pl 000 S0`00 WEVA @ PP> Z& 00 0bW1! & 0S  ;O NW1! 0  00b\! 0 h   Pd0Wp00 W W,(K, ʚ;4??? -LM^ -LQӿRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0xPP" 1 `000 0X0j 0    0S 0S00P 0PX 3 -LM Q-Lp@`9W 0 0g 0 1000+P& 1 Q@ PQ QPQ100@00 0g0 `` p0`X? -L@P  0 0 剦Iooo -P@P`U^LpL P <0@T0ho(BjPo -L M@ 0@y0kp嬐嬀嬠`0@ @P#5  0@PP\H`NVp<< ~(Kot?Po>,Bo Bkj0B|?o&) -PLMp, Z ,  0Q`%,` P`U0@TpccP @P0U U1Q  P P@U`0X#@gT@!  0X PU X`p0S P P0gX@cTPP P, 1 0YpP XPp 0 h1777 -L`RPp/Q+U" 0Q*U 0ScPPV`dVP U 0@`T@! P $  ???? -RLMp`@0,0 PP V@`C,K,0S PP; 젠 kR&,0S W0 gpZ @1@!S @  `dVPx0Z0 c; 1 ,,F|o -1L`Qr 0,0Sm* 0Xcp`Q@@T P 0@ L0 S]:X0`%`X00VX 0 X@1@!  d 00dS 0000 X00VXS`` pP T*1 Q@ PQ QPQ1@00X@@X 0Xpc`0 *100 2022RP0S0SP00 -@LP 0o0umP02 - @R0L0 0S00o\m R0 0 R8#82 0-PQL@0otmP @P0 0-@ LPP 0 -@Lp`@T PU00002 P02@T P -LMPp, 00 , KN@P P P \0PTP0 ,RX \ 0`h 0%`hW00S Z,00 0(KW#VcXc0PUSUU  0 `Q ,0 0P@, R  0 R0W4\fAW/PWPU& `0, A 0 0f 0 00 00 000P0@,0 0 1 z@PP  {P0 XU( ,0S 00S VU 0S:0f 00,  00f 0@,P Z0 1i 00  00 0&C -Dt? -40ML @   0Kq0S R$  0S$ 40$  0  191# 3S,0 00Q0Q40$# P 0-40@L$PՆ R00 0S000S?0?0h 0-40@L$P庆 R00 0S000S;0;0h 0-!40r@L$ r 0P0P80㕆,  3,@0300P008080$jjj 0-LM@z0P9@ %@ 80  0@K0q p-LMP@Y@0` 0 @᥅Kpq -LM0@P`-@ K70p 0  8@ᇅP,0P   0@q -LM@P0p  0`P 0S000UP 0U D 0U003KK PCq4j8j -LM`P@ۅ p0 @)K -@L<@ D0僃hN -LM^@P` 0S \ ` 0 *0 Up 0\ UY 5UV QUS *D2U0CU70"0_[ 0@'0 1 p1U\ U0U= 0U 0 RZ x- U O@U U 0 0000CU 0U 0U 0 U U0 00 0 0 0 A 0S  R  R} \z `0 3 003 0  U  Uw09 BB -LMXP`$0 p" 0S \ $0K0 0 @ K$3RO Rr R  R  R *@W  R8  R R U@R R RWT 0S%0 R00 0000 0S \ $0K0 0 @S5 0S00S S0@1yo@PAR`1R 0S  R  R \ $0K 00 @R R R@W 0S0*B BQ@@R񟗦\@)4@) @) @)0T@00T@00 UP 7@n0KPP@ 7@^P@x 7@VW 0SLP!@L00Vh V e@Aq!w -@Lq 0S   -L8M;@@0;0P ;-p ;  +%X`K8w2[0;,00%0 00S< KF 0;∔ p-LMQ@P ` Q Q KpT $ 0 0q -QL8MP L @ P8 L 00 00S00PD 00D0 0 D  D DUU0 (HP , ;0; D#PW@ PU D  P R0008 p0" D0 00b0!RR 00b00,C 1L00c0L0S~ P00P0 Uc 18SYX0 !DX` Q 0 PU0 ppR000 U 18SYX0 XPDD 1 D ,D  D0<D0 U P0 S Y R X!8S< 4 | X0S| 0H @00PR` <`V 04H 0aX,0RSP 0h0 40l S D  40T 040 H\ T 0vH 0 j 00 0 0h h0 H0S T R0hSH0 D 3`P 0S 00#W00S 3S0 P PQpQ00SPQ P0 S Y R 1SX R 80S D  D  P00S  Q R D 0 ;& +U@品k 00b0!RR 00b00,C 1L00c000P0SL 80 \ 0 R `@d4P ~, @ ,PPh 40l S?1DD D  T 9 P040 O< S< TUTXU% 80 0S $5  D0y80Q 0 R ;$ +@ (K p a 1SS 00b00,C 1L00c0H\ PHP 00THPU WpPP0 R8*0R:D@2 0Q/0S,80(3Sy U 1S 1  1S 1 R 0 P 0S\  D;# +@埀Y P0S 2 80L\  0LP 0 0;f  5(2P D 0  8P& UN KDXUDS;! +[@I7WpppO"0;ⲑP P Q!RP P0P0Y0S UP.Up0S]D Wppp 0SpP,0S\ 0D000@000;gJ0;b9#q p-LM@`၀ P p00 0 0 5@ L0  0@Kp qL063h2 -0@080L06$h# -L MP L32C0bC^ (K#0 0Rx cP 0A0 00 0 0000008 $ <048@0 ]PP$0S DK 3PP, (00(0, 00CS 0& 0 (00(00 00CS 0 Z848PP @>0w?080 D>,o?040 0>,>$j -LM0pP K$0 @P $`0A?AS  00CS 0 >%@K $K0@P 000  00CS 0 $PNt@$@P0A?AS  00CS 0 $:$@ > >+tP06F4  0\@P wsC03? -LM0`Sp  0KPP,K PP (K,s,0< $@ P  3S%P0 0F6"mPP <8s 00CS 0M>3S  #P5P55 P#P 080 iP\ ,00,@0 &Z 4 KDP,ZU@LG@,0 ,0 ,0! ,08 $ @8 PP  R 00qPP ,Y4=,c>,Y|, (00(0, 00CS 0 4008 6Ã,=媹?$j? p-LM`@ KjPP x0$. P 00CS 0=x p-LM`@ KLPP Kp K0TPP   00CS 0=0 $ 2P  -@PL' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TP )P( 0S0 0  (0(poP 0  0C0 00C0=lo -L Rg r R@0T0  (0 ( @T@T ( e  ( 00C0( 0 S( I @T@T1 &W `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P d@TZ@WP:=@TPZ&EW00$Q d0 R0 D)@ Q 0Q@doKopoKoиj؅) -L M`P0S p2R P(K Q 00\828 42 A0!/@!b0SPq4 1`j !W @; j1] ` V  @l^@T 4 0X0 N0@p0PK 0sC 0s@ 0SB o, p 0X0 0,@D000  0  \0 ;\,K , ` PW,pKˆ@ H, `F 0V0C 0,00C0  B tPrV7Pm` PPh`P$Blogfff -LM<  24 Q B 0A"q#W@1 80 V0 4  0 SB Wq@PW: P, 0@S$00S S0 =PP,W@0 ,0  @,mW,W00S $V(K4 , WW0(P00 (P0 ,WW.0P @`0` ,0W12,K  >P@ @VJ0 1P50;@TZZ(P ,DW,^WU ,YW8  08 P 04 0<  0!=P<4 0,0  W B Aqlo00S S PPg - @LT 0 00S S S \0 0hW0S00 S  R  R 0S00  000 Ҷ? 0-@LP0S 00w0hfU0 -@ 0LR ) 0S S S4 00? -LLMp0PS/@ (K iQ0@0̗jQ@h P 0D H0 D 0 BpKp@ h0 l @P L@P\`00S&@ #@0 0s:@PxX 0R)@ 0 2 0=@Pt t0P  000 0 0$0 040( 0 t[@ʚ; 0-0LSP @x@$@ 0S 6/Pd 0040 R T0h0hTlo -LM0S@80C hR3PU/`,hP`* j0p 0  0 lK00@0 l0CdP h0 l DP < `PX@T TDK:TP "e$^0`$K`VX$@K 00 0 ˠˠTXKD K _9`PX0px00P P0  0$04@P(@: -0LS@ 0S0S S Sl^h0h P < -TP @4$0$ 7$?PjTjXj\j -LM Q@`pP. W QW0u03Q0SQ{ꀘ)X)@)x)())ܖ)Ė))))ؗ)h)l)D)T),))ؗ)) 0S -W Z  - 0S <0S S S $P 0Sq 0Sn  01 8 HPI PG 00 RL3  8 40$ 04 00, (0  姴5XM0(B8S| SL SJ 唴 0S 0S0 0|0S  0qU8n jh R 00H0 $Z Pf 0 0 a000,0 0l ,EQP@00,0 0" PI X`IRN K 00 0c c 00, 0 b0b0 W,0Y0 V 0S80 yP @Q 0+P7VW0Y0 P90 P,p  p8?hoH?@?@j0? -` ML Hp`@000 p@0h0P` @00P@ @0(0P  $K茯oT?t???? - L^p( 00 8A/P`PU``0 0@`0d@P`^$0$0$00 $0 80dC6OQ  @ 0S 0S $mp0Wpꌯo|o ?o 0-@Lm00P 0P ~00  \l00  00<00000  4P0 ? -LM`@PlKp`H@ DP @P 00 @6lK00000000000000{000009 -L M:A封0`pS 000S@d _0!X-0@`A#OPpP1d 0pH-4!0 0C?2cQdS0d000!S100&R 5@. 0@TO0 @@0_0Q  B!|0EA`l `d0@d`P P0@@ K0j4B8BoQoxo offf(?,o|ogffftooooo 0- |R0P00h L 0@\ 80C6LS000P 00h诨$oo,o -pLl00 00;0000 9 0S 20S0000000P `pH0 S 80C6Po 0P`ȟ VP`sp L0S 0  0 0$0 0,2p$0&003 8A/P`P `0`0@`0d@ 0003 0S 0  0$0 0!0p$00(000:000p!0S-00$ oj800C6,Po 0P`ȟ VP`P000 00 $0 p0K?(000800E|0C0@|UP xt0Sr00 ojU00800%|P ` ooo|oojo 0-00L PL00p<P0010S 10S00 *   00  00  00 # 0 0@ 0$@00@ 00 0h008000h{00@000000800P(0 0@(0,@< oo0? -$2LM 2 j0 RG !0`|0K!pW !0 Rᤑ> f j00 /0S 00 p!0S  P(8K, 400bS8 00PcPEjU 0 R0 R*nj0S:00700|jP``80C6O0P@` `d 0@< 0$0 0p0q(otooo?|oo o 0-00LP 0E Q2 1C0Q 0  0 00<000h000005j@i$ 0000h\jjq - LRpa 00Sx0L0 P00S $0@LQ X? x0 0@x0|@P `00 0@004@ $ 0@00<000iP0  0l  l 8i008006X@ @{h0 0@h0l@g@00ꌯoq -LpL0PS` 8@<<@ R @00 00;00X` RN00 hv00800h]z -LM`i2V  B!2P, D``䁟䑟A!1n`U`q q 0SX0S` PPU 0 R 0 R4? ,z0 R ,oh0 R0 R0 R0S0 R@ 0z0 RP0 R0S0S*gfff|oo8Btooooooo@? -LMxD@0 @0\S0 4 < 8 HH4 Qh@ , R? 4 @_Q}y y3 ?Qʭ @@P`>0#6pǏ#0 ORʔ C0S @Tz PHP `X@Td PU*P`00`P C 3 @ P0K/D0( P@ p< 40S <KP< K 0 0440`P@ PR00 T2`@ \p,g(K0S*,2 ?QzP|wR0S0C0bA 000YUP` 0ORڤA!0y,wgpQlg( $0SZ PO8Q0OQIPG@P `v0 R20 R-Q00@;004@@|BIPi,0gp,,gp|4 D$o8Botoooo|o,o!Cej`jodjoo@?L? -L@ 0P  -LMp` 00 & f 0PPgK` Tp P PP 00 00 8000l y@fT P(KD@0 0@@0D@0 0 Kfl?o -LMp00  Z00Sx0LP Z p0 0@p0t@$K0 0@0@00\9 000P(` 800@(, 80<@`3 000ꌯoq -LMP @Pp, Z `@P` P U (Ko, 1 -LM@h -L(M@PH `v>0~pW (K4K 0H ,@K@2 PD,04 @r,@ T^P<  KPD < PR.JD 1`PU&J0O U 00HP`F<@T D1P @00;00k< TDvK0 <D0\ 1@ > D8 1P(`80 p0@80<@(,  /00xP`900040K  0t8p0P $q? p-P MLddd 0 PZDH0H `VPP@P U$@Kp j?|o|jj -@ LP ( R,0,0,0,0$0 00l P -LMP,  @0=   0R 00P0 ^,0  0R q0 Y t/ W> X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00 R XY V qrruuXuVzrQ? p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0E00C0hϗDo 0-L@PEUT004僘0P0T$0 0   R0Doj -0SL 0R& 08 p P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS ))))T) 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cXQ t0S\  0@  0S @ K  `V $ (0@(, P$0#0k0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P @)`)`))))#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'jj -LM40 1\00 ,0 080 G\C`VB p pppV4X 0 P; ,Y0 = @PMP$ ` p4  00 08 0@$0  8 0 ,0 40Y40' Y Y P\ P(K`P`(KoY0P1, 0 'P PUq -L M((@ $8 0@K? jDo -LM 80@ `I%0 R\ 0 [  "P|0P0C,P SP%0 ,0S 0 $xP > 00WL0$  P WL0$  0  R  0  ,0S L0$ o L$從 弞?? -LM,( 0 080 R0 0`(40 S P< 00  , $<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 40,P L0P  x$0Sy 0Sv 40 ,  00,P !@PD R,Z, 0 jb, D@0,SɌ,P00 Sx@T$  "sP, #,K0 pbW^ ,P,P00 S SJX30 S ( @<@ <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPPw,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN Z T+ 00(K0/S 0 db<00@S@ p0S4 0p03R0S@,PɌ,p@* ?@p "pt,@0 R1L0$ ,  0p " , 00S L0$ 4 Rs L0$ o p@0 0 jȌp,0 @p@o@  -L(M0,0  p0(40P 0S 8+0i`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq  P8 ``800(K Ps8L0S < P `Pw,0p 0L"H RU $0S0$0q0S8㵓0`0K4 PP 0PK@4` H0 D@ 8 `8P傒 ~ 00b Ru `?`@o|o0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-@0 S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 T- P  P 0S 0R Po -LM 0 0p00 `R 0|040@4 Q0$0 $PK @$00$0 08P#8@$00KjLBko 0LP  \ @0D0<0804000,0(0H0$0000 00L0S X R\0\0\0 QL0SX0 X0\0\80080@0D  D R80SPPPT0T D0T0 PT 0P0 PT 0D 0D0oܴoD0@ 0CD0S80SPDPT0T 80T0 PT 0P0 PT 0ܴoo -L@p`\ L0S XPPU L0S \ -L M0   K0 P K$*-2L?0\ \ x 0S00Sox0S 40  0 R  R x 0\0 00R0S R 0-L$@ P R 0100S P 0$   00$0@- P@P -0A0@0@P -LMD0P,4@ ` @P@0d0(HL@Pp8<P@ Pp Kx?,?$?? -L M`0P1p ^0Lx@10P @Dl@8 <0@WKd@T  @T\h@T < @T꼺j?j??0?@?H? - pL| 㳿,0S' 0 ,`0\h0h dx<0@@pP`0LP T0X@DPH`Z Z [l i  -L M$ R @0|"( Pl  0PLP 8@0H @`0 ,0 04 00`KP `p PX``@000p  0 x@0h0P @0p0Pt >0 \ T @TP P01Ps #X 10CR c. \P X@T (^$K @T 0Xe\"!10C c RP X@T\ \ L ?X??,?p????@8@H@P@0@X@h@p@.@ -pL@T P` 0 `@S LPQ 00 R 0 QR0耹j|j p-0L@`T  P @T  P pH0@Q @`0(0S pp耹j|j 0- @RL R000 00@ dP h0S& 0S0 00@P0@0hP00S S t0d 0?x0 R <0< Cp0Q@0t0t0t0!CejVUUU -LP  p R R000 @  h0S 00hp0\@0t0t0t0)!Cex@ 0-0LSP@@000CSx00 D0D d0S0d 00dP@0 @ -@LOD@ 0tt0P \@ 0P0 PT 0@hN0SP0 P0P0T00@Tܴoo -L@p`Pll\ 0 @@ aP  -L`psOh@PT! 00  R 00@00$ <N0WSQOh@PTW 08 h0S NhN兕@@ -LPp` *O0@!h0S zN 0 @PbOl0@Sh0S ZfN`Od R% V@ 0S'PB @VP 0S00&00 X*00;00@Ud RhP' V P @PP 0S00800X 0N`@P N N N@VR @@@ P-L l00Csl0 @  S 0@0lhg_@ p-`LV@P00   R000   pl00l0!Ce@-Q @P -\ 00 R 0@eXZoj -1 RL PpU. `PU 0 00S00` 5N@MaW`pGZ`V Z ?O'P0@X PU`(v sq`jGo'5 @@ p-L@`\P0^0%S I p\ 0S 8P%3 @0  0S pp@  0S p p-LP`@`T0  200%VPp* - L@0 12 -LM\@PT`n T]dPZTXPV1 2p`X\ PG\ 0S d RD@$T@6 0\ 000   0V0P@@T@!0400P 0400 R R 0S 0S $1 0\7@112@@\` .@Pd 0S Ǯ$0 @0400P  4 $0<$0,o p-0L@P`    fP$0<$0p8$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,P K0S S S -P0 KiNP0x  KiNQ0PU 0S0S PU-P $1@$ G0 00$ 0MP1ꀹj|jo -QLMp`0T@$KW00 P@ $]W -80T 0CSL@80  h680S@0 hq -LM8P@U08040`pI<40{B`9U2 V$P7U 800CS80 0,0@40, 04  KD0SW 0a<40 Ki\  0EC ALj$@8@P@ p-40L\@ !04phn] L0S 000CS'80 S0 @0pKD0SXp0S P\QT0T0T00T P0SP0 P0P0T00@TphKxQ 0S00 S1 x 0S004 # x0Q' P`Q x 0S0 00RV`V 40;404;40n00x0xQ廑幑巑d@ܴo@|@l@0qq -40L @ x 0P Q x0  R0 00R8 0r03P0S 40 8 -80LS ; - 0RL@  40 <0S 00S 80S 000 000CS0,0qj 0-80p 0CSPL@80 0 \P 080S@00q -40L @P`  P<400!O\P@08#1pQ  R8P  #PP 800CS  R80 JD0S P R T0T0T0 @00@0I8P RT 0 P T 0 P @ܴoo -000CS1!2?01L`P@p 0 00S 80S1p@T @T x 0S @T $v/x Px0Ppx  x0Px PxT` 4 +4 40;40@ XPY00S    ,0 0,0 qo -LM1 `00U0 4 8 ,0 OL ȁA0 ?0S0 " 0`I1 `RD!0S9 P@UKPPUH PP RT0T0T00P T0 @  @ (I00S ,0x040@0@00080,040P80@(KT`p 0S 0S Hl 0 0 `0|0 P H0ڏ00oqooHBkܴooo\? -p0LM@Pp0 $0KT `P00 $`0p P$  $``輻j  C/ 0- 0LSP@ 00# @I/P0@'/@ -`L@T& pU@ PPp0 'P  L冎Up@W 0~X $z@Toq@@@ -L|HLiH0Q P ,h^$h[ @o$@0@Go -PLM4 8 \ 8 0!4 |1X> 4 0 zP@/ R, ( L0S300X@PY5:`,K,<pP T,@  L0S YX@%:P +pP ` L(K0P @E0T0 40c8 pd0 R X0P4 0b8  p0+,0p 80" - oj8@o -0LP@U. PU+ `pP !-@p P 0$0 p0 00$0$(0$0 l/00Y 0@耹j 0-p0 ML@d@P@XX 0PP<<0< P0 P K0hIBo? jooܴoo - Lt@ -0 P0@L`pG@  p Rt0t0t0 @  @ 0EL X000 Rp p0t0 @ti9Gjjo\Bk 0-@L80Q 0L0PPGpQt0t0t @00@0G@DZ@Do̅= -LMß0,0 P 0 0p0 &PP  00 ` L P,, 0R(K, ! LKT K PPL@  0T 000H@K zPP L0S T LUPP!0P 0@KP K PPP P00S-P  SP{20S P00SP  0PPP PP  @KPP 0@@ P PP P 0lPPP <00<0L00L L00! PL0$% 0 @d0 `@ l0 h@ 0K5K P @0@UKl0KPL @P0PP0 } PhL 090 PT L (00(0L  00CS 0p LSlFP^,]Y 06PPV|@Doj؅= -LhMp0`$0 @%PP $ 0R) K0D cKP `P \  0 X@ PPt@@KIL08K < @ L 0$P(U PY@Do= -LM,p @ ,K0 K `P*00 P0 000@0" d0 A0C` 匐 吠 @0h` `p K0"0 K`P V v`0,1 (K, @`| ,0,0 0, $/ 0 @@0 <@ H0 D@  0#K3K @0@cK , H0K@;@P 0Q,`0[ P, 090Y$ ,0  ` L0$ `00S< x`P@K 0 0 ,0 0n`P   0 0, (00(0,  00CS 0,E@ Rv00g`Pn,00 0o` j -LMP @0  @ K -LM c @K -LMpP  0$S00PS  y 0@ 0P x@ T P(K0 ` V(P x@T 3a P `  p-LMP@5$P `K \ 㸳P Kp.㰳\ 㫳Pdd_/㥳 -LM$$10 @\` T., 6 p$048,0 PPn.p@ T P@VW*, ,PR 0P @ TVW000P(K00P0P}o -LMPp$ K.@P $ $0L`V  00CS 0$4@,0 $ @ 00CS 0 T$048,0 Q@$ -LHM@0p P80 dK0C\ `0 d < 4P P KPL@,`0 P$048,0 ! -`L@pT  P@$P @T@0$0'/00 @$0@0$0o -LM80`S2 x K0 Pp1PU 0S PU @0S  00(P 0S  0 0PPU<@P    M~`Uo@o@ -$0@@0$0Lp`P 00$0 0 0PP4 0PUU  $00#X00S$m0 R0000 0P  0x0 00C0PU R }o@ -LHMD0 p<0 hK0C` d0 h @ 8p @P0TP L`0P m"@P$0   @ K40  P@ 0b@ -P5LMH0 S, `p="@PPKZ 0@P , 0RV(KD00  0CK@ 0 P 尀 \@PP 40C@0QK 0@P10 81S "@P%!P  0L p$0p0 0@P 00S @0 x` {mUL H! $0L1 m-@i@0 P !@P!P  L!pp b@P$8$$$"2 00$  0K @Pl2 $0 h ($$T$L$40S\ *?xwTH!00000 R0) C$0 , 0   0@P ^P00 PH K ` 00SP< PP8 0PP1  00Sb  0bPP%40 H<00<0(K  0,0@0,0(6PP0S (0P#  00l PPSPPK 00 000 @ 0( PPk  09PP@;40  00 @KP 0@p@ lP <PP -LMPp, @P t 0000(K`H0 00 it @P00H00\ 00 0@P 00, @ q -SLM 0 `  0K0 @Pt0 PL 0C"(40 0΁Y000Q 0 010!La000 Ѝ8BoųE.oonm==ok_k0@-@PP0  U0   R 0U 0  P0` R.00  \@ R (0U 0  Q000,=,=E-@Mp 00 Q 0C 0.Q00P.Q.0W0ЍS P J Q.Q 0 S.SQZ0.SP.0W00P R J0 S .SU \  RZX \0d`c `hV 0 S  PQ 0 0LV \00SQH\ᘡ'P0@ S  PR 00A\  Q00SRQ 0S0C0P W\_00W @0'0!00c000l0Q0Q Tp:Su  B0 S 00l bS0a  ~0 R0P 0 Q0I0 s R .R ,=0@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S ,=p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 0 3A0qQ P@ R .RQ4 0?AcQ 0?AcON -PPLpPP!0S|0 <@Ph@d1 T!T10Q@0!81>@ Q  0P@ 00C0$#Bb2 0a༐ 0> 'b! 1  b0àD~ pLAD RlPEd31C 0 !000(koo=nm=QB,@0@- P$@ 2 001^   R 0\$0T0U00S 00o o R0S  0 -h0L@ h 0-PL@ P +0 0= 0 -LM@pL $0P PK,`K9   4 00 y    h0  00S K$ KM PP\$ ㏝$d ㊝h $0 $0 i $0 $ 6$ #40$ 6$ #40$ 6$ #40$ 7$ #40$ 7$ #40t$ t0$ #40h$0x   h0$ y000h0$ z000h0$ {0004 $x0sv0004 $x0swW `Ps  j li0 y0rp h0 0h0k [ n -LM@0 4phP4` x0s $ h jP(K ix0WlW;t0 00 , tpdX01[Y0xp$00W 0, r 00KPPX0 G2#, 0Q= x0000s7 PdX0A1A ,0K+PPdX0A1\0080 Y `X ,0H `0Cd04K PP 4弸 JPPX0` 70bd040dH80cb 4唺4_\@ -LM@\0S` 00S` w\0S aL $00  %0`\0 -LM0P4@4 x0s` h0p`x R#*d0X  B2!0C03r T0Q` 0`P0$0xP0i5x 0pj@ -L MxPQppD0 @ "@@P< `<0#0 0AT@T 0S$0W0V00S  ?PD0@`(KT#00K`P'= ) 0@,#<`)00@0 ` `8`00 P$p@ 0^v`P 0uV2D 004 0U 00a x0s[ ,K 40KP,\ k,d f,0 h ,0 i ,0 4 &,0 4 &,0 4 &,0 4 ',0 4 ',0 4t, 040 0 0x04 x0s? 4gh0' 0 000tQ% lD @c@0Sw0 40040h x0st`1D @0t0x0!76i000 0 t80KPP X 802x0,0 $ (t (h`&qo oj@@ -,0 L;P0<"0Bo o -@LplP`᪡0p8< U##00V 0` S 0!40X lᆡ@-P`@p |\00|0S 1P| 0\ RP00  |0Q0|00Q000S0#0% -L MßD D@ `0 <` 04P p t\0 o ^d0( K0`"00K,nQ4 |P#000W{x00 00 s@0.8K4 K@0Kr4Q <P n4 c @SPQ0 `P20s H<lZ0@0Ph0sd, 40u@P0, Pg p@ X,0K@P4 O W0@0@4 , 4@ B@lo@o -LMP p 02@$p  0 !P  0P:0RT0P$pH0 L1$^A   !T00T01 01$pP0S2:0lP՛WP`W*( K,0K ($K ,0DPP$px~H 04 0 0, $pP K$ -LM4p`P4K(K 0:@P$,K(04K P,(0H R:S 0S Q0Sΰ$KʰPǰ, -LMQ@`PdX 032`DnP6"\050@0 0 P˵pPX 0\ H `X H0N a 0P崵pP 到00 -LM$@ 40   -LM04`<0  <0nPD p,K8 K0PP40K,08K|PP.0, H0P*0@SH0 @0S0S 0 P 0, H0 @0S-p)(KUP0!<\PP0<00<0 -LM4p8K,K 0T@P80K,08K%P30P,H0P *@,0PH0 @0S\ 0` \ P d ㍉P 0֯үpί(KT0ů(@4@ -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04K˴`P-(\0H0 R (0S  @000 A @D\0 0S (|`P 0\ 00T00S$Kt(q -L M, ( h0 h0 p`(0S$Ktt0\p \H 4`x0sA ,K`X H `0Ld0 ipP@,H0 @ 3  P,0x 4qP0 40Xt0S( U$ q@0S (0, (0K,p pP(h0 t@0\p,p\ W,,p@@4@ -L(M(PxL ^p4:dX0  a<à  0, `PX0x ,(#x X4K>< K,0K`P( ,0H S\00K H 40<K`P00(\ H @\ sd oh0 0 i0 0& 6#40& 6#40& 6#40' 7#40' 7#40t  t0#40h xh0y000h0z000h0{00040x rv00040x rw000,0SKnD  @  D 0 @ 8P: ,0 @D0CS,03(0\ C(0;`P< K0 (4K A(X>`P0K40<KW`P00\ (H @x 0(K00 `PL R h0 t, x0s P0H0  H L0,`@0P,` H -,LhM0,0  H x @00 T |  d 00 4| ` dh0t , 0tR-(K@ 0HPt | "Pt @40p@ ( 8K0P P` P0t0 \ X  `\0 0R   S R\ o T `k 0Y 0R S .SY B0l0 D0 h0 p@KdhP K<0KP@`HK@0PK嗲@P2@PHHPH 0@ s 3SS9\0S`lp R PP pRhh b \ X DV\ `lp V0fl2l Q 0\0"'t X |  ͹0t0 P\`\ 0\`S & P X0S@H` 0 0  =H@8K 㵆Pd(pd0,0`0x 4r` <0SPZ V<` PRH v 3`x0s00 @`Rw T 00R00SS  Q u  0FPt dt0S  Z Rt ` <D0KPt p D0R |0 0;0x tB7\ X d\(p\ 0B,00.S  R R0.St`R <` T dt0S  Z R= ~ | 0  |  T0  u  0Pt ~dt0S  Z Rr Z | o0 40@hQ`K0t0 cH8t@ _P t [` <D0KPjp0S T x 060D0| T   d00S  0Pt 3\d 0A,0l0(0p0\;0t %x t0 6t 0x 0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt p0|SD0 x t060x \NP0t@ 6t@ 0x 0CP060 D0t W@Do,= 00  $00 0-L P @VP004  0 0 -LM0K@ SP00 0  -LM"0K@ BP0   -LM B`0$0 ,` (  h0PSp 0S\, KU L  0`P$  6$K]*h@ p-00LSP@0 0< 0S  n`P  09P =ph0S 0S p-` Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z 㯎Z 㪎[| 㦎 | p -L  pJ`P Rx x0`@W0Q -`i<;$0 :$0 " -L8Mx0Pp G@P (KVPp7 U@` "0` 0``l@ vT$0040  0@P(K@ H H :唯@P x0, Pd 4 0R   GV P<_;\ , ;00k000,0 H@ 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$02 4$ 40`^\8 2@SQP  0 400 0,0 0 @400 0002SL0 #PP80S 0 4s0 x0 0 40,0080 0$ 00020^t 8 0Bp \n:0L k0Qh 8^e 4@,0!< 80x D 0,<0r8<00 L< 2!?04 H @D000H0`T <80D 4t0LP QT  3R 0D 0 D x 2tQ0 08l0l00P S@CZP@l0 4p00@4 C`\ d0d @0RX O@@0 40,0P 0 S,?0,0 |QKP00B P< oP P@P$00104P0010h0 0 b删 x0m"0#4X0 <0! .X@ $ 0@,00@0H&0%40| e0  x0x40+H#13 @Px,0H@ ᐂP 0|0,00 +0 ,Ө0,0 y\ PH yP0 sP `Do@@@<= -LM⬐K@ | PŽ`P$  0S    `P$ -` 0S0S K`(K ZpY ,0K>`P W Z 0:@0,0 0C(` 0p000夽`PP00S` yx0d" 0Q`UP $08 lm 00 ` 'V$0I 0S`LV R<0 0@  8400 0 0CAx0s00< 0KP,  * `t  P010kp  00 l` V ^ 01`00吠P 0P,0KY ᓏ,Za⇋Y ́0Z`,0 ~ [| }2jE0  B40Rd++++x++d++ 00 ;0 000   -|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s (080<00 080ꬽjj< R00 0S00@Q 0S!0?A01,0000@Q 0 S 1 91 0-L M Px @0 80髹K0 p-0L@`t $0D{XP4P%(,0(0%T"$lXp@@`z@ @ -LM0 pR 040`V  PR00` X0@0b4` c SPQ 0P -LMp 00匀0CSD0P`S u*  x 0D0,  0S40@` X0b5 ` PVQ @P 0@0@H<DP`0@0v@M 0s0sX4@0<0< 0 < -L@- -L@- -00 LR@`Pp rp0V D -LMPPpW4pP 0@ BpT2pP 0 p p-LM80@SPP Kp `K$0 00 4 0 00 000rp h0 0h0i0lj 00n0 -0@,LLN0 WD|o -LM0 ,0 @Pt0pS( x0R`# :+N), 0Rb(KK 1d K`P 0 !0 04̀KX0K00  L` H` $0 00 ,0 "0.00  K0I`P0  0  0TKV KW0Kk0PM0NKP K`X0[ 0X0K0 RKW0/@Do|ox= -LM0 ,0 `t0S4p( x0R# :M, 0R(K@K 0@7PK@K⟈00 p $0 00 0  000 `X 0H `0Cd0 PPP+d@HzH@ y H 0#40%[ 5[#40%[ 5[#40W [ [5[#40$[ 4[#40%[ 5[#40x tr= !4 0 0 %[ 5[#40%[ 5[#40W [ [5[#40$[ 4[#40%[ 5[#40x r aP d KP)  b0#80 [ t0#80w  @0S 002y TKV KW0Kr0NKP K~X0[ 0X0Ke@ PK K 0H XKL @ P 3P0  0  0"8.0 RKS0L@Do|oܼj= -LdM@0 P,0 H L h7`LL 0L^|0 p H0U HPLƟ, 0 R(KP L0^\ | XPL x h0` T  0S x0Q 0 0 x0@x @0` 0T b0Hp0 Ppt (0 d p,L | L tt0P TQ   \  Zt0SH&pxPf0 N HK ᦶP]HPp Tt t   \ t R h0oT\atpP\H0 Ht 7 KPJ00 0 0 \QZ  LKjLPX x X \l (0h0 Z T\CQ@L L|  3x 0@00L*)' | |-0 .R=| tQ H00 \0 0 PB `0S  | T R0S8x \p BKↆ7K ゆp0 ,0d 0( xp @P BK q0SLxl00h 0( 00lx@P 0S | L}|  L垭`\Xd x2p 0@P QLcpTx  0S\0d 0$0XMQN | [ R@G X0tpW9 `X H `0Gd0PK |@P'P '4H0px0pst 40  0x0s ','8  0P+@P L@0S 0P(L$T TT@Doq=p@@(@L@ 0-P@QL⭾Q0h -LM@P `Pp0s0s 0s$0sH0sL0s P0s@0s 0s0s00S qm 0P(0se 4 0R P \0  06P40 C 00s 0rp 0h0 0 h0 p 40 Q Ph0h000h0h00 00Dp 40 Q PDh0h0 0 0h0h00 000/hl(0s (n0r00s -LM0(@KP4p`} 0 004 0 0v 0000h tI Pg h0PL240 h0 0J004 @ 0 0400H@ x H40 N0 408 <0,0( Dh0@ 8D04 d0$04x \0 00@L0P@ 000 Kx0S 0S`X H a0C$0@2"@1Y<@00   / x0s@0! i0lj 0| (0i 80p 0rh04 0h00 0d0n0m -LM@| 0h4l00 0 <@00    0 0@@啾Km -LXML T 0 SP 4 @0UP Ph00X0 Px0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H xD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QT?PP80K0@0Ud @0jh@HD0cS0! d`PS0!\ lHS@1@!L  P0UCL0ST> @0Wx0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @ǤP,KP8 K0 PP`0K,08KݤPpPUX^OTL0$  JP 000EꠟC -XLZM0 ,0 p!  pAl! h04   KKHl `0S! T1 T 0@0NTlAPd h  T!20 d1 Ah 0 dp1t 2Rx1 Wc@ P L! @@tA l!P pt!x0b0a1 KV Sd00X\ 1 գPa8< l2| \Y1Q 0`! \1 0UP!X1 pR/KO?KNOK@tP K81RKDP @儁@08!H| cX!X! 0S 0PSW Q S0x p40 40Ȍ \p@04 .1KXP KK -K-[00\%(@Kl0S/:MKl!h P !hAT d 0L\d 0 @` \! @ hA X! H| 0 ` P @pR0S S@0`1 \A @XA @壞`q\!rKV 1 R0dA0d0l` p0T!00b0p1x P Qڌ0 0C, 0R(Kx0sy 0@t! P1 LA 0X!MKX 0@@@`a \q 0 4(00 s<1xSX `H a0C"0n2O@ 04 .1KFXPQ-[(0K 01BR@0@`1 \A @XA m @%KV l\} pt!x0b0a1 KV SX\ d0rPa80 `2| PY1Q U P!P{A0 0z@0RU RU*ږ0KK,-1Kw-1[!00(@Kl0SC:MKl!q P % 0h!`@pR d10CSd1 `hA@hA PUlx0s@0041 41 0U.1K U0KK,-1Kw?@嫝KV K>KXnK?VB? @3(@叝t 0OX @Do@u@= -LPMd dP dX 00L dT 4SH P Sv OX  LTx0@0 @T0ReTPa 0@0@TZPTX ,0KPSLTxD Z 0MJ TpǏ p X4 RHPd`0@X0@031@ a< QT>QD @PTA 0CL0PP\ ] PXPV X8 UA D8 0LT40l@Q  ,0T0\0(KY  L{P\ *L T0x D 01 HDd0X0C03>\ 0C` @ < X8 9^ 0nSZn< ^ZRQVp l0 T 0\0 4 ^d0 ` RmLDx0S*d0c\ R X0P H` \0b@ 0l5 \ Qh0 |tTl0pP` P `5>VNP1V0hR3Q ʧ Lx0 0SXU H d0Ppppՠ0 <H$00@p00P`Sm 0s] HT\ dP`0iZ! /L x0Rp:LxP |P00 HT 8\ Q,H0d 0S* 0L\0P00T \d H0XPRH 0Kd0 P9P\ 0 T0MQ00P@U];0s\0STT\ 20SH `0X c51 a0 QV -L@>P t P $h@0Sl0 l0p0pxo0  0- LP X0$ 0X00H0̽j -@L P   P 70007 -QLMP P- K@K00, P0S0H@K00, uPQ0 Qнj̽j -1L@T6 W@1 0pS0pQ*ڴ 0SP#00S PU R |`0S l0S Sh 0㙹 RW@0D0Ptoj$j(6+xo -pL@` P0P <@p ` 0 0 0e0BLto@ -pRL PP` U @W@1 }pWP`&L@0 }}0  0- L@p*PP@ A`@0S @:0S 0S 0s $0S0 $ \YIo -0R,(SLpP ` VA  P {@T~Z,@(PY g)P hZ,(@Y 0-80LS@P0S  R00Q0 0008E P PP KK@@ p- L 0`S t0 PUPU 0S 0S@[ejppto -0L@pTP. `0S0 rPV 0R`@TV 0S 0@S S%/4$P to0  0- L@`#;0PS,6Tw 5T <5T, 5T 5T 5T p5T <5T b5T 0T 5TL0p0~P d5T :0CT .H5T @5T 85T p(5T o5T ;T 5T0S i34T0p;0 /4T 0T0p00 0CT0p04TQ4T $4TP epH4T 0T 0CT@0p00CT 0T~0S{ $80@Sp xr0CT 0T 3Th pL 0 P0 0T0\0CT 0T 0CTR0p:0O0CT6*2T3 2T0 pDi0S< i0S52 0R 0R 00 p (H0p0$Q0pp 0 P 0p00@S0p@@ 0pD00p0=00p0S0<0@p0 p 4001 @p' 1  i=0p0<0p0P1<1  P 0S0p 0p i0p0S0@0 QpH0T :00Sp0T 91T p0HpP080kB @~fwBfB{BlB sB@f@nB@wt@|B@vB fB@hB yB}BzBjB@oB@pBxB@vtнjBBqB@mB -@LD0S HQ\V0\0L \V0\0 -L MS00 S @p\P4 ` R400403 0@0 @ @`p0K@00 j0,0@0 尡 4:0pS$P X 00S * P 0  $  (KIo -LMpQ`)  P 0 PR@T@T 00= 0 000( P 80 <0S101@T|9+ -LL̠Č.Č@!̌K M0(K.0 01K (@ 1[!0 !K -LM@ 0  $K1K$@ 1[!0 !K -LM@pTP` @T 00= 000( 0dP 40 <0@ST/=0  00- Lv@0PSc00  0- Lp\0PS`  0R` X0 0rX0> $0S;1 $ ^!\C :0S \K | 0(X$@L\":@T* 0  0@   2`0 @ 0  0$00pP` #P0Ss`Qj`d0 0 0 0 Io8@ Q-Lp`V Q CiQ Q `QE ?*00@ Ts 0iTP0 ;s17`Fs @P `P 0gT& 0Y#Y#  xP ` pux Q0 0Q Q000000` x 0 0i 0 -LCMq0  0 $ `P @R` P52` P`$ 0R& K,IK J/K0_`P(h 0Sr(`81(0@ R0#1K0@ (`;@Do=0@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 00A S@-2*Qf 1@ 0S'P+P+$Q+$Q+P+4Q+P+P+0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S Rнj -LDM@dKP@pfwT@D` @0S񟗾DY+= -0LS@ S 0SQ 0S 0Sh< cPT 0S  cP > 0-0P@0PL HP$ P$00 >P( P(00 4P, P,000Q<|@ - L@ R! !  110C0C11g 10P RZ -LP`p@QT 0@SpW@0@Sp@0 0C@0 gH0T0H0P U -L@p0QQ 81\P 0 R P 0 Rj -L`0pPUPU 81W5 @T@T 0 R0S cP@j p-L M8`KP@ m(P ^ PKpj Pp-LP` p@Q Q P @P 00 0@ 0S0C 0 @@\ $0\   pz|+ p-L`l0P@T %0B8R#8 S51S@Ta0phjB -@LD%(h -5@05L3%`0 h9d 0-5P0L5@T Ac@T  R! !  110C0C11f 10P RZ$0hh p-L$M`00 0P@T@T 5 %d1S KH< K@T 0RKp@Doji ,= -LMwX, > 81`VH `VC 81, R@T@T 0SPU 0 pR*0 0# 0 0# WY  P P 40 P(0 Q 0 jjjj -L0LS@  7PL  $ 0L0ah`t+BQ -0LSp 00C SP@ 0S0 C RQP@T`U 0S U0S9 0`V`V aP aP0gS \ 00L S0gP ^0P@@\00L SL0!l/@!b00RPXP0S jgfff p-L@`P FPP  R 5p@ p-ppp p-LMK`i@PP PP xPPP = -LxM␫PU, `p@ p;U h;Ua \;0S$`P <;U ``, 0R(K:UK 0UP :UI P` :引UY G:U1 N0CU0CUN*0CU> 0U 0CU~ \ @ 0 `5 0# `05 @7`PJ```j`9U: !f0CU0 0CU 0U% h9U`P1S  `4`y '9U k0CU 0U| 0CU_?P`e P` L@K t` 0KCn`8UR 70CU 0U 0CUu]`PCLPK 0Kn`Pt_OGm 8U 60U[h@B`P(1S@  h0`TU AR7U h7U?7U+0CU*0CU5zh7UM m\7U-w`PP`+P @T 81Ro  ሁ`0@0T`0]@TZ 0 0 0S0 R4 40640 0 40 0R 00B 07`㰑F`P `PPK@ 0Kym`POO@ si@ _`P0l0 `P8# `  0  ! `  08 C(` !`PoP~ȕ`il0`0d l`@KO@ r_@ 0KAm`h`PN5w l x$q< 0 \%x   rN`P4,$5Q6 PU3 0S00-d0S S S `S S S@ h0 h P`g9`P `P )6`1%~1`0!81`0-`2U h0`0@X5 @K5{@A8#` 8 05 ` )8#'2U 2U`P 9`P 1U 1U01` ` [` @U8# P `p081`0@ ` `V^`  P`0@ ` `VI` YPK@Doi$ii$zi i$xi Fixi i Ji8=i i Ii i$i Hi i$i oqji ~i i$Fi@6i(Ki -ԁL@\g P 1S 1 RQ[ P ta%0S 0S 0R0P 0@P0A!R 1 1! Ro\00RR  qP`P  g  P PH`P  g P$000$06jjjj?j,o@ -L@000  0@_hjj -L@00S0 0000@hVj p-1!S0#RL:5 `0 P0 00   `00`0p`0  p0`0 0 @0 l@ \0@P `0S ph000 0@@0 jLoHo p-L0%LQ`U G@ 02phpj -PL55`";5!T2T"1!p,~630 R 010  0 ` a aR0 10  0 @T 0 RM 5 Q 0 0R0B 0;[Q0  0 0S0C 04 %01$(,0@T 0 R 010Q@TYt0 !h0 R404 H040 0 40 Kh `Bk@o|+HH-0#" A0: 0 A  AQ0A0ABkЊ=0@-PR@ 0 0!\!""0"!0萊=@-pR` @P@@ 0 ,>#!^ """!1# @==   -"LR@ \0700"R p-@LT`P5 T T fe bep/p0S 0S0S @T Oe Kep3000 00   009ep@Tt 1el -ep@0^  0@ 0000 0ep*j0jj$j -L M@c*PK0pK `P5BT+@T(  ZP ZP00CS0 R07004` .20C2 ZP2 0C2 `$K } -L M@p*K0K` DPP*0[fP$K`00[ BT@T  ZP  ZP000D7 @P"  d d00 p2 S0"00+.B 2 02_ZP2024P7P -\ \:5S0d0\-P41P0h040\0\ (p2i 1i i i -0@2l D0C"2X 00/0020SL Y @42裐@42xBk* 0 RQ 3  \0R 000Q ^f 2 @@@ 0  PP0S:  0   @ 0 p pPP00 -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -L@p`V]0 XpP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0BkBk<+x+ܵ+X++ 0-0LS@P 0p 0P 00h0 0-0L R (0Q0 R0PS0hz+ x@P 0\ 0X0X Q*00Q8P 0$+ ~+,oXot@BkBkBkPo@@ p- L@PT0`0 \00 00 0P0`@p 0P@'+To@ -0 LR* ~RP -LMⴒ`0RPPP@@U%U〢xx2 Ez\ eu\Qk*0PSh 0RS BQ:`aU"0S`1 pqQM@!``07Vp9WX00S0 Pp \10@04\ 3\H1, K0D,0pS: ^!Q Q\ 0d 100 0  QPpd\ 0 00`0 R 0d1000<g*60N SXoBkBkjPo=@ -LM `PpP @  RX@U TU @Tp R P 05 0S PU 0ES 0 Y Rp T 000S` 0 P 0SPP0 PP 0p0 00R )  00CS 00 ^ڿ0S  \ R0S P P  0S|)  p P @ 0St @Tz  d%QPf p \0SP 0S:0S   0SPX `  0`V  `| Q R 0S r)p50S  Q0A 0 >\0P0\P Q  00CS 00S 0hd B)T>)p0D0  ( 00\ @ @4 @ @ @ @To -LMP < @ 0`Q40 8` 0` 0<, K,0SB Pp- p@Q V Q 8CRPP0pS @+PQ (K T00S p0 S <0 00 0 V 8 ` 0 0 8000, @R? V 0 0@S@ @R4 00T00Sp@T! H8S0P ,0 SPO 0UM P`Pp@T /P0UP08#x0S5 R 0AS0AS R0 040 DP8 l ` 08#800 5QS 0 00pSp0 S 00 0@SU} Q 0 S R 8CRQ; 0 Sg PR 0S 00 0 P@MP PEUp@T@ r@Q R#3p0pS 0$'P ( @ @ Qp-L@`ph0 P PPUp0U PhP 0R Qr r0R@QPr0SQ * 0Sr0S Q1 \  -L@@PA- 2\ \@pQŸ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# ` a` P%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! ` a%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a"^0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#Q0 |0x00b0l6# bc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"Bky7 p-L@L0`SP΄P P0  hpBk - LRp` <0S 40 P 40 0 R 0S 0 R 0S P@0H_$H`UT0D@`fPUV00S@ PU P80080jLj -@L `P pP 0 0 R MPPU 0 S 0:: S cMP0 Q 0S R 0 S PUX r0rS f@P@P T 000 RxMPr r0R Sr -Lp`@r00S *@P @V PW 0P 0 R>MP @PP PP -rXLPpr@`F PZ 0SJ Vn 0@S``@@ 0S T  0R0S @T r`Q; WX00S 00P 0PPP R 0 0S/ 0S Q 0`0P0SPV``@00PP0 0RXp`P pGW0T@j%$ @ -@00L^ R000 h0  p-@LTP` X0X bP P 0< a!0S00@@p7pjj\o0 \o - QL`Pp0@! S 0S -PWPTZ Q++++++++ ++0+p++++++++-P PA @ MVP @0 P PzP$ 0S( AdP9dPV X8P0 0 0P i^%dPPPP9P 0S  0P4 @ --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 KP P  KPW  0RP 0 dP Pp@TW 0 |dP P(KYYp\oʚ;0 R0%3 %'jpoP (0 P0 Qjho 0-L@PP P0 A0po - LT+-00 R310 P0 jho o 0-L@P0P  00<0 R  R 2Sj -\L`pP@P 4 #P P%U0pS*j+ -< LR@ g00CS 5 40 40 r040r040 -0L pR㐀` PP%U s@P P P #P4 #P 0`S*hoj+ Ȱ-P2 S R 2 S,00CS,0 R0000 0 jp@-@` 0 PU1! \ *0 00\: Up lp@tT 0-L@0%PP "eT"0  0 J0 -0LSP' @T=@T \JP,00,0@Tp, "0R8@#xT0W0 `P pJ,0T0r,0  @ 0``@00 ``pjP -`pL PP# 0@T \ x0$ @TP0S 0Pl 0S lo,o o 0-l@LTP#l@T  R 0 0 0 R 000 0 0  0S0C0 r!l@T0舷o@ @ -`p44!L l@ T\ P@T 0S R 0 0 0 R 000 0 0  0S0C0! c $P7 pP `l R0 0l ` 00  000!jjol @ P-L 0S 0C 0 h! @ -@PL0 80CQ840Q 0 $ Q00C0M@P 0S0C 0 [ hDh 0 (h !!`oLo @ @ @ 0-L MdP@TX0T$ @%@0@@ 8P,h00K0!j @odoBk+ @ -p0L @R  PP 0@ 00@ R 00jdo P-LPP:0A ,`P0  &@P ̀Pp  p !R  !Rտҿ`@P0P  80P($0 0oXhojpo -LTM0P,0 pKt D SR@lP 0P @P 0 @TT!` 0p0`p 0 0S D1R  0lP @ t,(K,@ 40 800800 S 8 ,0K`P ,@ 80p080,@T 40  p DR 0l0  d 00h0 <0S 0 \ @0 X <04  to -LM,0 Q0A00S0C0`00`SP 0S0C000S9*  pG@P9  @0 QW  QdP 80S0C80$0d040, ;Pd T00X R XRX  0QF -Lp`Pk@T 0 R P@*@P$@:@P P 804 0C80 0 R @@T 0-80LS@P 4P 8 R 0800P 0SP 080P P4P 8Q >44P30Q  R 004PPP 00 q4 -LHMǟPp, Cd @{`P/`  000 0WQ W W, 0`0 dǟ, 0`R(KZ Q 40  @0 R4 @040  < 8 40 <0000D R0 00NK4,4X0`0 0 P Q@P7`  00Y40 ~100l0r0Pr w7`   @PP <P  PF @0  @P= 40 = 0dP 80S0C80Ń0d0h R800C80 h P)40@ 0R40 0S  $Z000 ` @g80Sb080` ^` [` X  `P P40740 0RX0 f {P4,P  0 W0 0@ 0<0: r0 X0 0 PT d PG0S  Z@8008040 L  @y007 P dP ` l @ 0Sh0 q l LLl80l0r 80r hX O  P qP \P4040774040TX (P\ # 0S0C 0 40 hP>dP; ɼb ` ,P` 4x40 r0 X0 0 T \ 80S\0C80>TQW @0S h 0@ 0S0C 0 0@ 0<0 0 S l m  l e g00CS540040 r04 < <4 r0@DoLo`o= @ @ -<1LHMZ$1pW- PU' 0 0X" R 0 0 0 R000 0 0 `V 0S0C0PUpW  H(Kl@KDN0 0h  r jdooD @ -LHMpPU$  R 0 0 0 R000 0 0X  `V z0S0C0|HPU R000 ˻ Kd@KDtN0 0`  r sꈷol @ -2LxMP 0T0 , 080 Qp` d @KDKN0V0h0 唀 dP  0_/NKl  T0K @Vpu 0, 0R(K _? NKl  T0K %pPT@T 80@ 0CR80 @0S  @ 0S0C 0< @P 0<0 0 S    T0Q'0S$ [IP7p @ B pP800C80 @0S| PZ 5H0S3pApoPT@T 0 80S080lZv Hs@Do @= -LPM`PKpDd Md@ d0K\ T 0 X 40 r <`p@0 0OTd 80SK080d4 -<0LS 4@P  # -40L h0S  - LR@ <0S 40  - LR@ <0S 40  -LXM p x `@Pt@ 3@& 0 t0 &30#P00S, 5 00 R' @PP 0t03 R00SI TU000!000pKDLxpK t0l hp d T (K BP,,@0T P,A@,P 0S 0S40 0A@P   040,  0P, `@qopKDL(0K#x`pK8 <@ l hp d @` @,PP 4`P0t03to|oxo -L M@ 0tk%}Ll0l Q  0S0 QPK  @ oLo,olo @ 0 000 p-@PL,`MLT*^1 @0 CS  @ Q00T0#Sp p-P`0L+L00 p -L Mp 4  , 4  RJX 0 Z0 PP 0`@PD 0 10 0BR0U ` PK@ TXU00  S@2 ,0S/ 00S 0*0S' 0T P+ XP @0 S,  4  R R000 ղR000 Z0 P P00PUP U 000004 @ (K 0K -LHMlKP DK1pWX5R pWR  R@T 0 X P_0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P?0`S P 0S  00$l0 0#NP 000@TT@ L@ `@ pW(K 5d081 0/Sl0 0 NP0 00j -L(MP@P`0AS`(KHK ` K 0`T<0 H D 4 @ T pdP RH0L 0CPS ,,$,,0,D@QPAL``L0P,<0@ X < : 400hS `300  x`L{@`U @%T Q0P U`P  ``0 pBK K ,0K21C0b ?A1c0to,qgfff -LpMⰁ0`S( @2 PKD|J< 00 D\0   @0|0 x 50p0 7S0 `;0pS PU 0S( 0R1$K 40JpK"DJ"0J0KP  HK@dp 4 L r0(0 080<0< 0帠 0LP00000@Do= -L M 0@0 S,,,,XP,P @DP00S@X/ , @@  I,Pp @Z `Q 0 70 0BR0`0 GPP$p W@00P0, 0 0(KP@,P P@,P P@,P ; D1@$DD 0-40L@0PP X 0iXP C8000a0h400400hMjBgfff -L`R@pP TU C@@TS S *@D0 0 80@0T@S# S U *@CD0 0 000U 0S @0`v P@ @8`U 0S @000 -LM`@p{TPQ T< T  0p $K <ㇶhQ@` d0S p@ LpP;0 Q080? Q 0001 0  W0@004 0 a `R \0p40 pU P Pd`00C0 00C 0 j(00C0000q ,oj --LM0 pR,0 Wd2@TS P@T. 0 !0R1S R SP  k>P P  c>P0`Q , 0BSX,,,, , ,U 0 `0aR  R  40040B(K 0 WP LB 02 8p.40`U  0UEP0  0 `0aR  R0 0 VP 40040`0lBPz8 r 0Rtc0PoPLPj\oʚ; -p0L PRp`P @0U P .>$$ $0 ph4ojjj -L@PM t x \p `(KPPp UlKDG t URUT 0 Z  lKX ` L Pp > 5U0$00  l0 08! t R00 S W&  00tlK` d0 h fPp  504 000r x0  0 l0 08! X4 0 00p 0PUojjj p-0L PRp4`P @5d081 0`0,P0?O$ $0 phojjj -LP ^@ P @00 `p0Z 0帥,嶠T 0 @0 0mfojjj --LMTP @ 0U, X0 T@ @  0S FPP 1 0S pDA, 0R(K `V0S+pWV V(p PP7p  0m@d 0\堠 0X4  X   Ve\W 㻳U '7Tx7pv-pZq 㨳m6p 00S0 0* ?SKDEF 0 K0  0Rl0 0#S0S 0#SP)  @P  0 S*`7p0S@ 0  8  p@PUpP `p;P 00 0@Sd,t,,,,,,,0`P/pU  @P 0 `pIP`/80080Q 0 0s03R0#SQ{ Q2KpP-Q 0P ;Q   0PEpP @P@ } 0S0 y P` @T @P P 0S  K@ 0S0C 0< @@ 00 00 <0mt40S 4 00 040L $(<050r   400@0S 0S K0SD0p@T U$0T 00T00 $r 0T0 PP Q  `VSp @P @P R~ 4 0@P KT0KpPT`80080 00 0 00 D 7SD 00 <Q 0 @0 50@0|0  |  0 K0P  a@P D '@  K0@04 (0,@ r0L0 0(0 0$N@K"D"0N0KqP  LK:p@ | `@Rf r00Rb 80p0800S K T0KpPT R L ($.T `800C80T0DT r00 0T <050T 400Q@ 0SS<70S7@Doqjojj= @ 0P 0CP>@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\30S<000S \ -8LS@ 0CS8 05 8S05p@-@P`0#U@T$b0#PU0t0# ^# 0S0R  ^P0,0,P#pԌ=P0L0Q00P0S>S  f-R!,!,!,!,!,D\ 1 R= p-0 0 p8LS@`) l8PS ",",X",#,X",X", #,X",P",:0 00CS",",",",0:0p080p080p080pl8S 000;08X 0\<0<0\8 8|"R f-41 \ Qp= Q-L QQ20@S4$,<$,D$,L$,T$,\$,$$,,$,7P"  P P nP P,$`0 lH | @ Q-L QQZ$P> 6P? P? PG 0@*S%,$,&,$,$,$,$,$,$,&,$,$,$,$,$,$,$,$,$,$,&,$,$,$,$,$,$,$,$,$,$,$,$,$,$,$,$,$,$,$,$,$,&,HP 0P   `P lP`@ 7n @ -LHM@ğ0@P"}`,0 . 0<K ^Bp h h0S]h  h #0S: 3 0`8 Z <0 "0Ql0 @l @0Sl0 P P 0 `8 p<[\v;0[Sq< K0 R  P(K 0C< K0pQp <0[S%@<0[@S0Q w1rGrT@k8b),0`JVd=d @f @ 0-8L P& 08#QQ B0S108# Q t 0S1 0P0Q@@O0(00 @ C0fd -X@LQS QN Q` Q`  V`!0S6  &pP VK  *z  P<, P PP@1 R P48 Sl8娨4S UlX %00S\8<\8 I4``V0 Q2 RP\8<\8P 0S8X p ``PdfJ -@LJ9V+"" R222 hC -LMp G2i 1 0u ?!P0`00` VP O0S 5IP? 0 `0`S  V P`AP1 R!  0@!0<)0TL1 Rd  d 10b 00 R" ?2p+I0~1R7 1R7 = Sd 000 0SH 000 0S, 000 >S 000l-dRx @fxj8?0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫`8>-  0?/ 0 ? 0/? 0/? 0 2"D,C,@P&|5,5,5,5,5,5,l5,5,5,5,5,5,5,5,t5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,l5,  \8 01S]="!B10b%=00 0 == p-OLTP`@@T 0R! H4P V @4Pp -LdMP,!@0|  ,0 p` *4P.xK  ?F rK;F 4P&lK 1F LK-F0XXL00 0C 0 x )0C| P, 0R(KxK  F@lK F`@Do?,:, @8= -LM0a b0^( dpc ^( 0R)$KV#NK 0F89 bHPK1 E#NK 8KE { 0+@DoP= -LM0娑Pab0^, d@c- ^, 0RU(KVpfL@H$H"00 G=@D@H$hOK  t!008#_ #<" a0b1p tE   Br@ 000S0 LPK aEOK <K \E   0 pb *@Dol= -LM`V, @ p& 0PK0K`V0[ 0p0K    K V@@K E, 0R(K@Do= -LM 0`  4R$ pP# R R $ 0R, KOK  QOK QOK 8PK WQ D@Do= -LMx0Q@4`KPp $0 D < 12$ 0PR Kx@Do= -LNMPPP$ `pVOK   DPK  pD$ 0R KVOK - P( $DPK  RD0@Do @Ѝ= -LMO`TPp@@T 0S 2PP /D00l8S  ?H ឩP @P D0@0/@D ?@/0o@ -LRM`V, h l p!  p2 K0!(KH@^K  `V$ 08 p#Hhl!.0(K@ p   YK VL@K C, 0R(K @Do= p-\8L`P@9 0K 0 9 < 0R>:0 "#A10a%=0 00CS/B,pB,B,pB,pB,pB,B,pB,pB,pB,pB,pB,pB,pB,B,pB,pB,pB,pB,pB,pB,pB,pB,pB,pB,pB,pB,pB,pB,pB,B,0 0  0)S0 SCLR0S 5p1S]/phphphph  0@8S"!B10b%=0 0 0C-LSC,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,C,h5h7hJhy h -0L0C@S D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,D,|D,hb0 P 00CS`E,LE,\E,LE,LE,LE,XE,LE,LE,LE,LE,LE,LE,LE,`E,LE,LE,LE,LE,LE,LE,LE,LE,LE,LE,LE,LE,LE,LE,LE,TE,h/ -OLT` @ RD0D0D0?@ D0H 0٧OT%] Pp0W 21C! c%- QpP@  /W h/ -LHM(0` ,0  00C  0@p$@`P 0h d0 hPK`0@p0 l@ ,p@#$0@`P H#H$8!,pp`\ \` : \  >0>|4l080S* @4PK B : X K0 80VKW0KB  PKB JKA/XK  BD@K- {/P  92`p唀@@, 0 R (K\@ >0>14@Do= -L(M0p,0 @0 @00P K080 PNKO0KA  HKA BKA PK  B { x2P 5PH 0 0 L0P 0 0 B0  `!4 0<@K040 "880 "4<0   v9 C  eA 0 0  00 0@0@<, 0 R(Kt> 0t>3'@Do = -LP@00 0-LP 㲦@P K@0 0 -LXMBP h d0 ^, 0 WK` W0Kl p 0 SV K UK @A OKA IK@0 0S 0C KB0KApK{ 0 S 0 0S00000p 09K 8K90K@d h"$d@0x WKlt0 |0 *|*X*4x[@ <2K.0K倠[h0[ lLXtYKXK1K/PK-0K$$h0pK9@K8Y0 0 @ J40` YPK 0 0# 0Q`   0 0# 0Q  `ҩl00 @l000h@p `lé, 0R(KAK u@;pK}0 SG0V0K`^^I@Do = -LMF 0 ,0 P  0Rc0@0 @a  0SPP  0@0 @ 0@ $H,, #H8P`0@pL#D< P0 `0@D p4R  *03@P@ (  q1P0Lk\ 0T@K 0P S  b K @DKd@K @ ?DK @0@00t K6PK5@K 0 0lS | 0 oڨx@ 儀@ | 0\ |  X< Pa 0| 0aUP!0Up`$@@U ( K L0Q 0#0, QY0#,0AڠTKT Kިx08#̠DK#8t K@x0 6K50KѨU|eP |  @2Py 0kR 07 0R@ @ Y TKT K⤨PT0Ed@E 0TEP0#U 04@K|0 0TK ,PU0K1A, 0Ra(K; 21L0 0. >0>1 $ 0S0 10PP =11L0 000S 000010PP 0S: d>0d>U1S100 >0>I1G1 B1@ d>0d>91@Do8= -LP@00 0-zLP E@P  I@0 0 -LtM 0  ,0 00 #2P   0P 0 iR 0 @ 0S p+0 >P`0P`P`@P "4 <00 `3 00 "8 80 040PP "40  jLK0t>// t>0t>/_@DoP=G-p#00`400$M400 0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝ耎=8G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00耎= -LM\8`p 0 xP 0 031C0SlY Y\85\8  0|倏x? 0|倏x?|O_,0P90,9 0   @BIo`, 0-LM8@SP 88 R 1S00 08h) -L(M@p`Qb,b,tb,Lb,8K00S0,0K00S00,0KPPK0+0K)0K*0K  G0  g@ =@T c(K8K  `;2K \;8K  V;2K R;8K  L;2K  H;8K -L\M8Ft 0x p ,0 h l tT  0RkhT 0 @j h@00S  P` | |0@$$,0@H p#H80@ L#D<P`x0|@ 0@|D p4Rd ` *t0e.@PX@ 1 t N,P 0 BkR 0 X 0S X hT :X00@00l@!!R x@d0 `,X!8X8U.h"H l0x@El0⠐!1 0 1dP@K8#8  lX T@0pdXGtTP@\  0@a0g T@! l0\ dX\ p.P@ 0W 0pU` -P`v kX RPP B;+-1L  t\ @PK 0 + 0l \ 80P[l04@K!T0X 'P^xdK0 l0 !!t,, 0XRd(KE pt>0>r,| $X h00Sh000d`,XX.hE =X,1XL0 0ptd>0d>K,XI,X V+lxE⠐2pp>t0>7,X5, X 0S:t,,X*,p@>0>dKX ,X t,X@ p@td>0d>,@Doh= -LP@00 0- LP@IP l8S0 0 1!1!0 0 -L,MP T p L ,0PH0  T *PH0 0 R H 0S TH < < ^900 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 ? LdT< 0bY[H@0`pD @0 D@b 00gT@! @ID @   dL0fY@`p @D 0WpD  0VP_,Pg PY P P U`` P   P L0CoP"88 KL0 1; +1LP P0H@0 ) P*,P3 0 0 0PLP!0<T @ @0L 0@P 0$$$$ P @  L0H 0 0 0 T*H(KP Tt>0t>*H*0H0  =H=+H1HH L0 0PTt>0t>* -L,MT pPP 0P,0 L T0` 0R<@K >8 9K:8  L|T +0PD0 T )PD0 0 BkR vD 0S D  8D0 @  fZTPITD@PH  0@a0h T@! L0dH 8 dZH +P@ 0X 0Up `X+Pp? kZ RPP`` B;*1L  H P@@K 0 a)0L !@0S"T*, 0DR,(K =Dw*D1D L0 0zPTd>0d>)D)D PTh>0h>T)D P Td>0d>)]@Do= -LP@œ00 - @LBP  -L(MP `0P L ,0 0H0 *PD P (PDD 0 jR 0 D 0S P@D P 27H0\ 3\H01D0, ,400<@K30 7 9K7  HWP0eZHD@`P @  0@a0fT@! @>@   dH0\Z/P`@ 0V 0`Up W*PpN jZ RPP  B;)1L   Dp@ 'P%@@ 0 ##Ƞ#\0PH0D 0 0 0 P(, 0DR3(K00 Ši *P 0p 0LPt>0t>(D(D =DN)D1D L0 01Z@L Pt>0t>( G@Do= 0 S00RSS   -0.0RL > @0#200   N000N "" N04\0N\8 2S0S ,> 0,>0S ,> 0,> -LMl8@S 83 0S00 =$  0 p-LlȐ@\P p`8  8S 0S=0=p` '#P =0=p> Q 00S:` BV  1R0x 0| 0 0  C B  R  0 00<0!0 8Sh<`10hD( D(> 0-LM@KP 5 c#P P P K0@K \l5 L#P00CS z,z,z,z,|z,tz,꼐== 0-LM@KP K5 +#P 0Sx{,`{,h{,z,p{,X{,K0@K |35 #P0Sx{,`{,h{,z,p{,X{,{, == -@pAPL,0 P0 Y 0 0帡i:P)0 Ya: 10YV:`A8s P#`A @8# P 1 PC0S@  Y:: $10Y /:`B(r00" P `B@#8#(P 1Y: 04Y1: 20Y :R0Y:;0(00*0~0\ ,>(0,> Ld0\ ,>(0,> W 0-\PL0@  0S0 -00S 0T0;00 - 0L S` "!@21C0d!P2Sp 2S? /t022S  Q ox02 - 0LSp00 $("8k". bSf@5S 21C0bAP2S2Sbi2SVㄅd5S @d5@P8&0f T0@f@d"0d5 -@Lh@ - 0LSP@ \>lȐ 0\p`\> \  8S 5h#!4 0Z @ - 0LSP@ X>lȐ 0\p`X> \  8S 5h!4 0.$ @ -L,MPlP >0>(Kp8S ^ 0$P 0  L } 8 p0Y40 `: 0Y:0D < H @ 0 S@`  S| `pY: 0Y*,>0,>H0S 0SD0H  T>0T>PL 804$@0<0> @0Q>q @Pl"0002 R 3 \87\8 \87\81Q3#541 R\ \86\8 !000 o5 \1\TA@08 #880~8 S808D>0D>UH` 2SD` | SyR,>0,>s+@K 2 PhPf0Sc0< S < ]< R pP @ 000t0\86\80D < H @ Lf B`z@X @= -LM@lPP p8S p 0 `P:0P:0S` 1:2S P*V 0SX 0 SS : R <>0<>,>0,>; P0S\88S 0 0  000P  pLPPPP p-`LQP@ rP   1p 0@S . p -LXMlȐp\x |0  (Kp8S @P0"0S 'PH>0H> t 0QX0 PP "P 00`\ \0 VT  0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SR,>0,>+@K w1 WP0` S ` l d p h ` ,>0,>l0S 0SpP 0 S: R <>0<>|;/PPx(0BS @P! P 0L>0L>aR6 tX dP> 0P>00x0\ xJ/Pl h0xp\86x0= d0S ?` R ?E(Bx 0 :G P 0xldL KjPx0d04[SC +x0J 0x R 0D"x0<0| P0T x 0|0 c 8xp p \ L K+Px00`0\ 0xx0 x6T>0T>nȗH0  4[S *d@0 <0Q)[<0@#[ #[  0@S  ^ H 80S\8 ^( Q& x cP7H @0xRR0 00#[< 20[0P0C0S20K}  x@PPg20[.곐= -LM `QpP@D @>l(0R@> KČ508 B#8  8  -LlM #R0 (K8 p !0&`0 " $PT #0P0 X :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*,>0,>xQ 0S| R 0p S`1r'R!0>00> p8S `\ Q4>04>`010 5. @ |02PP `P l8TP S 3  p R  YpHT 0S :Q ;@:0 t'|0 i/ 'e/0@ 0  -Z/5>0$0#ḃp0X tt0x @l8S  UR; 2S8  2R ` c0S hP _ *S[R 0X0 V2S tP R SOR,>0,>I+@K D/ P>0S dP : R7S50lSl /`8 YQ x t ` | p l h d X )l8S \8 hP ?TdQ ?600`p8SP8SMt0XS ,1 R \86\88Xt30( ; 0 Q(503l0S:  6 `P P\86\8 L KP00dPH00@  <008 < #[  hL KPh@ =f -LMpW( F`(K(0S(  Q 0  0@`W1(PU !@P,  PfkU; #!1L (0S 000C `b 0 @P  P  ( (   |  -LMP\, ` |2S  @2R >0>ob l(|00 @R|0@ pVZ D0P0W0SJ\8 1RG  o 1R 0@? P 8SV4 p`!1R8<0!0 1Sq<p10q!V ! 0 0@0@/00@0@` J, o)t 0S"pP 1<100 @0@00 @0@ꈎʚ; -@L 04"48#hV1ھ 0R p  PP # 9g@ 0Sd$@P>0>0S0S ;%`F>0>mꪪ -LM` 0PSp :@00S <,d,p,,.$PP>0>#2K 01R0S= 0F0f8#8 $#$"KN  ,00 nPP  $K2K  ,,K  ,2K2K  ,,K ,2K  ,,K ,0SFKꪪ 0-@LP000he -LM`1pN#28 ,0 @P0L(K2>Q 0, S PU @0 0@0@`00 S0 00#  UP00  NP4 U 8 000 @4`R`@*0S00R0@Po,0ྟ ` -LMP p@@T0 T*   ᨑP 0 $aO8Pp@e 00|  `P@ X 0`P(K(KoPp8Sl8S t=Ȓ= @, -LMlhpV80  PU=0= X P  ラ(Ko4@=0= < 0R40  eU=5, %02=5:0S@@T 40 S00P 0 <0S p8S T10#00"-40.   0S=0= p8S 80 0 08 lhVa < 40R  <\l \KR=0=Fl8Sl>0l> p8 S@ 6  TT T 5P  1@ 80(Kop8S `' .P98 SE >0SU0  0>0>0 0@X0@K(K`8  8S0 u0S0u0.000l8S0,ģ,T,,T,T,,R =0=#Rp8S ' P =0=Rp8S `' P8 0!0 `0`S \8 ( 3 "0@. >0>>0> P P  \8P 0@L0@ >0 >w  P>0>n P  H2 "% ,0 (KoeTPT>0>00@  PPu0Su0.0C0 0S 0 BQ.0S*<0!0 8S<10D( D(0S 805 Y 0V  "P>0>U L 1 0Rx |   00C00 3 2C 0%R &80  0 P* ,0 (Ko P 8 00 @@ P 00 0Pj -  jLMp 8#800  bp1*"*RX,  P`M @d20\`, 0 d%0200V0 j = 000d 0R 0, j dő "0h00 0 0dő*2 0R j  $0 00C:0(K -`rCLM gŞ8\P# &80 083 <   - 00c:#: Sʲ00h:#: S>0>@gV@8 00h:#: S  0$KmJ -0` L p# @T  048#  10T:0BPU @0 4#2""0EPU@ 04#2 h -LM̂P` p0 0 S-  0 9 280 c0@Č, 4 0Q00 l \8  <   %80  040 2(K!0S:1  &8 480 c1 Q051Հ5X8  S @bV>00V. x,0 0E8@S`!0P 004 0C0- :0,40 0 Pd PP2S  P(8  0b0 %,0V0 <   | 04 0b:#: S40 (KobD0Q5Ţd㓍%8dUw''g- 0S00\ \0S0S *)SS-P\2 ڰ\- ʀ\# \ `>0`> \ 0\ @\\ \\ \0W)0z -LM, 240 4P,08 eV>@0p!"0 !- 0 0cʠ,ʠ \Jʲ 0j:#: S6 0b8":#:SXP`M @d20\`  0 d%0200V084 b!00c0:#: c ʠ B0Რ,ʠ48P0n@ 0d00" R 0 0@0@,(Ko, "00  d50P00 d5" Q 0  \84 b dő "0t0 00 0dő* 2  Q804P, e  0 00C:0(K 0-P@L !' ''0:0; B0 [0C\%#53c0t0d >u & 60 0&(0 l (p08t (780bd -`PpL! @&' &:0 0;pp0 0\4[BCR8-S0T 3535t0c0u >d 0l 6 d0&06(l 8p0(0t ȗ x0Px00x08Sx00x0bd -LM☟?\, p #x?\ =l?\ `?\/ T?\%\85`0& 000/幑@P 00 n`>\ .>\ ]>\) >\ >\  0`, 0R(K>\z x>\ 0\J x>\`8@ d>`㳀ᴁT>\1 EH>\ @>\ 8>\=k`P>P<  P1r'R!| 15>008<9p8Sl8SH 8p R 4`=\ 0\ =\<=<`P80 H=\| @=\E 8=\<%`P= RT `8: \8 ;4`\8{<\ <\ <\l5+ `k<\ <\ <\\M@K! p8S"9  LKM0K%! v `M<< @R`hF`D;ِ`P>\Ș  0S774`4`\8\82h;ǐ`P,@ [P\8;\8l8S p8Si\8  % ' HP4`:妐`P `8 0S\8 <4`\8\8^<000=@00Pp0S `:児`P0SS0`021Cc  `PpW@P`\8 :0 0?00? 000?00?000?000?000?S S S S00 0?00?000?0`0` `p8S' $`\8`900z\8`#500(00qp8S3l8S<e`e48`P_l8S\ 5A0AS2`WT( p8 T( ST(  08 20C(t`<7я`P6MK! `P0M0[ SN @ }M [)LKr$4`  0"-P`7宏`P`8@ 208S64``6圏`Pl8!S \84`20\8p6剏`P0S \85\8  3$4`$6v`P`8 W 0S\864`\85d`P[@P 8T` 8S SU S` 0X5C`P*`l8\S >`1 50`Pl8SK @# P PW x0 `~l(R \8KT % #`r4\) 0\dP# P@P 0{S`̠K|P 000O@PT 0|PSP:|`E  | m`P CP  `:8pLK:0; M0K#`-\85\8 {4`# u`00CS` PN R4 0S1 R b0a ! c%- Q R0S00000ac00 `P `P P R @ \8 B<4`\8-o00?0o??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0?0?0?00?0?0?00??S 0?\84`6\8  "`{\8;\8%  "P"`n<0Qj 8p Q4`e0` 8@Doii 6i(i8i4qi i8i$i4i i5i iiiiii|i  0@ @ p-LP`d%R @0@S d% Tԃ0d50`V0Pp p-l8LS@P9n0S( u0S.00C0\8"0 R$ 0  2S 0 9t#92! !00p08p+f @ -pLP@ {0p1 -L@ho -0P00p00 0`@ X1\A00x|L B tB0SS0 h  J 0<0h -LM>Q` 'H1pW:tX!^3 9 S02 @">)t")"1110S'  2S 00 08\(0C1|200 0mml@ xf -PL@ p[` \[ sV @[0S  h[00[0 m > a0 >[@ -@L`P᫝p# +@P @Ph -LMhP08p᎝# @PJ 8S9S7 ؜00 0s>J0>X@, W(8R/0V 0S`lQ  q30 p8S 5Q !0 l%0W0"! 8 S 0 o臜W 8S S 8;SR 8S S P 8S S 8S 8;S @@ -(8LR@`(8R p-PL#M`@kP<Q phLp -LQ@ 08tP00Pf d h` -LPp`@P 㯜p0S  0S 3 #0S R@:0S  0-LP@P 40p0吜0000d H 0X@ -LpP{`x@@D@ϛT8S hǛ* p-@LP! 02 8  PDa <]P`#  808ph蠛@V-8i- p-L@`4PP8>08>   ''8p p p p-L@`PP8>08>  p 0-@PL$ 0p1pP 0h0 ( p-08@!@1L<(84!41(8 $1Q( 1@(0 1Q0`0 >BPPt" `8 p0`B 0P0P2  |ɵ lĵh ph迵XXPLDP4,@,x,8,tj,j-X,0,x@$=@ 0-H/0L000000/0P  \8 00000S /000000001`(  13` 00000000 P  R 0<0 p-L`pPp1rGT@<)1@$R@ p0R@l8SFF \(t10S: :  D)@R :0RD @\ 7$ /0/0@@ @@)@@0SS S S@@/0< @@ 0 S@@`8   P@@p @@@@@ 0'%  iP\\ @ ;`P@ -LM\0p-4K , 80 f4PK`Y @'0' <0 =P/ T \P , 0Ra(KX@8KP*\80\8  [@TN 8KP/08 48KP T1@!P@T P00P<@0@   0`!3 '+0 <%! xXh @ P\Ǹ8KQP < 0 4@Do`z@@@@(@`@?x@@=@@ -5LP@h\80\8p@ O['p ! l8S\8 l'00'09 :0@ ; @@- 10303\8 03\8     =/ ?0/ ?0/@ `8  00\800 L @p }a= :0:  = `8  0|r00 㾵0t% 5N@0= 2=X< 0\,d`<= @ -L$M☃5 p$  \8||# t0X8#]S\8P0\8l8@S P`GS08>U@ 8PSPV 0RU`@V(  Hp2\8 0108l(R9 0  1l8S\8  9S(PT(0S  ©0T8 0CT8⺩X80X8b$ 0RV K T8  DKxN`P p 0KQp$@U0@$@E`P\  r7 S1 0K $0RS1\ 5t{<\ 1r' R! P: @Do@@@f= -8]p`LpP`V5n`1GT@ \8 0  8p RhQG8 p` -L@ hb p-LP6`# @P |0S8;S08P@|phB -T(L@'l8 S\8>00T(.\8>5 . \8XX  P0d(0(00 (0j0X8hl@@@f -0l( @RppTLP`> T3 T 00SX ͗ p@P U. 0000PS S R  '8PHRK 00S,,x,x,W 0S00l8SX HPPX X '([[ #2S  R RR 'p34 P'p3~=j -l8LS`p 0 XD000囖<@#PᐖUl8SSPP [[ 2S  Q0l8SP 0.RP P PP 0.R 0.R 0.R= R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQl8S S \ p0  ˌ,40\00S 000C0@- 0000t 0l 2@ 0 0220 0 " 0\#40@fF=*0 0 > \ R 0   .0 0.0C 0@-800p30C0"\"h"D@P` 0-`8L P@+  0 0S$> R 0  0S%<0!0 |0SxP<P10|P @0u0S 0 0S0 R>  0000  p--0P` 0 @ 0 #4L0 ! z\\  0#40 ", 0#80 "$ 0 000p  0-20P0 @P@D@L Q0 p-$1L R> 0C0S0S2Q` R 0S0qS R0Pf  00 0 00@0@0SX0 R00H0@ p`0`   0-0P0@PT@#@L 0 0-0@0@ LP0 p-8L`#X~@P   ;0 B 0P p -(Lp"hdPP @  K0 B  0`   -(L"HGP  0 0 K -(L"H5P  0 0 K -LhH#PP&$x 0 $L&  p@开 -LMSPp" +@Kp Z0 0  Q00CS - ,- , , ,, , , , , , , ,,.@K 700P@ `6?J&40`P0`T]Z&40`|&40`  04"#400<00Pa`8 R(K00P @`  00@`  00 (@"h  08#h&4  0`@0P`  00`P  08  #hP00P00P{ ? S0C0P G0 0R  P 08  #hPw 00 (P"hiB=?=@@ -"0L@M+pK0`P 8i e00  0d0C0<= 0-00@0PL00C0d0C00 p-@ TL`PP T000p; 1ph @ p-0L` P@P 00 P  0#40 b p -L hP @P&x . "(0T0+0C0@"4& 0p 00b0 0 -L H` PP$x 00$,0CW0@p p 0$$@ 00 00b0 0#4"B 03#05C40 -0Lp @S`P% P" l d00!0C0 ?@Ì,40O2 C40  0#40 b R0 R S * S 7S,4 0,ȠL,4 0,Ƞm -L[ R\8P P\L@`:V 0\8%1 -\8 0  00c0 0p0  k0   L0  z\0  p0  e '  -L`pP<0Ȁp 9QA0+ Q00 0 P@P ) 0 S0  00c0 0&0     0- @=00 8PLp0  i 0 -("x![@0T``DLW ;40T 1 #   P `P(  W'40p 0 0#4[@000,[0 S@W003 00c0 0p@  W003 /   g{  -0@L0p0 -P\L:0[2` lRppQ@@\L&" 0< R 0  440\ 1 #       bpP pP @00 岀 '  㶁#" 3#4!0 )\8-  [@{ l8S50 R5 [0S*\( 0 00`0c0 0;: ` \( \(\(-fj -t2堈 PlRL[``pP: \@@\LS 0<O ^I 0 E 4 40\      `P1 @ 8#  ȕ 3[#4 0: ;  l8SA 01 RD [0S5\!* 0 0c0 0(0 C\ %9(0 Q\ s\ @_ 0 R f -LMQp`x PX P @ @PP`0!P21   n j' f`8  VV?0B 0@005l8S> <0!0 7S㴧<10ว'0 5'$Kl8S  PR 0"A_p`pPst0 00d V 5 @0 @   7P bt=Ȓ=8@,@ -LM@ P 0iSS2 0 S@Pt>0t>! 6K   pPx>0x> \8! |2S3"[R>0> T*W 00@(K00Sp----08\(E0@0 P0`U  ```"[  @Pt>0t> @0PS00`3 < "!0< S2 < 21C0b10"R`< 0<<0021  ,2  "[2R P < @ 1 "!l8S񟗁-h------pxPLpPM 08pyP00  7' 30K /\8  1  0@00l8S pX00' 0K    00  0K  '  !P0@0p/xL000壍W0 x>0x>ꈎbd@ -PLAAP@`p Q,2 }P& 0iSS"`V0 p`8  0S 㲁 !1R 1 01\0e7 0m<p10!RA<@10A!00@  !0@ 0 0@0@5  '@ -LMpQ@P 㾍000@UG ڰUJ PUz Ue |>P0|>&U  U 0U("(`P U7 U((0 `Pt> P0t>U `P 0 PPX䈄X`P8((#8`P l8S ("(g`P 5 !%0 0x("(B`P 5 !0 00`P {@@,@ -LMl8SS, 2l1S5  0@,Hp` 0@P DP`  0@  #Dp0>$K, d1S* 0$ ( >0>,0 8 P8  0@,Hp` 0@  PD`p 0@P #D p<P`0@!(#Lp4,0 (@dh! ,@0l1 8 R 1S>P0>F E0@$@Ap`D0@#D <P`C B0@!(#Lp4  $Kk -LMl8SS0S (K  0@pH,` P0@00 ,@ 0PK` 0@  D` 0@ P #D p< P`0@!(#LpX!4pR >0>\1SP>0>ʧ0   00C8#8S0 \ 00005 !ޝ ,00 i tD@@ -L,Ml8S8 $K  0@,Hp` 0@P D0P`  p 0@ L#D(0>8 X1S*80 H P>H0>8@ H HP4 H(  04Pa b04P 044.J@"!Bb%=00.D 00 , *D HI8 ,@0L9P@H0P9F E0@$@4`D0@Ap#DPC 4 p0> 0$ H L0 %Pa b0cP4epX:d d`0X8 %< % *0PpX`): 0X%:0SR+@K   P0S0>{X1S:<Qt L <04  0Rk0>⥤1 S p ]O x  P' 000l8Sx200Sx2 5 0S00KhT0|2!⛚ L00@&p 0KhP@@ -LMTJ l8S, 0J, 0R(K`1S8  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L\!p4Rp: >0>X1S*(9   @B P0΃! lpKJ? p P@-P  @>0>T@ P ZP a b0cP4epX:d d`0X: S 0PpX*: `0X%:00S0S^ PP Ro@K  P0SP  S83P ptQG R 0SA  Q 1S `@5 pQ  0R  00 0    HP^  KP 0S  0S8[S ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0X\!`1% < Tş0L 0 PPk :  04P#  | P r@K  P0S0SP @@T@T@ PP K0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p]O 1q刁x1PQ   Pp3#  `VX ˿  0R@@"!Bb%=00 0 } HI0P)L900P9F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 X\) T)0@ <  P@PUZ `0S9 D0D8S221Cqpc%=00 0 HI0P L9  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  T)`~p  P@h 000  L0  lQx200Sx2w0|2q@Dob==P@@_= -LPMtPlPP, `@p00CS, 0R2(K!00 0BτlK/JP3`P>0>⁡00`@ {pQ 0 R 00 0`G GP5a ᆗ$0 0@Do$=P@@ -LM P` 0@lHP 0@p PD0p ` 0@ P`80 4@ 4`L8!D<`P0@ H#H$8p!,X1S  >0>(K\1Sa b0cP4epY;:d d`0Y40%0>Ox t0Jo  $t L00 <xx X1S>:Ģ@Doe=P@@@= -P0o0@0@pL0P 0 0@0@WG i0bS 0bS<0S>0>0S; S=  040\a0b $c Q00\0S 0D 0B8S0SS#R 0Q' 4'  4 8  $cpPd>0d>0S0S1S 0SRupP   0S   y   | x t -"0LM'`K0p?0P0@ & " 00 0C 0 "40040 "880 "4<0 !D  h= -"0LM@'pK070P0 `0 00  k= -"0pLM0 0'PK00`@ \ 00 @  1S0000  n= p-@ TL`SPP T0 00p; r1ph=X@ -L` pP @a @T2 0! }P0 0 0S000 0RR$  1Su 0S q "40 0@ C Cq0CB#4Ac B a0b + ?P奂B!1RE<0!0 1Sq<p10q/00@[0@@0 ہ0S00#$ @ ^0S  0 400 0  Pb di!1RY17@01@ ꈎ M-LM0, 8 #X40 0@ (P( Z c @ ;8#(@#< 0 ,k1 0h!"8 0h!"4 0h hg14 0d!h"880d!h"4<0d! Y? 0@d1hA,@%,( ?$Kk400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!ⲓ0 A $Kx@ -LM` pPK Pc o_1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S0 c 0 5 ?$Km!f X00L 0#40  00:4#(#< $KD@@ -L M0 0S` 02="!Bbo0%Sp 0 00  0 CP,  ,0Pc V?0 @X1\A$< 0\!c@"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X! 0S\  10, "4F0E04D0 "88C0 "4 `c E_1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S c0  0 0% ? Kiz!< @004 K?@40P@@ -LM0 0S` 0pu0S^ S0 0S0    'P l Pc 1BS brV?0 @X1\A$< 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D  < 00cS3 ( 0e)$ 0 0%  ?(Ko"!B10b%=0!⭑0 08@ 0@(K(  "4F0E0 4D0 "88C0 "4  Ua-a-a-a-`-U U 0w! l8S S w S Si|P# @P 00 0@P{l8S 0 8 R' '  770C0C77B 10P RZ 10P+  R( (  D8D80C0CD8D8&W_ Wf00 0]5\!P808M RZ 0 0<W:00 01l8u\8, 00@ $l8S<1Q  px000 l8l000 0p8'↍0 {@# +PP > R >C0 0zl8000 l888(@4@D@`z@\@`@|@@@@j@@ܒ= -LMlX ȠU@p.h, :U p8VS/ p>0p>p8VS\8(Z4 5D8S808D>0D>p8VS8S< 000 508  Ȑ000(|8`]/  !ȗ \000jԌ 00tb PpP  ''0 0  8p p pP8?@@@ -LM@480 0PpX 2S  21C0d1 0"i^2S  cR@eV@Md5S @d5@P0e T0@e@d_0d5 -LMP@`zV>4 @c4p  ' 0hyꫪ -LMP@`nz 0pS0C 0 S hy*>( 0c  ' 0y꣋. -p21C0g1@LM _*>h t0P &h 2XB0/:0O00 `Rp  81lg- 0-LMT0@+;:0 ="  7P 8h p-@LPy2`0S2,0,  * phIy -=pS@bO% ``PL Hi8 P)L 嵲N@T `8  =S1NO%  PPg HY8N@0L P9T0   htj- 0-LPy@x 0h躕 p-8LS@` p0S8P000 P 000p 000pt -LMp8@S\8 l8S R`P XU0S 2P ヲpP 0 ps JR  0<0hp@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 0- @0 0000 PL 0PPT LwH0P0 80B9a$!B30b03@L0H0耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@HPតP 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PKr-= -L M0@ (KJ 0 @PK r-=D  tQ 0 S"0!B =-<JQ !0 S0䬚=0@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C00`=GD  tQ 0 S"0!B = P0 Y@ p-`PL @HPTP4J@T(phE CPph>@@??@ -@PL D28.,*$0 h"@@@@ -L Mp`L@0\48 0`P  0<<Q 0l@d@XDdH DHK,@ @D@L@T@\@h@x@@@p@ -Lt@0˼T   A@0s-@ -LM0,0 gP2 p0@ 00@:K =2K00<0<Po:004K P  0 < K;0K1<1< K 0, 0R(Kd@Doj= -鼀L0PS&p0` @ t 0x?0l I#P@D 0@S@3 < W $ SXooHoB`o@\o -LM K -LM @ , D P5 p 81@(0@":K !0P2K`00 4K P`  @ D 0 < K;0K1<1< K 0, 0R(K ϔ@Doj = -@< ?L0 <0 p- -LRHM `p00 p@dPP 408 0B S800 RH TKQ `@KD 0\0 0 X 0T r `媜Bk 0-LHM@T# 80S0Q 0S XPKD 0T0  L <0r S80儜K0   40040@ -p!LP`[ 8QE H@T UTM \ 0Rq Ÿ0Rm5BbcPNʠ2 R? BPG Q 0 SA 00C00Sp0 pp0004 ^00 000  00 819@PP" ㊻g  00C0Y P000Q\Q 40040 R 0Q0S R 00 \00S0040 040\00\0 0P0  00C0 P000@0  ?nw"( "EjLo(B@jjj@ -`LDM0,0 04"48#( BRp`0 , 0R(K 0X DK T0 xT@K t5\ D 0 R  0@㉺DP `QD@U (`0 !Ps @<0d R0d RjPP 0P0 XT DKT < 0 :K H4K T3 2K0; K<0K< K 0C?@ 0 R  i 0CU 0CUlk @0PP' ZOj 0M W  0P, 0R+(K5P 0CU ^5U0 0U0- WR V  pP`Zk@%000@4080`@00X0090HX0805h0H00I0 pj0P4U %4Ur 4Ui W 1S  Pp4Ux0S) H4UV1PH4UlZ0CUh4U= 0UXP3U 0U0P,0\0u< 0R 0`V 0S 0`5p jH@o -@0L @Q0(0 Q803@0 h> -LM@p P@0`<\00 3 R 3SA80S>? 40 ^E 0PS5岐0S P 0 j Y0801 0 4)4 S*NPo0S@40 RP @0 00 080ᾓ9(K04  00#0l0F  zNP>hBϠd, `PUPE,10C8#8S1y, Sv: 0ADP044$ 80P P0S P10  l1l!08#8,0 ,!XH,@^7PUPE108#8X1*, R': 0AP044$ 80Pq@ 0RPS @0 QN 0e긁M긁(Ko\000 @Xo joojjjj -L M@0P 0` RG l0 J 0S&0S/"\! `1Q 0S<00 s 0%,80S/  p80@0@P0 K180S Q0 1P 0800(0`c-]L0S0hר@@ 0 KH@spP 80S 0 P1 oq@ -LM@C^ , 㸟P7 3@ 3 3 2 2 0Jb,  0Z3 $#$("ȁ  10S!0 0 0 #@D"DH$H00 1 (Pcp $<&$ 4(!4"H%<@ @@1S0 (@cSp04%4, $&8,$#8!8$,000!(@cSp04%4,& $8,$#8$,!8000(@sS`σ04%4, $'8,$#8$,!80001``, a 0 Q<l0(KD0 v003jojjjjq(@ 0-@LP 0`P  0`P  010§0@L@ -LMP`! \\ \ 0(K0S p04"48#8g00S03#!4@K,0   ,08#8# 0@ 4KK.K-K@P /70, 0 @P( K2bpP ,0@ @@0,0 c , 00b0!,0 $!$0 G@ p-LHMPP` 400S Kp\@KD 0 X0  P 00T0 4 0, r 切#@ -L\M0`Pp(0 4 400S T00X0( 0R+$K|@KD_ 8Kx  Pp 00t0 4 L r 0PWT 21C0D 10\  0 @Do$oj@h= -0L Ywp3jjo -LLM `᷅PP$K40ppWPl@KD h 08 (0Kd < ` P(LLᴄ(P<0 0EP ᩄP᥄ P j- 0-PL@P9 04$48# X04"48# Q\00AQ\<0 h0 0QST JQ :<0h QX0Q:SX0he0T0T0j= -0LP 0j j -L MQ`@P`  K0S S *` 0` @=j`^` 0[P Kiipp0 piX`P PUឈPPljoj j -LMKrp  0C`$#Bb20aD c @ Cn<(4"4 KE.Mb -LM 0@p@A`0d` 0p0#!dPB0 0d0  0pp K -L(M0p,0 PP  P   0S 8A<, 0R(KU` <p 10CH0 S0 0QP QL P- P L0`S " HPS PdU`0S S@ U@UT# DSS    ' H04"40`8#8 $ #$ ! 0`0 0`0H LLu1P <R1P0PQ 0 0 Q L1PU0PU 0(8A寀T<Q} 0% L0S SsDK>0 ;0K< K 0( <K80 ЃPD  T00T0AOP  0 0bL0 0@L0P@D @P80S0C80<@̂<< |@Dooo= --LMP 0,0 @04"48#hdVʘ%000J(K 0$V$Q0dp 0pP 8%000PP 0%000 0 0 d 0 0(SFԔ1 0  @AQ:d--------D- -<-----T@vʲ1#V0 0VR00Se 0)S 0 0 21C0#10\ 0(  n3 R VU0s S#0# 00Q tdP 00\  0S 05 LP0  010004K 0 0 0MPQ4 M2 R1 | 000T@ӈڰ0002 R x2 R1 Vp000T@o1_02 R $2 R T#V  10VR  00 00K0 0(0弇0P 1 RXcT񟗮---------------- @%@#@!@ 1  (00P00000b~{\00e SCV00VPP000  001L0 09oj$ojj$jjjjxj4jj jd- -PUX#0`000L0Sp  AR00U0S1 ! @ 0R:0SS S S S S S S S S |"000  P 04"48#8SWQ    0\QP1! 1 R@P 0S!ԑa(0 (0 0b0(U]! 0U0 0P0 U00 UX5 00 01@ 0NS<: 0 0N 000Q 000A ("(04"400  0:0:00:00S 0("(04"40 ;}!EI Go@ @ -LM@P  P hn p- LM@T`@PK0`0P@ 0T PPd@PK![0(( b!("( 0P0 xBkBkDj -L0MȡP@( ` p;l0- @TT P<  0Pl0l0`@  LK# 0L ( 0RB$K0 Pl0l0`0 Pl0l0`T@K]n 0P`HpK 0 H0KG K 0 KAKBKCKHpK 0 H0KG Ky@Do= p-L MQ` 0SP Kp XŸA0`raP 0BS -x-x-x-x-x-x-x-x-x-x-x-x-x-x-x-x-x-x-x----X---x-x--p-p--P$R 0 P`\ePUJ p1 RFP X 0PKphd 4 0$A 0@d@PT2 @0S0@ 0 @d0PP |  0U  0PKphc ` 0Kphd0`Pg @cojZooojjj$ooj p-` 0 @ !PB bL 0!0e 000e00 000p p-PL+U` @ 0E #10`pBmPj -@LP`b`P @ 0 0pD 00 PL@0U: 0U0 *00PjBm -@`LPpP 0S 80S0C80H0 0 ,`0@P @^~oo -0LM@( ,0K,K0 +K1K'PP 4 10 S 80S0C80;K00 R{0p`V&`V# 81W@T@T 0 0R 0 GP80S0C80 ~80S0C80~j -LM1@lP1P| 0SDs(`GV  0R| 80S0C80ž000 0 00 x`V 0 $#$("(DRD #0,pP 0#!DQD#p00C0< 0RV P`L"0 S0!0 (" P3"X$00$0: ,00,0W P3 .P P 0(1 R P 40 80S0C80Z00(Kh!(00(0(KoH!(00(00S(P3 7PW 400 0P 0 RZQ (P@Q ,0 (0S4000``PP0 `L00PL0  0`}=}oojojj -LMtp00@K`P 0 E0 00K/ K,` 0cP 0RK<0Sw@Do= -LMq00@KP` 0 (0 00K/ K,P cP <0U h1 R 0R V1<1 0% 0RCK1  0S' 0S( <#<U0Q 0Q 0S8!(0R< 0S 0S <#<U4U8#8U4U8#8U v@Dojo̝= -L(ML 0 01CX@ (@PT0D0 " Tp XpW00W0SDTR 1T gXP@TD0S 3 R(KW @R0W`B: o딓L  (ZbP < d000T TH3 R ` VH 3  L0(:bP 0WF* 5 W@j<K 8:[P; [R 0S(9 ["200 "S9 K .` TY L (SPP 00 <H0  000S0D0 w,`K@ 90[0S SM S" 90K@j L 0P!P00P0i:0[; [0Sh@ L0 ^PL < :0[0:0K:[0 A0K :0[0:0K9T6@L  (aPL0 (bLu3@j 0@j :0[; [0Sl L `(aP :0[0:0KL0(P*@@j @j xjXjTjjo - @LTp l` P R0P00@ Z0U0C0 $R000 hKjo8o -销L\ p`00S 0CP`P1@ 00S 0CP @T 0 00\ojjo 0-0PLP @000P0oo 0-LrV0PPT 0@0C0S0\ 00 0T@@P 80S0C80000hUzooo - p0` 01 cQL ( 0  0Q  0q03R0S |%0p00#`寒\%00C0R R00 \  0"# 0TU @13 *D0 $!$("U:@T\3  04 !4$ $8(#8"8PeU#ڲ 04"48#U  !04"408#8 $#$  04"40a8#8 $#$ T0 P $ 0 $4,.4("(8!(#8Rcڲ 04"48#(Q P R0<00 #,#@U00C0X 0S00`` @T0` 0#$04  04"48#Ƞ\ 04"48Q#h0\s0010S p<r Pޑ0U0C0  @Pԑ00C0^U("(04"40  00 R000 幑0 01 0 0!B W   0 R `P !00S0<0 0 0 0000 0  00 0S0 0` 0 `0fp  `("(04"40 04"4 04 40 B h0 p0h0ooj8oo -LuL0@S 8U000 R ` 0@SX00X0 od@P 00 00X000 0XY0SD 0SA "F  "t00t0 04"48#X000 Q000 0S  bf 4 X VP'PK0S2 pE PC 3 R(00(0oP0%p00p0  t 0 00t @P`000P000~ R 0 R 0Sh R{ Rx 0P0SF 1f2pW pW 0S 0S 0S 0S0 $#$ h("(04"48#( 04"4  `00`0/ $ $)"(04"48#YQW40040 p1l1 L 0 @@1  Q d00d0a@P `|  | 04S(00(0 Pd00d0 000 @`:@PC @00@0`0 0$!$ ("(04"40oooPjxjo$ojjjo 0-PLZS 1@hT0 R*0hR\  @00C@0R@00C@0Ro p-P ML<Ÿ< 0 P$Ÿ$ 0 P iPx AnA#!B30b0020aA   R1P\!* n4\4*0 R0S 8ChV N#!B30b0020a4A\4:1!  1 !\D*@x!0!!Q210: P   Kpht0swl0d@o @8oj$ojjLjoooo=K؝=o0@o4@o$o@@jj(@ 0-LM4P [[@[0[ P@増K0BmH@ p-LMP0  A0d `i PK  0S S S Kp !K 0S 0S  0K 0S0![ p-2L` Q 0 H0S 202p Q 0$202p p 0@@AP0d 0P0#!d 2 d<2 pH0S 202p -0L`pH MPP @00 0hhʚ; 0-PPL 0S@ 00@S 5650h60 p-PL`@ U  U# U -p0V 0p0V 0 Q p0 R0 R 0Q<00p V0p00p0o -0p01`CVL!PQ`dVPQ Q@0 0S@@0  `d0VpPh 00 -L$M$`V, P@p 0ES . ..0 . .-@0S , 0R(KT 0S @0S 4R 5 65 600T 0S @00T 0S00S0SD0  0; K<0K0 <K80 /vPD   I:pG -LP@T7Rp` P' @P T0TpTz Tw T9*@P @TT-@TATT *@V qV k@"Tf SV 0Sk @!T$T;#T a0 0 0@0T+T0 D 0!R񟗃.................................t.T-@ӆ% 0@ 0 {$T5TVs 0S0 PR @ 00S S\@pPP@ 0D !S񟗖,.....8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.t.L.4..8.h.@.hl050@+l0#5ql04l0#3l03l0#1l00l0x w9@P&0BS@ Ǖ@Rl0l0@0@0@@l0l0Rl0l000@@l0l0 Rl0l000@@l0l0Rl0l000@@l0l0Rl0l000@@l0l00BS@x Ǖ@@q @Rl0l0;;@@l0l0Rl0l0;;@@l0l0Rl0l0<<@@l0l0 T T=TV 0S0PT PX P@l0@00l0X1T$0 0 0@0z0S@ 0q  0@iVf 0S @000 @y TTd0 0 l 00@B hl0@ 00l0Zl0@0 0l0Tq! -P p04 48`G#8SLC*0S010@ fQ:*@P3 0 0000 B0p P p   P@ p 04"408#8 $#$  0 0  0 p|o -LMP< 0p01 cX80 A(0(K 804"48#8P, @4 0 V0 408`04"4:18#( 0 :04 0 $#$("(Q0Ա40:0ı0c 8#8 $#$ 4 0P <0 S04"40 <0 H0S9 0!4H00H04 04"48#8S.@`PI 1`80 @@S00!1,(01(4 00-">0 02 02x  x , c,8#8 $#$<0 S  <0 HP 8j0Dl <00<0 00pzW7050<00<0202x 0 x 'o|o --:L`0P 0S 04"48#8QS0S , "\00\0804 40o - QL@P0`+ 0v03Q0S pXQbd..-.-. .... ..-.X.. ....-.../. .. ...... ..0\ Vt p i 0@S1 R 0SG 1p-p 0Sp1 R 0S/p0p(0lpVI0 p 1 pP8pP0y@p1p0 T8p( ip9p0 Pp8zT 0 P  P 庎帎jjjol@`@T@ --LMLr, P 82U r PUF @0 l0lJj@(GjTy R 0S8 RR( R 0RZ#  !0@P l 10S@0  ,K 0l@< ,0PF,P0,0 PUZ$ l 00S@0   ,K 0I@ ,0dP ,P @(K0R 0S 0 @004  B4 0 й@ojʚ;o/o -L<`@41à PddUp !@0P0@A W 素ᶐp' tf/B|Q Q V# 01V 4 #tf4< (po@-81M    QP< (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0ј = 0S01!(S0#8B CP#&8!̱P ü&,0 0 20pBN|1S(  S < t0b? S Q Q c|0@ P1Ph0P x20Sh P(0h S1*(0P!j -L,MY0PS1 S Q/ ո/(K(0 40 H <0 <0*0S``@ @P¸ P7 t@00SD@ ; &1 ᫸7 (4 H < 0p p0(0 >Y0S S  @p `@0 , 8 p <(4"4!<0D  <4("4!<00 0 D ("(04"4000 ,:8#40* 0 R 30,(!$#, : 2"0T0 <(4"4!<0P <4("4!<0Y Rq R4<  0a8#8#@0! 0bmQY 0S|RH R4@  0a8#8 $#$@"4`0 Y Rf R/(H Q<R@0 H  00` @0 @ |@ 005(@0<@@0`= >0?@p0 , 80 F^ 400q  x0 0 Y Y 40 c("(04"40 ᔽY `\0@0x 0 0 %(0)* @p 00 , 8 '+,p!< 0S;0H P'|o jjj -LMQR@`p %02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 <( 4"4!<0 ܼ <(4"4!<0 0 6S-t0. -: 0RL: 000 0Q000 H0"!B 00C0_4 00C0H0"!B  pp -LM@`PpD0$ K@P < 4("4!<S VC* :S0:KCGC(0@[P lp!|p -LM@`PCp0$ K@P 0 0bS!CzC(0@YP dh!Rp -`LCdQpU @^ATP0d1hB -LpC:: S 01 Q:1@UP TX!4iB Pg?`0@1A : 08#8:AQ00Q000@ H 0?0_iB@ S]jp jBB. -LM0`S Y0S{ S0L0X0@"2  ! 1L0吢L0"HABClrl2, P RjT"0Q< @2* ! BR0 0R000@b !0?0^d1@0Sd!00da0㼀0  0,`1Q01 DH!`o'BX!W? 0<@P\1`A@0 rUX 7P@800# L 00j]/  @0t!x1L/@p \ 21C40P!@ TU@ppxpjpjj jBpB. -LM`! D ! 0 P1 Up PQ ~0S%  0 , K\PP ca? 0@X1A PUp0P0YPd @0 0@0d (K @P X ͹ t ɹ0 Z 娀!Q00 00:1Y!0l  lS0SD0Dp0P0P!= S` `0`SC 000  崐PP* pd @0 0@0d qOKf}H1| @1R  H P! (K 0 1 <Pc V0@cP !|0q [0 20   0 h0R0P000:0:TP!wX ᝳSppjH Dl0 PN 7c yBpjj A-L@J 0\:@T 0c 0bS R@TL壅0D L1M0L1  l B 00C 0@ -6| SLP@p@T  0S  0 ( ){V%  0@S1 `0V 00000 U |P l0  HP Qt04t0t04t0p -LM`0 ;|P P  00lSں 00lSpWP, $ 0! lPU0U0 P` 0O0@0@巰 C{M0᦮00e0     0/8 4 0 W  1QS P呰 R0000 0$ {Up 0 0lQ0@ @,P尀U㲁 ,0S0,   0R (K R 0` 0R(Ko 0 Y  0R; $!0000A 0a1 00@ @,P尀U㲁,  0@_8@ 4P @P@P@ p 0,@ /8 4 0  s R0000 0  0R pp --L~Mx  0 , p0 x K 1 0#2S S  گ, 0R(K 0R :Y 0@`jTh` r TPP P  0h#21S  S R0 000P`eUh` P<` ,  H $0$$@X%4P,̂&.,%    R% R  : 0P0"!U00 U 101< ;TP  h`h``h` 0   (0 t 0Sn ( Pi" O@H h0;P y 000X  t0KP t 0RM:0Y000G  R 0S0s: 0S0S 0s0 R  0S0S0S$ 0S " @5 !0 00! 0R0% :Y PPE UP  @@ 6 0S PP 1 :R  +  '  <(4"4!< 0  <4("4!<|0 00 0O0@0@e⢬h``e h` 0S T10cS`!0bS1ڨP  `1R 0R 0R 6 S&02  C R |0@  @|1S2 SP9A h@@ "1@0@ 10 0PU R 0S:DQ \ `P1 0#0  @@@ 0L0\41ʸ0S 0K0(  0 PP |Q @WX!0 b0b S0| |0 \ P@P a1 n0dPR ?S0 0,1(1\ \ \| Q 0T!R 00bS0c^/V !R0B" N1Ɂ h0^ 0O0@0@00 0h `nh` 1^0n Σ 1ɱɡ0h` h`6VSʬ@ 00c0a0PU0U00`0O0@0@ RP 0R P  Uwt0 0t0 P @ 00cS10cS U =C @ 0(PHKdK\ \ 1P0P 1t$\0 ?0 8V70S @0P4 V101 00cS10cS$P0S Q  T10bS00dSڬ@.1990l0 lK p "1 01,nY  t0KϲP t@ 0R0% *#  @Pt0PP th0O0@0@0( FP  .t0400@ @KGKH@KI0d@K@\K 4Kc@K?K0 P  P ( / X+ 0/  R;02,A@T1 P 1@Tq 0Rx #3Rʸ@PHKKdK 0 @Ppx0H0KGK D d0KKcK0`0 &K  l0Ap@Dojpj (=@pPPxjpOx ^hhXU|/O40 @ Vrm p aX pʃd XXp I r0 S X Rm0!0bS70ODH0@)H0L@DᒥpP IX00S; 㲥1 0X0 0᪣X0X0x q 00 0x 0S0 (p# (t00t0YpP HX00S 0X0 0X 0P0Px0S 嚪x0 0 |0 @B t0 1R B X40 <(4"4!<0p <4("4!<\0I 0`#P7P` 1Q!0\ aT7`2 S 0S0S"("(\0 04"400 cQ0ՠ0 & 0Q 1("(" 0 0|1S S S2p0 2 8#8 $#$("8S|0H 0PPot G0 p TK"p 01 00 00t0MNx 07PAv7t 1~@0S0KT@K 04 4TK(K 0`@9tP & T"R!<8(20! 2|< -|1S' |8 %|( K]0 :0X! 0RKphXxPT 00|, | N,p@Doptpp4= p-LD@P`TP 40php -D@LPpT Pg 40 T0 00h0W0P 7S -L0Mp0<`K@ 0 ħ4KPpD= -L,M4pQ, @` , 0R(K0S PPQ 0@SŸ5P: PŸ0 P- U V) 001L0 @ L 0t Pn @0@S D^ < ,$ !$0,0cS10cS 01 RV @ 0@PH DY <,$!$0$L0cS10cS`F0l $#$("(RD }* Vh1DQ2*t05t0 p10dSmpA0^/t10 00bM0 R\ 3PAP @PV<@K Ppp -LD@@6S S\06P?shn6S,0 R3QAQ @QN 0-@LTP R0000 0 Yj@T00p 0-L@E.Pj- 00000pp p-|P@L@`t0txP;t06t0 @ID@ҳp0t0I p-6| SL@P@`` 000<U8#D00S8#ph06 00 0pN - LL=kPPpM @p41@P0.@7 Ga@@ GT  G 0-S00 t0|020 '"(8CQQ?&ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DP0pjd.=.jjB?Tjj -L4MğPP,  @L0 P T X |!|0D @ H0H0 0`0lQ@ ᲟPN \$0D\ \K TP0\  PT0\ 00@ 0P@ 0P 0 0LP0 ,<4P $!$P 4!,.

P*P% P  P `PϪ40 0 0r 44 0Pr0 R 0S0S0S 0S R 0S0s Q #PP PU  IP<P 0S  ϷPQ 6PP BP 7P -QLM 0S K0S0S P0@ SAP T \  0 0HPk0P @0S   0tdj|-p. -LlM(0@Qp,0  PU , 0R(K`VP0@Sp jPf P 2 R X 0| S 0x0 t { H0KHK0 oGPKH`K@K |   0 0HK/P2p0 Zh |x 0R:l@KMd`K0 |x@\PKB0 c0KdK;|  L 0e/PWI [&[tHKp0@p (p HKH K@0K0  @KHK0B/P| t o @KHK02/P a@HK@ Kp  pp tHKp \0Pp I[@K&[0(嵹P;@Do|-tj.p=0> -@0@L@@h --L⴪tM00p0 ` 0, l0 h 0@#2S S4 hPL, 0R(K0 G0K 0 S ):Xk 0S000 V04"48#X#8` 0 dR' U00U0S 0000` G0K 0 S` * p0K⮙P< p 0R0% *0 hbᬑK00^  0S 0S0s 0S0S 0s R 00 0 "    (0 0(0 |000}\u S00d00dSP U "(00(0G[YO YPH@K0HPKGK d@KK.dPKcK0 6K|.\ 0SZ V 0ST ( γPO\  0娸PU` 0S0h0 l 60S@0   h KJV l60S@0   hK 0Ul  h0Sh@K @0S! 0?@HK h0\P 00 0䕟P U l0  B@(BT P Ur @0 Ql0 #0R R) ,0S00S40S80S0S 0S$0S(0S^? $0n@P8 Q 0l 40S@0   h KSJV x4l 0S@0   hK 0o @h0HKPnhPk 00 00h0 @0 P P 0Sq \ 3l 0S@0   h KJV t3l 0S@0    hK0. HK@h0 ᠦPC 0@ '0S 00 0 " G  (0 0(0 >@HK᳗H@KGKdKK 0D0 媗d@KcKK0`0 0, 㑍P#C0 D+ P000000 wP #0R1@͛ 0җ Pe 000ɑ: $00"!Q$008 @p妶PU000! 000^+ 0 E(@  0@Pk8 R 0R( R 0R @{( TKPK00  0 0vkp@Do@pʚ;̞= -L>0Žjp-Q@P P*R 000P( 0B)pj -LMP)0Kp @v)0[ !#R)K R # (0/0(0(K%aVT l5,  , 001S %1S ,5,  , 0701S1S1S ,1S Q ( 㿓Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ፓP @ @ 0 000 ("(04"4#0庐(1 0 ! 04 40)[Z Z ᐐP#(0/0(0l00S 00S0 0 0@`000(0C8#8 $#$"2 I 0 :+B 05+)`[V V` Wl"(0/0(03 00S Sx) +0K⍏`0+ K*K*0KY 0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(<00,<$"*)0+ K00(0C@   00K$00,<$"*)0+ K 0嶐0+ K*K*0K*0[0 +0K 0  000pj -LMl4 8  +0K`+ ["2S S (00(0坏(K( 0P "2S S c 0PD`P + ["2S0 4* Kr0S000t 04 8<,<$"*4* KY0SY )Y( 0S:Y )Y p 0S 553 R1 (F?30 PU)PU& 810 R@T@T W 0S 0R Z 0S 㲊P$00$0w040`O0@Y0@ )YuPB8 R DP  0z@ D0pR< 1 00Sa<`10`@  @ 8{42@P `G0Su /+4 t 04 8<̠<Č,ʠ*K) K)KP>  048<!$!0!̠ 0)0[p:("#! !4!(0 Kp*K 0)0K P  )0[R 0 0Q3?`P)000 00 0xUPt@gH00H0g 00 0000 @@p@jj@qLoHoo -\0LP1  0 ($ 00 08 jp --\0LM R1   00 0 d K 00 0jpG-@0 0P8< 0#40   0 ! 0 8<0# RM` ' s`BP0 .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V-00r`F0 0! #0 P0 .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " V$$q001 !4 0# 0#(0# 0# # , 0 00 P.( 0. .A 1 ! 4 ( 0  .,00!80!$S!L`  [== -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(K=ت=؞=آ=ئ=G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0i ̠x|P la !Q`#<`<4P, x0 ` *L#Ƞ0`!|@$0p $x@0P(@%P @,P0|`P#Tx0&D#d<0*!40 "0 #T4,  (8! pq "0. *@P 0p qS`A8` 0#!( !0  "0# l"p0tt唃l l@匓 la"< P !Q`p`T LDPp0`p!L##t0$`!t@0$X$d@ 0@l0@#D0*̠0 0T0l L0!D0, "0*Ƞ #夒  HP QP!$x`@P0Pp Lb@ "*0%PQ @@ a H儀 0# "X !  "0#x!| 0쁟쑟'x h@|P.<b0*( p `FA %40!!x!!,!P*? A10N@b@P, P0@ R?W@pG 0 ^?W@P0 W(K (Ko@,  G,0!pc?WP -L,MT  1>?0@0c80 X1"0 @ D <0 08#8H L0 T^!\8 0!pT..l<@ #48 <, D[2K30KT80-KL[ C1PK4KP .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q X, 0R(K`2@Doj=< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LRM@ ` hK^```aD  h! \ DAhp\ 0"hQToD0#@ d0 `e[@̏J " 0%`0# ` flL i``  & 0$0#p苎dKp\ȅ0 0#X h 4D0`  n (T1 0,X0#pl1 fk{T1P  l1 'lˠPꪉ] 0. Th0#l1  `0 @  *g{ l1  @0<` !Pa n`PdL0%h` j0# 8nP 0 `ae[ #`L 0$` 0# X䝟0 hc;4p|0 Lq |Hp &ˎ }LdK0 p靊 0# pT PlP )fk` p|0, ,0# lˠ 'H |@PY 0.茊0#H@@|0nidIP0%0# l1  H0 g{ ( l1 a  !0`j` 8`|d`e[h0$ 0# АdKLa al͎ )0 0#  @0lc;`0 j0`p *` P X{` 0,pfi0#pH Plˠj[ &8@p 0 .gz "00'@  L0Z48y<0b-d1 LP0dLx n x0fk 0 ̀l1 d1l0g{P x雊0,0  X0 e[ 0  x lˠt a@ t艆X dʟ 00 @!@a@*L1idK 0L jȇ  ` 0 0t``al@qd n 0  h hYt  0P 0P P|g;@p <1  L1Xylˠ eZ @p  0 p T 0*fk jp g|ภ @P0 ਟ0 0 < e[꫎@   00 H1g{ 0 pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* ao@  @@Z`* -L,M01>?0@0c80 \1T 08<0 0!D @0 ^.L H0 T0#\pT<!!l##4<30K, 80D[@0-KL[80 .K2K8T N1PK4KP /K0pKP P4K  U'DP  0#<0 "( 0#40  Q\ ,y, 0R(Ku*@Do,j =< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -/LaM0 @ lK,0 q1Ahp PaA ad`lnDi4 i80|/0%1  d0 ac 00#l1 p `0(p0 nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT\Οc< Ȑ X0' &@0 P,1 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PLx  "d Qc,lDnad<͟H0% &@ H0  "aq@cTcQ? `P0`?SpP`0L`@  go}@@pb | y?0YP@p q?0Y@P 0 -L M0`P(0 p0K  !62 b1 R<0Q0^ ~?@ Q R W 1  !1P7r( 0R$K #@Do$@(=,=G-*A) 0p"#l0P`00#@$0@\! "TX b?  CZ8@ D0 L)*0pT0P`P! "80)`*  j 圡dPZ=~1A^_`>q嬁ZbAa0@,00@bZP`P`$P(`.   p!f?p(P`P^?`0  - 818<,!$00 @! p$(P,`0Q004@ލx= -pRLP`& @D1>0A W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW.:P x@1@ T@D 9 `phP x@1 0S@DRH0 0@H0L@Px@1 0S@DRH0 0@H0L@SH0 0@H0L@x -RL`p. @D1>?0A @c X2:PP Ox@1@ @D  pj?X@<@H@ ?X@D @pXP *x@1@ @D Px@1@ @D 0-PPL 0@ xPx@0@0D@H0L@08= -0L@$M80 4@ < @L H <HH8 4 @ p ` P8K 衟 80K @ 0!D#L"$4%T'\1t0 , &dp xAP H 0KL0` ੡@ 1L N@D@ 00K @ 0!H#HD8%X"('X<x&h0@ @DH0L@" 0 pPP0P<0PP <~w<H00@<@P`P`(KoPPp`rw<@pPPlw0P0< `PPdw -PLM, 0 . U00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`0^``0(Kol -PLM, 0 . 00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`@^``0(Kool 0-PPL 0@ vPv@0@0D@H0L@0= -PLM`( M 1A@pt1 lA0@$#4!,<$DH1@A <1 4A 0 @q(#8!(~8$H? ⨁@D( 0 8PP0)?PP@+8v@00@0c8( 4<"$$ (  QokP@8gv0P0P@8``vP@@`[v 0-PPL ( PvP@Jv@0@0D@08=G-: @M;0@$P$8$0$$ Q|4q aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.8.\0.$ a0ql A=P0,@$ @$.@Ѝ  $(,048<DG-4@ M;0@$P$8$0$$ QqA= aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.80.\0.$a p0qP*0,@$ @$.@ЍD<840,($   - L {X=H0@-@P!0 Q8 #Ƞ 0 ^D0 -L M((K0`"x0i@P 0 8#X "U 0AM00 2K40 @4pK70 40 0X5@P)4 0 8#X00 U0@X(K -LM((Kj"x  <0 @  j@P <@0 8#X "U 0A]@2K40 00 P }@ 4@ 0@v4K0 00 4@00@0`V 8 8 `5P4@ ^ @ 4@ 0@W4K0 00 4 0 8#h00 V0P800S80 4@(K p-LH`P0$H phJ (-"xL` @P08#XU@ (-"xL` @P08#XU@ -LMR`* p0K 0(8,< 0$4 00 , a00, p###Ġ""H"TZ0@P `(K -LMR`* p0K 0(8,< 0$4 00 , n00, p###Ġ""H"TZ0@P `(K -LMS`4 p0K0 0#0P 0(8,< 0$4 00 , 00, p###Ġ""H"TZ0@P `(K -L0CMS `B0K4 pb`B0K 0  (8,< 0$4 00 , 00, ###Ġ""H"T 0 @P 0 0#0Q0S`F0 8<, 0(4$ 0 ,0 00, ###Ġ""H"T0@P 0 0#0Q(KG-P0X\P@0T 0c|àE,80a5, ,E娕0q  A `&0`g`0D`&0& as1LE#8##0A5 nP%0H P%0e as1#A#̠ #ğ0@@$@a 0L@$0 as1#a#̠ #|ğ0`&```0P`&0& as1#4##0Q4 n@$0T @$0d as1#Q#̠ #ß0PP%Pa0XP%0 as1#a#̠ #xß0`&```0\`&0& as1#0##0A3 nP% 0` P%0e as1#A#̠ #Ÿ0@@$@a$0d@$0 as1#a#̠ #tŸ0`&```(0h`&0& as1#,##0Q2@$ n,l0 p$ 0cgqA!Q!1!ĠA 00#0` \`#U0 p0 0cr#xA" "lQ"40  .`40t .0. bs2##̠#(0Q1 A aP&8 x0P% 0c er#@"1"̠ A" 0 0#0a|< p# ` r x@"1l"̠"d@ 0#0l0`#&<&(&' 'Ƞ'p0 `====G-0Pp8` <@ W0 tTᰕW< |0 0cr#E"805" "Ep1  .c80x .0n bs2<ş#A0# #$$ 0! @@$@b40t @$ b0$s2##̠#(0 Q4 .l0 p0p. 0c r#T"1"̠"|T 0#0l0P#, l0 e 0cr#8ğ"0A" "4$0  @@$@a(0h @$0$ bs2##̠#(0a3 a`%$0d `& b0s2S#|# #$tS 0! .a 0` .0n bs20ß#Q$# C#$ 0! PP%Pb0\ P%0% bs2##̠#(0 A2 l.0X .0 bs2Ÿ#Ax# #$l 0! @$@a@0T @$0d bs2,Ÿ#Q # #$ 0! PP%Pb0P P%0% bs2##̠#(0 1 l@$ 0L @$0 bs2#t# #$h 0!, a0H ,0l bs2(#Q# #$ 0!PP%Pb0D P%0% bs2###(0A0 n,0@, a0s1|@#( p #A#d 0! n < ( ,,H,T0 @P==== - RLxM0 00@X0Lp ^ p0XL< 0^P`X L 0 XL8 0^X L 0 XPL4 0^X`L 0XL0 0\@\p \0qL@(8< 0X0(PP(($.7  .%<!...Ff0.,A.40 %.( %4,F0!,,, ,40a,( !q, %8!\fA0!!!!08P!!4A0QT0 " "! "VA!< " ", H 8 D 4 @ 0 < \` ``` Vdy/Ty/Ty/Ty/w/Ty/Ty/Ty/w/Ty/Ty/Ty/y/840P(pE($ 8 d, 0 l% (Ƞ 858% *|aq !40` 0`0 4ap %D q%ȠPQ` P T*d*  0儀 P0!P "0%P@ Tq|D`Ql Add " ` !0# ! "0#  ` Xu{/<{/<{/<{/{/<{/<{/<{/{/<{/<{/<{/z/0,4s(,X*̠*(48t ß0 (3P !Q*D40d t@x lP !Pq#T3(h8@`| @p q`Q8` hP 40&\l`p  "#`d0Ÿ!$D0&x`@ q aQhp@0#| ! " ! "X[T[M[J[2"aQ2" A0 0# "! 0  \\ 0  0 0  \ ^\ 8KbXKbHKb(KM[J[X[T[G[C[>[9[>[9[G[C[SDpa(8l 0@0XHP(($.H1  .%<!... Aa0.,A.40 %.( %4,@0!,,, ,40a,( !q, %8!`A0!!!!0hP!!4A0Q<0 " "! "@PA!< " ", X 8 T 4 P 0 L ====G-M 0ß 0@R$2.  B$,,$ , 1, ..4 4<.ß0#. 0#p,㟠0Gt0} pd **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000 ) ))l ? !  B1 ?Q,0d,'F0 ,ˠ 0 0'000 pW*!0  , "",$" !!1"! 8!8#8 !0##  2# " 0Ѝ|x **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000t)p ))l ? !  B1 ?Q,0d,'F0  ,ˠ0 000'pG0W*3333UUUU= -LMP`@p TDXHL\0K 0P ,@ 00 0p, P`#@#"#8"Ġ"0 (KG-M R௠p㟠0G 0d p **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000 ) ))l ? !  B1 ?Q,0d,'F0 ,ˠ 0 0'000 pW*00  Ѝ|x **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000t)p ))l ? !  B1 ?Q,0d,'F0 ,ˠ 0 0'00pG0 W*=0 Q > 0-<@LP i`P@ 0T00tjj -2LM @Rp`0  @P0ČȌ̌X!2,P2! ) !0 #,# ,!$"0  ! ""4!4<$"0#"0#  ,8#Ё0 , , A)0*!S0 -ክ4 4 4  }*G}0@ N)Tf ;<?p8p , @^ 0 (KT 0SQ<PY pjUUUU>> >C -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUUp@-0` R" 0@Tڌ0 P 0 U 0S 00\P ppjjjj -00ML@ d0 @Kp -LM,00,0 < K <0  Pp -L M TvP0@L 0D<@/0 ,80@/Kw?pH@,pP@p -PPLD d0SA  1p\ a 10 ^ 0S 010  \00D P à L ` 0 0@0@ P(ejjj -H0LM0S  0M Kp/ -PL@Q\pp%`0S! 32C0e0 !   \P0@0଀ 0 000ഠ  @jj -0@LQPPppp`0S \32C0d0 !   \ 0  ฀jj -LM⸡00 SP@ 61p`^1 @0S% 0"0 V U 010 R010 R Qt 32C0d10 R @ ^t`VX Rp(KV ^32C0d(K @ pP ,P0@`@00 000 +jj p-@LP0` RpQ 0ES32C0dA1 R U 00  Q 0 S Q pP7gU( 00  Pjj 0-@PL }8PQ 40,80,8Q,0h0p,p -Lpc,`P DgW Pf80U408@ P,@PP8  ,pp -0L1q0SK RڌPPU 0S00S  0 0ਐj+>PU;32Cel *`P2 0@#"B c!f0@cf10 㨐  l `=0 /l0P0P 0Actf 'P "Pjj -pP0LS`P @VP#:32C0f A 0S0C0000SP P0  0S [jj -LMpP_ <0S\ }8QW ^S 1P `U:4 R 0004 R8,K P,0K0@#0(0 $K32C0e 00C0 0,0S  0@/00@0 @  P p(W80(0 uQ8jj 0-LMP 0| 0@Q *#d0"B a! 000R@0P  (0  K0_jjp(/-0PjP0S0SP0S SQ 0S R0000 0 00 000 0-@LP$PL<PLL~0 0-$@PLP R0000 0 PLd$0 -L M4 0 , L PP ($ 1>< @040K0 @@P@  00$@ @,(K| p-0LMQ`P KpL S0@00 ,K KM0P,mU0  000\ $@  (00(0  00CS 0vLdcj -LM 0S0,0 0Sܝ///|/ܝ/QR 0,0 ,QRL h00  0 p101$2d0 0(00S {Q0S$@PP0S@p(00a L $ Uء fP, P0S@pP,  X 0@0$0@S (Y$LqTLk,QR QR 0 P, 0S,0 A0T1 (0P` 0SP`0@0! fP, 0,0 \/\@ -L -8 4(0L0(#Q 0,0hx -LML4pQ P, 0S Q jPm` c3#@p0CX@@ 0C@c0 0L@0 3PRzpP 0,0 N RZ 8Q4H3  eP, ;Z  ,0 00<  @010Y 0 S 0 000 0 00 000$  (0100"00`< 00@4PP Y 0 S 0,@ eP,   ,2 PL, , ,0,0 0S 80 c 0, 0 00S Z D0@0 0!,00S *32C0bt!10 @ 0S P,  (@0,0:I,0@0!, ,0 ,0S00S,0 ( R, Q 0 eP, Q 0@ e, 0 S Y 00 0 00 0ct \ h X t/jj\@x -LxMds\, ^@$2 @3^ 83^ , 0 R(K3^ 1C^@P 5P  -0SЧ/ȧ//////////////////////b0StPK$P@K>b$;bVJ  0t0 p 0R0R+*hP p0QWhLqDP L0QWDLeLaHaDa@aQ@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d `aXp/// /@@d@@ -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd !aW/// /$@@@@ -L`RAQ=8 Rp.0^p.W& 0Sc^pV$ WQ `dV pRP 0 @nT@!  P 0s/(p/pj/ g/l@@T@<@ 0-LxMPP&@Kt` 0 | x p l h d ` T P \ 4 0 ,  L H @ < 8 ( $ ?K00/,j$/ /Э/@ -$2L Pr0S Q@0Tz P:  00CS+꼯////////T/T/// / ////////// / / //`P UlP Ull0@0T0P Ul|ly0@0T0P UljP Ulbl_0@0T0 S lO0@0T(j$j QP-L`@ v R Q0S4Q4 Tz 1`l UPP] 0BS]Զ/̶/Ķ//,///////,//L/8/0/,/(/ //////ܲ/l/@//1S X00 l"PP%c 夥P  !_lPxu R0 ! P0pP @T `l PP740 P @Ttl 0P  0R &"( 0pP HtDt@t >\j4jjjjtjjLj$j jjjjxjTj0j -LM@`l PpP^ X^ 0 0J( KlPEUJ P 0 0U2XH  (0XU(*XH e@A0?P00S 1\1C20A\,0@D0 0l/P  0CR0(l$K( K lPU0HW(0 [ 0`0`U -LqM08@,0 0 Tp!  U܁ ؁  0!R 0S 0S  Rş, 0R.(K0CS`/`/`/`/`/ P! K Z] 4@TXQ ,0 001    <KA] 0Q$ !<0K 0S ("(K<K 0 !  1KSKԑ 8#8l`1  ]1 !K` !Q3 RP Pf1!UPS  0 eQ00â" Q@ @  \!`0! 1 `A  0zV 0S !<K1 RVP! ("(K 1 1S: ! 0 1 PR7@e T @\Q 1  0H 0( "(K !  \! 0 V  0dZ00CS f\<( 4!4 <1 1 "( < 4 4,<1 K |@KK!$1S 1@ @\\ 1 <0K 0Z<Kᔈ1<K  \!<0K U <0KZ@Do$j > -LM@ \,  `G PK  [YA 0 pW  0 =0SY( 1lK@ [P, 0RM(K #,10S. 0S lK$ [lK  lK$Y  l0KYp 0 !Zp   0S   Q ("( lK$lK$g@Do > -L\M0ɟ| |@, `x p[bPPxW 0l W x0 -LMPP] 8`V 00S 1 QQ*0AT ,0pp0 S0S @T0(00(00CS//////////////l/////////////0 0P(0 04`V 0@T3(00 pP( 0 02P( (j$j0 0  (-"(L (-"(L/ (-"(L( (-"(Lh (-"(LW (-"(L> ->@LMl00 -A@LMl00 -z@LMl00 -@LMl00 -$@LMl00H -@LMlv00 -@LMli00 R@R-L`p l >Q @z p-L`@Pl zo!Ppp $ -LM 0pP@$0 4`K3 0#0P\)  0#0#0QA#0P0 Q3@R 3x 0#33M$ 0R K Gx@Do >   < 0-LMP KW !4<"D\0 @  tW=z K0 -@L iWcW00 -@L [WhTW R-L@p`l A! BPP @ ;W p-LM`0P0 000S0A Q B,@K 00 0#0QL 0RKp@Do0> p-L@P`l ~ Up  E p-L@`Pl jX%(pH M  0- LP@ lUdP ^PXP00 0- LP@l4CP00 -@ML0,K - ML̀@0@K 0 0 -LMhK@P@KpvV 0  0S2"Wh@ @0 < 8 dP @l P A "0@ xŸX  @ P TP =hP.@K`WP(d0ST0T0SEVSl `P @ 0X 0 PTP WaAl P 0 S  @ld0 @SW^(KU(1!@0 X T@ @ TP0l 0 tP W- T0S$ `pK0@ U000l*`e0 pS 0PU :@U000l`^z5z5j @j -pLP 0   R`@0 0` 00\@ T000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000@> -(0 $ , 08 40< 00T -@Lz T02 -LMD4PK0` p$0 T 4[  Z 0R300%0[0%0K–\@ 4[  V 0R300%0[0%0K 0Q1 0Q11 0#P1@1!@0#T1 zI$ 0R. K1 0#P1  0R300% [x00#%0K  0R300% [x00#%0K @DoH> -pLP`@~Vz_1 0#P1`F PV@  \b0`R1!~ [20VS  21!0#P1z_ (`h@ iz -LDM⬀0dPK`$0 p @S!S@0\0#0@@Tk [ WDI$ 0R K@DoX> -LDM܀0@R@$0 P`(Fp 5 01dPK@S!S@060#0@@T+  I$ 0R KptSAO@Dol> -LDM⬀0dPK`$0 pz@]S\ \S@0\0#0@@T 1 -_H$ 0R K@Do> -LDM܀0@R@$0 P`(\p <00dPK@S S@060#0@@T~ H$ 0R K\pS@@Do> -LDM⬀0dPK`$0 p @RX R@0\0#0@@T(  _H$ 0R K@Do> -LDM܀0@R@$0 P`(Xp 00dPK@R R@060#0@@T t%H$ 0R KXpR@i@Do>G- 0M0|l L\ ̠<Čh4x HX $'4%Č&'\(l * p$́  00Q >I?("(Q -""LM 0`, 00 P" 000 @Pp 00#00  "  0p0#0 0  ,G,0@W0 (KoQ -(LM|"X0`Kp U@T Kd Q  dT > -H$H0p!`L BPٽ@0D Q0 0h -@L}QzQ wQhsQ -LDMBl0 l0PA`h  4K,0 dY bQlPE0D PL H  PP T l0S L@K0d@ `P PPX0 \P 4K DKGYdKd`[\0@$L`Xd0K@0Lp#D <P`d0K@0D#L4p d0K0@#4<$D,d0K0@#<4($LP`d0K@$4$@pd0K@$<@P`DK<K0!@"\ D0 @@ XhDKD KDK 4KX<K \Xd0K0 @\Pd0 `@ X@PE@TX@ \P l`0F@LPK`PU`P`LP H` T``FvT` tDKVF 4K0SF$, 0PR(K@Do>> -L4MX \0  X0H T !HP< \XH@P L <@ D @ D@XT @H 0Q@ < D0 8KF(K\ 8KX< 0KXT8K8 KPKP[\0@$L`XP0K@0Lp#D <P`P0K@0D#L4p P0K0@#4<$D,P0K0@#<4($LP`P0K@$4$@pP0K@$<@P`8K\0!@"8K 80 4@ )X0K <%XPK0@ D0P L < 0 < D0 |>!᝿!ᨿp@-(0"`P .`0 "  @0 . .0 0  .p> -0 1 0L@s|  U| 0?,0j -L 00#(H8H#X`p %  X   $`V Hp  %8Y H( ,0S T j -0L@O$|h - pL\P `oVP  10PKt0 0OT?< XK ?@^V,@RV ?PTL20 R)02 0 \ PU L#0\0 \US'V8 0 808 0  10P #V - pL\P `UP  100Qt0 0OT U80 O0] XF ?w@U,@U ?PiTL20 R802 0 P/\UL#0S 0 PQ0@0C 80O0@@10 0@?(80 O<S -LM,   0P`,0S,@p,Q@T@a0  0p P`(K0S,pNU@,0S@S0  0p@P` G-M$PP`l00h 0P01>0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?[0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ!0DPL0` p2RLH `08?>   c 02L!0CPP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0| ?(KLH,0p S0QJ 0H 0 kU j$>>P @h @ @4 @ -LM ,  @_ 004  0*0  ?n40 0D @ <  SP<4p0@P400W D 0TALCB<4BaGT@!V`Z4 P80 tt80PQ, 000hSP#, W<`S,Q!, , R Y, L#20T 0V0ZH3,p WYULØ0T 0V0ZH3, QoUYL20 40S02 e04@ TUYUYL#40\R04 QGU<0<000D`Rx,@R`TPL#2 P ^04pW00pWPT PL# Q04@T00pWPP (KC cB SV@QVS 4 0 0    B ? 0@3C L" 0p0C0\2Qj d08<S c>Q SPQC ` 0Ƒ 02R^ , 2P000 H0 0P; 0P L 娀 ?D @0 0PO`sPK&,D K `p \ \ 嚑D K ` F.0PX T `KӑX X`T0,, @?|Hp00C0 0,RT0T!00C000 0<K(KP00 X 0  H , Q?8 `p0ᗑ< 8 P`<8`8! a, QV.QV1 4P@p3#U T -LM0 @00_Bd @PR 0 b4Q0 RPQB  K k@P  <H 0S 3SKf fU -LM `@,0 Sf_Q P, ? |1HP 0O0@ >QT1 AR\0?00S:p* 1R\0?0: 0  00 W 0p5 p;0@4DL# 00* 0 R0 ,)h(K 0l=S X  B ?>0S@3CL# 20C 2 0jU @ @ @ -LHM\ 8 0pSPo0@0T8Z8Po0LO P` 0OVʲ 8@<4 S?P0 @8\00 P4 7H 0O0@ 8 ?ა8`00p S 08'8S`0`0`QωX 0 !00`D  @0 @@40R<0 8 0=8PT0ZPp$P`p6^`0/ 1> R,6@^`0?0 0,p0P`W $ 0 $ 8 b4 D0@4 DL# 00 068Q`0 80/0cQD0@@< P088P`0%X3Q@_`08 0P+8@004(Ko)gUJ\ 80 0LD} \P 0, 08 şR\p00p  0(K8p$8 `$80@_ P L×8 n     ? 0@3CL# 000\@4Q d0@SO 4R 820PuWO8`@O80O8 0P O80O000 `3RT0T !000l84S}`06C cB SWAQWS3 P`080 P 2 8R`0 0 0 8"   8P ?0@3C0L" 000\`2Q- d0@_X@ TP S c6Q SPQCX K ̎ 1R] 208p, 0PP0 Z8X K d ` 8娀 ?L H0 8@P0`OdKs&,L K lp h h 城L K 8` F.lKP܎ `0', @?ᆎP000 0,RT0T!000\p8 08X P , 0 P 8X Pu 0\8 0 ,(rjU !@0!@H!@t!@`!@T!@!@!@ -L,M D `DL@ pP(K D P4 H 0S 04/ GP00a0 S0X$Q\q\0/ Q =>P  4pR\0/ 1>PP 3 ^\0`ω1/p0@00 ,@ f 0p@WXlhP ?0 , 83,@^\00 N1/0L@ 00 R!H \%2R> p2^ 0L1/0 H010  B ; 0@4D@@L#0 0 Q0C0p 4 eWb0D 00KL8cH0NL@ H 0x00K<0 x ? 0 SʲRt0\pD 0(080 M P  oPOP`M<M`0d/ , l1 \00.Q`8``\g0pHFx H0R P3sPx `R\x00x0j   ?> 0@3CL#@000}0\ L10  ZD0 0;jU (@$"@T!@"@ -LM4 8 8PAP(K48 P, H 0 $h0Q 0 S 0S R BQ0N 0R P3,qb02SQ0 Po 0 ᣌ8 0OP>  0l0p0^  0@0S  P 0  Q`10 0O0@ ``0`8 V@p 0@_4, 0.T/ Q8@ @d_0  ࠌ`00 c SQ QQ0O@0 <@ < O>P@` ` PPU`%<0`ï^P`1>AU80pV,c DjH"@ -L0M L `LLH PPT P0 00S  L PD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K D@ < 8 Z?" `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00Sga 0@ <0 T Z p T K p|Q8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0ADb@@ 0 0 R#A4o` 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004a0@ d! 400C4000 c! 400C40jU -LM080 00 @P4P @ß 0x (Kj  V ,0P* 00 ,0 aJ V H#0S0C0ß0 K 0P`p40 8 L0 Pl0p 0 R RPn 0   R P 0P`04 H` 0 Rl 0  P  00d0X0 0 QN 0P R R QK 0P  P  Q9 0P  r 3R QM @oP 0 Q P0S su0P0r 00 ,0 |H#0S00~*k _ l0S sY0l0V0h R 0l  r 30l R 0l  l  0 Bh  0h Po}@Bol 0 0 (0k O(Cm>"@`!@"@0"@h"@"@ -LM $5S. @pd`  02 f V@ SQS K @0@ P   10Pp7 K X\\\ (K^4KKx0KW!P0K Po0@@ 8K0KF!P4Q@K00(00 0K80`S 2 K Ze㼠 $IŸ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] ,_ P0S[ 0_Z&`pQ d0 c> @SPQP#00d0  c6 0SQd " 80O`p X_000K n "cP' 0 S@P0(0SK ,]H K@00,K cP,0 H0@_0 ^,_0]0_00H00 f4@000Q 00j -LM $5S. @pd`  02 f V@ SQS K @0@ P և  10Pp7 K X\\Ƈ\ (K^4KKx0K4 P0K Po0@@ 8K0K# P4Q@K00@ P p00 80S 2 K Zo㼠  @K0@ P?@Ÿ0 ZPp_ Z1P` OP`0R` R80@P0p0Sp A0S_ ,^ ^0S] 0^Z&`pQ d0 c> @SPQP#00d0 c6 0SQd " 80O`p X[000K n aP)  R @P0p0SG ,\D K@00,KaP,0 H00  Z,^0\0^00H00 Z,@000Q 00j00 R 0  0S j M-L4M00P S@0,0 0P0 SH  `3Qt 0a0S QARQ< D?@Ğ@c.d 0P0@0S@TP 0 Ry P1 0ppe @T HP00,K  `aP@ ,P /\0,0 P@(K,0 < b4ɯT L0 P  0(P@ H@ ?P @P 0PPD@ .< 8 N P 0 R P0 0 0 @0@P@0\00 H8@d0<s c>rc, SqQP 0BP  0M(0 ! (pǏSvP0@0  @H @ß0  @ {H@<4 Sʯ H R|Hd <@D4@D_@Ĝ0e.H@ׅ 40`S H00ßD P@Q4 0 Pž P 0; VP@ 0 R P 0 0 @0@P0Q00 H 0@d04# c,0@0\<KR HP0X T <@TD4_@ e,0QH  4S `H@00w Lh00h0 4S`l84SNJ,P*mH0PT@0bRD4K_ l Lh0 0h0sH0P L0 0V 8: 4SB:>L#@0Cm>#@`!@#@X0h#@#@#@0#@ M-LM`  0 00SS p0S `3Q 0a0S QARQ< D?@Ěc.d t@0d Pڄ0@0S@TTD`  0&PP"<4 S<7 0 ,E@ Q> 0 R5 00@0@000 (K#3 yP 0@ 0  P84S 0 ?ငS h00h0P  0&X08Cm>#@`!@#@ -LFM P 8%@  \?00R 0  P4 UR00 0a QUQY00 @QP Pb0b1re R1nQW@yY0g00Yu,K 0KP Q, 0 B1, 0 PP \K `p 㬠K 0[ 000@K@^P 0HP, 1P 0 R0 @&& @00S*@@5L 0`UP崠85@L 0 0p`V\ ^ 00 F]P  0<`0X \KPR < @0 0PU, U yZK 2 Yrd \ P l 0 A2 oSQS 0'0 0O$1 A 0@1 A  ȟ%,AP h @!_0@Pp@ PZ^4\^JY 0 @@@\0 00 YPؠPEZP @^  @00PPP\0 0000;000W00;000W\'0@   ,0PS 2K@00[0 00P;000bW,0@S!Q"@P00\@KԠ00\PU To0 #00S@0@   0 0 F,1000 @ 30 0`@0p! 0S#Q d0300 H<:00@@0XP 1 @K0@PQ000ܠTK ؠ 0s Vp 0c P0@V;q#@$@9V Z4  4K00 S[@P=40 0#dܠ00 Z4 d0# c4! 0S#Q d0304 <H940@ 0 0@TK00\@K 0W @CU 40<H940@{4U@ XM -LM P8%@  =00 0 R P4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@iY0W00Ye4K 0KdP  04 1 B4 0X0S0 L0K `p0 # @K@ ,|W   @00,KZP , H00 !@40T@_K R 0@ 00 @GYP E TB00P @ @b b3a R`Q R\H:D 0`( 00@_0!qod$@ -RLMM@ >-8Pp) P P 0 R030P @0A#O1 g00S0P'1? 0@  `HAR-8Pp# P P 00 030 @0A#O1 g0000P'1? 0@ ` HA -8Pp P P 00 1>0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -L$M p4 P<0 7\ lQRl \@ R^Q V0 #4000400,K0 pOPP<,0Q<4 ,85H 0 <0, (K,2J( 0 0S80 & 0H D 00@@,@^3*.D RH0Q84 Q0085@0L 0 U0H D  -LX$@\5XX SS 0 R@0Rh0 S8P0!RTTcjC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < K=`<@$0#= ,K ,0P@S b 0}P@ ~G@ =S P@(K8 0(@$@ p-00LS@P0 0h0S  g`P p0  }P ~gp -LM, 2 !\5SS0 74d 00  8@_d t,`p`p<@D_@,p`Vp` p, ,0C@$0(@[`4P8`,P0``0(KTT%@ -$0L Pp   _@P`@0 S@`V _@P  <~0 0&} @} -LM$0 bp PUMT500#0(PPP@ $KPH0@x @ f~ 0@@b 0Q 5|PqeLҖϖ̖$0 B:$0 -L@MRx0\ X 0\L0 0  < < D_P (KSfPT7 XD\ ~@\0< @@kb\ u}ZX $0 0@0 \0{PƟ(0K8 #H`0 0PxPR8@t8 I Y` 00:00,WE, T`/:sJP , 6H@ \%R  VWP x0@@,P3E\ }@ \0R< {\ }P0S .P+X Bw P 5-0RP5 @0SX$0! L5@s00!T  yO P  Y1P h ,P0\%4RPP00 0 0P ,0Hh (h0 S, 00;00,DP0, 0P40  04A4= S54@ 4@ @{/4D $5S,0 1@H DH 4PL#480 ,0He(,D4,@ 80D Q&D04 \40 i0p40 PodLDH4P`, l5. 0\`#Q0IH@P0 H0 4L兕84 $Q,0HSP 4$H04 ,0SPX L  40S 0S0X 0 X004$ (5*(0$ LP@X  t0$0P0d 4( 80P@,0@x0X[@ R40HCL 4 X@!00K+0ua'4P0S^`\Q`a004 S:O/ 04@ P  TQd 4 +4 0040 X$00445P*PL05S404%b@P 4, 4HX<0@P440Lؔ4HԔ`Do|>T %@|%@4%@ -L,M$0PH ,P L  (K 20D0 3|L0H DPP`L D{Zu 2D0OO[/ P`$:,@K@HP],PHpPxCL3P#L3P#h 0'h0 S, 00;00,eC(5 (0/ ,L  40@.P@ L080p ` ,0H ',CC80@`\ p@0\4 0f0PH4LD/d  `1, 0P#Q,@K0D@LHP , Cr5$%R ,0PS$% ,0SL0K << K80 4@ < 0 [\RD  H0%@0 -L$M8@pTc$K *dP@ 0 _PZ, @ @- 04 0 4O  4$"0@<0 8@ @_@P< K @@PV-xb-`0d  , l1. @\$Q00 (KG@P,0x<-,(0 H P., , 0 R,,00000(B,b%@ -L|Mp Kl @(PU$v5%0SL t  ` 0S(H00600坫Y0SBP Xh 0S" 0 \ᆫP%h `R YIpgx00S $0 h 0S00  od&@L&@ -LHM\ \T \ X  P@ 匠P X00S S S .T0@0 UP  45 S:05S*P(KXT@ 00KzPP 0T R4  0d ` @  8  PD < 0H0 > 7Y 0iSXi YXXRQТVP0,0T @H @a<L0T@PPy8PsPL0 0Sj|5 R , 0S 0 $ M0t03U0S000T P PT850 p0L0 0cS0!S<0 PDD\D D 0D 0,0K  <0PP<0 T 0R- 00QRj 0 0 RS 0XP, 0SSH x@ T @0@,@,@,0LH"~00 Ug 0 \! 0pP0@P 00@b b3a R`QVRQUO\00P  P85@0L 0C0pP10X, 0S0 SH 0 @ 0 R 00T 0 @ 0 \t 08"X  R R \T@0{ 0 TE P,=%T40P*\ 0S 0S 0;0T4 R U @*T000T0X0 H\~0 T4Q8 R 0  T0PU P\ @80dK@ T04 0`@Q T0  0d d  R T0d ` {00o0 w&@`jp&@ -L MD < @ @0 080 45Rp(K <Pp < , ^8 T^ @ 0p00@@ \3),XVS ,KD 40BpW@$P(`,4@00cZS[ 0 H < PpPu,=<0,p ^p @ 0 @T? @0P`<0ppWX6885004 00 P41P `Y c PR\QZ!R` ?ST@0pW@$0  S(0S,KD 40Bp0P` ,pPc=DL0$   @0` @ 00\RkW@@ 000O8 05RNpH,p -LMLD @  œP0< 0@ DPK`?O# $Q R<` @$0@PPQ0@ ,P ʅ 0@K0`0@TPpW0@ ,P ZP8P @\D K X8P0O0 K 80 S0c0 jD@Xd 4 <0$@P 0%g`p 0K0g 8@0@8@ cg00T0O4PP4P $" 0@XDP@  R\ 4  $ 0@K0@TP7"0@ ,P 0pW`P8P  (K Qp0@VPwP`p8P V{@PY`4` D0Ky -LM L0 p @ T`P @  0004'@ Vl`KU,PK 0PP vPUP ,P t @ 0 R 0 10АAQ, S x` ?U P0<x00 40 @ 00   0 R x ,0H0 1@ɯT   00 R 0$ 0pǏ0S" x0@S,0 x x@ 0P` ;P R ;@(0c c9b SaQSP``(K@ 0 R( 1 0pP`( B b5A R@Q2  Q   00St p0  R 0@ T |  PK | \ t@ 0 R @0 0ppp ,0P`P`WX tK0t p | @Q00( dß2 b91 R2Q0@( "0 P(`80 0@(, 80<@s"000H:PP ?;P dV RPQx0@H, 1 0R00 @  ( R% 0$ 0pǏ0SR @\ ,0!P` P`Q 0S1 0@0$ p@0SR\ 0@H ,0P` P`Q0SR @PP 0 0,0 S1R U 0@H, 0 0Q @PP0$ p@0Sʮ0@0! (Po010X ɯY1 !0 ((pǏꌯoq -L M P0  000S P K-\0\ 00P P 0 S0Spp R0S  0 -hpP L`@i 0 01 R R 0S0S P0S00PPpp -0儐倠L`@p0 0PP 0S0SP A[PPqpp - 0L0  0Bpp 0-PL@D 0PZ\0 -LM@PQ 0Sp qQ 0SZ0S00S L $0@ p0  0P! 0 00 0p R0(@ 0@p0t@0 000   -L@M 0H QL I 0YIDpKP`(1@L,K 0 @`2sP+,0S(\% P 0L (Q  R0.SR 0.SH0P 0@P`Y X0P(K0YXq -L8M0P( @= P@: (p0\@ K07@`P0 `pr@P(L0( R-0[.0[S"[0R4 0R R X(04L( K 0@P ( T (QuX$K@D(@q..&@ -L0L(\;; -LMPp@0 0"&!R0 :R4, 0 R00(p R`P 0 00, 0bRQP`0$KS40040:\$ \` 2 1C0 00 \` PKR-$jj p-L M0 0S 0P`@P dP@CKp0P` -LM0p,K-0 R 000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0 R 0  0 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@000S;$0 SL084 $0$  0 Rb 0 dkTLPP`0 \0T0X@$K00 0 R^ ,0 O 0$@0 0 RN ,0 O(0,@\0 0@\0`@0 0 R4 !0O004@000B0? 00,0 00 ,  \0 0@\0`@0 t 0 0 h0OdkT0 @0 0 0 ,00 ,00j 0-LM08 PR9K$0 R6 00 00 0 RU 0 O 0$@0 0 RE 0 O(0,@\0 0@\0`@0 0 R+ 0O004@000K00 000 00   \0 0@\0`@0 H 0 00 0 0 00 00j p-LM0`8 PR9 K⮮0 R7 00 00 0 RV 0 O 0$@0 0 RF 0 O(0,@\0 0@\0`@0 0 R, 0O004@000mKp0 00 0 00  \0 0@\0`@0 H 0 00 0 0 00 00j0   o0   n -LMPp00匀0CSB0S q$ 0`x0 D ,0 K0S@0@f`P0s0s<H@`rݚ@/3`004`;00К@/&x'@0h}0h }0 h}@-@ 0 \00L0(0Q S\  0 p @\(h0S  @"e -L -LEM@0p,0 0 PR` L L0R bJ, 0R(Kb債V  jcPH!0  QQ8PD 0l!X  R R70 000000@00 8  0P8. 0 0C000C0000N\jYjV  bGbBb>b0X d  R MOK   0P8 @Do>|o -LNMp `0,0 8 < L L0RP @b81V I8PI ahK<fK , 0R(KP L0R 0 R 0,X R 0 R 0,X R\  b@P<@T 0 \ T!0@,QQ\ T!0 ,X R 0 R 0+X R\) T 0: S00SH1 D1 i8 PL! P T0 00 RT  000000T!000T 0@P < aP!R P1dILaIJH!RT 000<8bPTT!0 0C0 RT1T  000C0C00T0000<:IHJ;0 *d RW @+0P@' 0a%I8#I<J00 0 0] 00OK <@P"J <`@ Tl)0d RV Ea@0@)d R) @ 8a@0)Q20(d R@0 <_ @<aL1D Pr H@! Q\ RQX  T[P!R8H#BTL @P0  NK ?<@PO%J80PL1 P PP P1L 0RT0RN T 0g_8!0p03R0S;P30S T!T 0 0 0@T0DA 0H T1 0: S000 .R <`@`<IoH1 0S0X! \1 @! <` @O 0_T!P0S^ L 0 PL1  004400S* 0Q PL!L00p00S P! 0 RPP00p00S@R P1 0: S00SV P0S(B@P 0 LT 0RfXQ L! 0S  L8%0QQ@L!000 RL1L  000000LL!000L 0@P L0 0C0 RL  000C0C00L!000XTv\Q@OT!H 0 RTT00  X"6"6@!PL P{@P7\Q7 @!RL1  B P00C0 R L 00C0L000P! 0 RP1P  000C0C00PP0 0081 P@0 P@Prg_G80 jg8WG00 0 0 OK :@PH<\o PT!`Uo \1Sj LgV8GU<5GHAP 0: S00P 0 HMOK T 0@P X1S L0 0C0 RL  000C0C00L!000L 0gF$0!QL! P H1S@s =2T\Q XP 0T@!0@'20T T@000<xL1 00C0(P00C0'@Do>'@'@'@'@(@j -LMq@`P 0 vy \00 p00R] }P 0 \w 0, 4 0 ,QppYp=P (K 04Kp6  6= 0 R00t`` 0 R00p@@PO ) 0 R00t 0 R,00,pP4KJ 0@  \00p00S\00t00S  d}P\00t`` 0 \00p@@u0h tp0,0 4 0 4K 0pP  P 4K 0pP, YR0000Q 0S 0;0Pb 0S_ 0;0Z,(@ -@P 0` R00p00LQp #}P+Q 00S  ( 0 R00t|P  0:0*0000004  040#0SO -L MPp0 S`0s0s0s $0sH0sL0s@0s @(KD0sW L0$ % 0 Q00p00R |@P 0 RQ 0X 00S 3 R@L0$ \ @Q 0X D 8#8RQ  d0X0#8#888d0X0 0 R$d0$X000d0X00#00D0 R@ 0 R 0"X  R R q L0$  0F@Pp 0 R 000 ,@ 00S@v S S  0@Ph 0,@Se:` (0sv L0$   0S00p00Q |@P \0J  0v[@PC00s000(0s L0$  0 0 00(0 0@P(q@ L0$ P 0@ d0d J @0d 00.Q D0 D0d0X0W00 S*0X d  R ] 000 ,@ tqi0sV`00sZo -LM`@ 0 P00tp  00BK0 R 0 P 0p X  R R 02& L0$ P 0 d  R  0-L^ P 00S \ R 1S1  01S  RZ(@@ 0@@"00000 -L` pPQ @PQ @T@a 0PP QP@6S@S  0PP@ -L M @p0S Q#0 HPA(,6倢 0& 0,K6 (P2(k,0aHPQ8 8000 ,  00* 0 R0,& 10C1,j%(K ;< ,0S$,# ;l(@(@@(@ -LM;  `!@ -LM @`0PQ $0:  Kb,6r& 0 K6 (P$`  0H \1 100 1 , 000 % ;#; (@t!@(@!@ -L`M` @P Pp, !`(K: S1 (@  (0P  0P ,  L0 `P30PQ !R/0 0S00505 0d0  Y ,&0Qp0 0^  \   0˄ < "@"@D1 pj(@)@ -LM @p ` RP q Q 0R 0W p!:(@> l6 `Pڰ6 $ 000W $`$ #@#@$1 -LM @偂,Ɣ 0PQ(K 6 6,K |'PW,60 RR 4 $0`a00 ,0Hp Y P _ 00ab P 0S =  0S7  \P 0S P0 0S'  RU 400c Q`e PJ 00` PO 0\H~Db,!1P!000 , B 0 0C0&,#$0"}U 0z 1S101P!P P 4a0i  ` :PP ;470\ 02 P!H(@L)@ @,)@ -LM P,剢@P40 (K6 6,K &P0 Y,0@TH% (% !\1@0! 0,0C040* 0C R0,& 101,'#( 0(0T0 0d qa P 00`A@ 0Thdp P0`  ;40,,!10(@)@p)@)@ -LMRP`0 0 0V0 8K 0KP 8 0 B18 0XpW/ HK  㘐K   ,K6 &P ,80H QAB T  0~4K  0P  4pp40 06%%0 63O0@0 <Hm00 @ 0"P  2Q(K 0 h  q< ,"T0 <4K 0 P x4@ @80( K20h4  PA0 ,j"6 PPP$0 6 3O0@000(K,"h UGA0( R 6,K o%P w,00(0 4K 0 P  4 P(0006 $ 0, &402O0@ ,0<H,0@, H0K S`# *@` 6Q` R0 `0P80SK 2@6O$, 00P;00,80@SVv 04C0 00 0m,j  0q4K  0 P [40K0H0 6$, &402O0@, <Hb,0 @ ,!P 3 D0K0 H0Kp "(K@6pD,K$PM, h0H  ,r!z  0K6 $@P100 0 ,+!q4 X 0 0 0D0K 0 a 6 #0 63O0@,!00<H00@P09@ ,8$@ -LdM \0  00 R x X 00 L Zt 錐 P|  00t04 @| ,K/l0KPx :,\:! (0( 1S@ Z* @ T'P|0S#ڰ10$ ,( P0p`e | ^ ,(0 ( 0P 0e 0@ Rx(Kd0 L10\X, Z L0Kxpp0 p Y@[ TN Wp 00t 40/#00p M p0H`,\00Y0S( Z& $0PU"*@| R0 ,0 S1 |0T H, 0 0Q@@$0PS,p 0L S,0 p Wc(0 30@O/P(00 3)O0@0 V`0`  (0 0@(0,@@@P 7x@ j0@fqo@-0 : Sl0@@0@- : S R Q0 0Q@l L0S d  0 6d 0p0p -L4MH L HP T0 D PF D 0F$!0 S T^T HL0/-"00D}8@ $2ŸP0`00(80 0@80<@(, 00<8 9Q00P0O0@U @PT0HS࠳@ 0 < D nD0< &@D D@&0"!h! B? l0 <@ DL6 #`@ Xࠣpc4 *1@@4 PU  RD0&L0,K"HcP0,040 4 H48 4 `FX p@DT 0?^00S <^( >n40@(K@1S D F D 0B,KH %00P0400 <,0^4 00 ;00  pbqo)@ -LM@LP$  @(K4`K0 00 T@ 0 0M!0 000 00P(` 0PEpc$o@k,6 6@C,K6 !@P10,00L RHP@$e`@0P : 10:7MY ,~@UP \0 0@\0`@0,u,6j -LMpRP }00 0BRSvRv (  W(   X 40 6` 6PP7 c SXQ,K/ 0PPN 0 Fh~n,0fH,0<@2 ,V W0``1 aN0 ` PRQ0G0/,K0 `P  1~7 ,000  0(K  L0( 0OT R~0Sz(   f0O0 @030@ `2 PT1Q&  PCl n(K< d4 -LRMl! #lA0  ,0 4! .KL0S㌀ `0<0l-1K KKl 0R 00h1 X@pIl!_Ÿ 0\A XQ (@K⼐h`@ QKd hYK MOK DA Pa H T `a La {LL0@ "00YP lŸ, 0R(K 0#60C S񟗻0<0:08(弟iPg|z@Do>+@ +@ -L K4K L0S `0=@K.0<0K8 62K 0C3K L0S `01K0@ 0 0. 00 K/ K@  ,0@?DpP L0  00Q!/2pP 0! B! 01000,)z000  <pP ,00m 嘼|oqx,@ -`@00LSPAp)L L0R A)pU  BpP.0!R# 00 ApU  A !0 00 0pP 0! B!H劲ApA  pP |o -LhMP @, 0 L L0pR` jA,0T \),PY)_A*0* (K\ L0R0 0 *0   P\  BP08h t !R| 00tt 0 o0: S\ X  *,0P`0 hd 0h! !h h0 0`PP Y 0 DAPd0S d@(`(\ Rh@ 0000APh0! B!h 0(00S$ @(,(F*0D*00 0 0N 000K N 09@i0 .Rd 0@M  @H  @C0 0u?P 0@`X 0R^ \T0 Qp SQl  Zd R,(`h ?P0 ; ,K P,0P`0 d dQ d `0Rh0R>  01?, 0p03R0S+P#0S t0hS 0 0 0t h 0X  0\ 0)\P0Ql0 p T0  0t@  0>d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S `h RPp0TQ00S ` 0! B!`0'd@p Q10C1 10C8#8S1k d 0d 000,'00 0 0N 0K P0PI h@0YL0 e p R`L R'Y0'%)[`0h 0RBl R `02!R !`` 000` 0Ph PH l0S `@0! B! 02pQ(p)` d wP d0!R\ Rc VB\tl0SP 010C100000(?'oL@HK! B!00 00 0 0 @0 0@UAP60[S#[0R  a  0T  0X 0C0< @ 0 0@3Ab'@,@,@'@,@,@q..-@ -LM@ 0PS, `p0s0s0s $0sH0sL0s@0s (KD0s! L0$  0R -^P 000 0D0   0000 00l#00D0 R0 0 x L0$ x娀 0 y㬐SX ]P0 S R 0000R㨀 0S 0;0Q 0S 0;0p 00S Sq So  0p@P(0s L0$ d 0R ]P \0y ,0 =Pr00s000(0s L0$  0 0 00(0 0PY`v0 L0$ 2@ 0R ]PI R 00S  O@V]P 8  0:0000   40 0L #L0$  iq{0 S )]PRMꨀ0j0s6f00sz -LMp0`$KPT0 00$0 00T|!0 000  00 0:#:0 10 00 (0H0 0 ,( 0 40 0 <8 0  D  0000D0 d0@000S;$0 SL084 $0$  0@+P L0  \0T0X@K$  \0 0@\0`@0j -LM 000 #K p- Px0 @L0 B`P 000Hq0($%00`(&`pdjNP  ,0S !5%PA-RpP `$(@#00 bR:  Q3a0 R R0d0e S:0e0d  S: R:  aS* 0P-L0 0a00P00a00P0a0 p-LM@P`P  0H 00S  Kp D-@,-@ -LM @T`p5 pP Q*Z  $0( ,@ TP ,Zp Px($0,  \( $0 , 4  $K-@h-@-@-@0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP+ ,,0S "\" R ,0S 0R:\ R0P 0  \/ 00!-P,P ,0 S 0SP 0 S00:S P 0S0SP0SP0S  -L$M`  PZ 4 80  @P,K0pK $ 0@P P @P (K40@$0(0,0l, 00f0eaQ80  P 0S0SP0SP0S PQ00SQ00S -L`p@PPU@V4 0S2 `P, $0(,  0a@PPU@ Q 0( S$0 AP:,00P* DPU@:`P-@(.@L.@ .@ 0-@PL> @ P0p> 0-@PL/0 0 0000,pt> p-P`L@ @` ppD> 0-@PL  000 00 0\p,> 0-@PL @ P0p> -L(M`eP@H8 <0 6vG @PTS `0K$  0X ! W01,K P@ 0 4 `,@P `@PTV* 40 S 4 j  0L <0`8 `~ 8000 D08 0(K80   0800  -Lx@u@@DT@d@ -L(M8 `P (K^p@4 P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K mP ,  @0 0C"0" 8 4 0+$  04S0!0K,K >P0  @0"0C0 p-LP`0(0@ `0 Cpp> 0- LP@$P .P 0Q0 0P0Ͳl.@> 0-LM @PVP(0$ ΄, P R 0S B^R P5 P8 0夲.@> - L@P啲l.@> 0-LM @PP8 0偲.@>p彨,p幨p嵨\p屨p -LM Pp P  t$0(,@ \`,K 0` `P P  (Kpnq -L$M@  p `nQ4 80  ":RE 0i^ ! \ʠ3hQ1!0l 0PP1Q: K@P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST PP!@ vP$( ,0  0 R 1S0!,K0KP, 40U@:00U8P80 -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0<P 0@@q @/@ -L$Mp4 W80 `PSXppx a@P3 $ (0 U.:,00V,K0K ']@T# ( $0 U:,00VR 1 S0!  $e P X@T (K,40W@:00W8pX080WxpW*Xp -LHMpH L0 D 00,P(@4 0dP4`K004`K@K@KࠁS0%5R 0 UP0T@%5 P@ `0f S* P0KU (K@j  DH L0`@ @P -L4MPpU@80 { 0$%Q01Sr:0a bU,0 50 R 10 >0 j``  0, 80P` P(Kf4   40 ,80 PP   0 ,80`P P  4800P, P -L$M` p@ PZf ^ 3: @g `@ PpK 0-@ MLP  0P偨 0Py 0Pqxx 0Pi` 0TP@`DD0*0<0 K0 jt/@p|/@p/@,p/@p/@\p p\>P,,0 S 0 SP 0 S00:S -L !Q 1S 01 0AS 10 ! 10A0倯~0@40@ -L !Q0oP0@ p-@L !ƌ\`"S  QP P 0 $ `p Q0S  0  0 00`p? =;t0@0@0@ -@`$0 L0b#6<@ SpTQ&0@ P PM$TP\P<@0!PR00R0S0 !P 3$\ -LP@!ƌ0C  0S0 !hE0@ -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FPU -@Lb tMP  0R000 00 0 p-"fL@P  00b0fS 0S 000  pmk0@1@ -LM@p, ,P0, a@T; 0S"4PU(0 (  0y,P ,P(K 60A0C0 ( Q  6,00,0 PP  0H7PB, p1@x1@<1@R -PL@PP) $F%6@}M0p0!a @ ppf bLPP@ 0 0!C< R$0(0$ (Pxp

-4` BjO((A<L 0 c<000C0n4pi "101o(04(0(4y(00 <L 0 c<0(p T2PK 0 000Ÿ<0 00, D0 LPPb0 X` ,K400p 0Q40KPPo U0!k@ P6/(PK  0gP0 Oj4: 10 14(0 Cj4(4(PK !0J000z4@m0j4L  0PK;n4@a'(4kPE'(0=C PK 0j4\p>4@3@4@qL4@@4@(4@o44@4@PK`P`YP@TJ4(0 i4'4(@<L 0<cP V  PK0iH'(0  !(0 Q-L`pP#*@JV  0P T   @- 6@004@ 5@80<@ 3@ 0$@ 1@(0,@ 06@P0T@p -LM KLH0#&R*0R*0a"!B10bqpq -0L@T`" `Pp :S0| Q * Q@T ,0" 10Sx0S`@pTU T0 RX0 0m 0PV 0`Uoljp 0-@L P0 PL*,LQ0Tj -RLP@ * L 0m0 0.  . Q! ; -L΂n^P`Up*S N@ Pe"0 ,0 h  hqTj.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 PP  @TF (18P  14@K0@ 4 0@ `P(P)4 R @Q00000 0J8 Y4 R|n < e<@ fP 808J0[ $8 E 000jTjq -@dPN`@ RL @pp .0  @ Tj -0LM R' 0+ KK( v;.8HX0@$ -H 80@$ $H KKppqTjİjX4@ -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @wP 0d,S0!D <0 -V`  ,4PK@ 04@ 0P @L l #Z<0cX@ (KTj -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd P P,!&R*<屜0R*0`"!B1 b 0 00  000 JU 8I '0 A0S(K0 g@X 0`S00X f , $0 0S qpqt4@Lp>00   -L(M@  pDL 4KT4 0 < 0 SRS@ 0 S: 0R  48 \= \: hg`,K < 80,  00\0P!4@,pT 8 ` ,:,0 @T @ `\ 0 8,:,0 @Th4Kg&(KHA X0S 001@ g0S 0SW4KL&0C! S, 0 0 0Q @ T00 >fW@ 0@ `S  @0RV< "f @0 4K` &PS 4@qLp`p`H@q -LPp눀`%0t@4W 0R 10 P W(W*(TjLp -LPM rW 0RZf 1   _W PqkW 0R1   LWhK@h`Kt!p *\0@P0 phP`1XCWP1 Q 0 hK!PR UeWZ eWU1h K@U@PQ x0*1(K0@p  P0 f00 @` P@VVLpTj# `p4@ 0`71lnq4@ -̡LM V Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp 0`$K0!&0@P0 `P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, 6$KLpjTj# ,1 -LMP$ Nl@T`p(KT,K, Lh0   pP, 0 ge p'4@ 0 p-LMP h`K! ̃.' 0@P0 JPKpp 6 0 -LM\ ~h(K!p@ 00  0@P0 &P4 1W , 0( 0cP`88 0L :P@zG`W h 0 "@P(p0x D0pS .Wd00S,(K, `,,  aSp'Tjq4@ -LMp@ `.` $PK @ 0$@ P @d K -.L M  8  0(Ǩ0!Y# 0@P(0 P0 ,(KZ1P ,0 `0ap`p T1hp  a(RP4K@  0 4@ #P7,P0U/88  ,0Z0S$ :@`p4@ P00000 0 !(^Z0 8,0Z0S$,8 Tjpq -P`pWL @P( (0 0 d|0@P`:P@`XW%&* /%% ( Pp00Cp04@p -LM>0`~0^p@0P 0` `P @P 000T 0 00 02P  K0 @Pige'' 5@4@85@ p-LM1P0 @|`|0 h0m  `0R0 P b 0K@P0 {P 0`Kp3tCmpq'Tjd5@ p-PLMP*@`Kp P \0#&R*H0R*0a"!B10b (%JUxqpq5@ 0Q-L@ 00SD00D0p@-x|0@\ !1Q# \ 1!^`#`3P P00Q030" aS P\  Q0#02SQ0#03PQ1!1%ppP 0 S(0$ ,00\1P -L`$@0@PS:0b V@cp V:E f@U>0e S 0SR F@U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300 0 0 P00P0 Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q:pnq$0(0@-@ T0#03 R0SP @1 T#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q R,T0#03\0S 0 0pnq-$ (,(0 R:,0\3400R:40\34000 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` {0S0@  0S@@@`mP iPU 0 00p 0 0  R P; X> P@0T 0` @H0S0P  0SPPP`:P 60SP0/0S0p  0SppP@!P0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ ~0S0P  0SPPP@pPm@ 0R 00  S`0_0S0@  0S@@@`QPN R 0 00 0@ T`@?0S0P  0SPP`P1P.@y R 0S0P 0@ P0S0P  0SPPP@ P @ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0- LP@P'$ Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP 80P L0P sV@ 5P@ A,P @pnq P 0S0SP0SP0S PQ00SQ00S p- P$` UZ3@L<uLp000/]02 -0L @2h20F2 -0@L  @82p3P 0000202 M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,P,  ` h(K0g00T0@ , K00K0 PP  P40`@y z`, ,P `$0T* , ꤖq 0-0L@P 1P 0  000 ]00000D> -QL M8 <0 4  0Q:$0R, ,(K /4 8 0PZD0 D0$Z(0, 00Q 0ZU Z , D0@000 00 Xk < h P2 Rd $08`Z p1p!Q`!V< @ ( l@@P PU < 00CSL%2L%2x%2x%2@%2L%20S]40S0QO jW ?$0 Z p1p!0 R <0 L0 D08pl ^0l 0l04P`@p0< 0A, P , P Z 4 _[$0Z p1p!4 U, O4 N0,0 H(0 !00S @aB00CS00,0 `j5@ - L@T0000ːЭ5@ -L` PP1 .@Y T #pN U $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP x}0S PK0$0( ,0 0 $ (,@ @`Э5@ 6@ -Lt@>N=A@ p-@`LP$ 0 q= UpPP+  @PPP@ 0/B000cSt:PPP@H0/B000cS 0p$6@6@6@6@VUUU6@0@6@ -p ML`8@0P(,0!0 @04 0P@V (0 -P) \ K& Q QA ,(01 !0B@@0S!0S W@T PP W|p \@XL 7@P>7@H7@7@7@d8@7@p8@8@8@8@8@8@p88@7@ -L M蒟p`$0 , (, 04 0 $0@"Z78\ 0@P4K0<"P< 0U@ 0L, 0Rr(KP`d pt x| Z )PP 0 $04@ <@\@H0D0L  P0FT0T  XF T F0T0o(0$D @,FTTF T `D0FT T  0lPPmLf@Do9@(9@L9@p9@9@xjA,;@4;@9@9@:@:@<:@l:@:@:@:@;@4> 0- L M0 \0\0\ 0d R@P 0xPh 0`dP@L 0Dd@(K0h[pCm j@;@8oqH;@tnqP;@oq -Z%ZULp`e   @ < @$0X+*@0(PS$@d,P  << D05 0P004 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtuLenT$0 -\0L@  Dh袂8h螂 F((\ P1\@0CP1h[Eoqtnqpp p-0L1PU E`P\@T P10P1\;E0\0T0000p0 P '@P \P 0 @Pd0. d0d0S0>P>ndj;@oq;@ -LMPQ`p,P  , V3 0@U@2 $(0, 00Q[ TO ,0S(0 S$ :(0` f, R00S 0@$1 V ,000f,0 `YU , T , O@ P f0,408@@ `$`( 0 D L H P T X < ,  0Q 0f S :j(0(0pnq 0-LM@P P $ ,0PgP8 -L@P`~ (P,`0p4m -L Mt@|0(x`Pp!p1PP1P!\  0`K,0 S00S40S -PL@pᤀI0 0JS`!`1 BPtP ,0T$0( $ R 11S63bS$ipnq -LM$0  p-L*"*R@` 0|0 P 0 080<0@0D0H0L00,0(04000 $`lS*@d0H00@c*P 0 pphB* 埊;@ p<@ -L`p PPj)` 0@ -@QLP`p @0S@0A0 0P0B@ -LMp ,@Pm 0`0 K8oq -L MPpU0@`0 U (0$ ,0 0S TPP / $(000 ,,  .T  00\ 0@0 U  0 , 0 0 $(K $ X00R0S@ -LP`p < @  D[  0i p-PL`@ 0phz S-LpQ 0$ Q`!`1\ P1P!V: @P $0V* 0V  0  X @P 0U$0U*  S-LpQ 0$ Q`!`1\ P1P!V: $0@V$* 0VTP@P 0U $0U* xP@P  E@ -LM$P\@`p:\: 0Q:R*@ J KiP@   0T$0V :Q 0S @  /   $0S00S@0SD0 0D0 @0p  48 000 -. ^NP@LMU`P@O 0U@3K:$0TG0P  $pU@*D0=P 0T C 0TAD0;$T,0( 00S1 P$0T'Z, T0S 0UHT0S $0T<: 0@S@@$K@  @ T0S 0U T0S $0T : 0@ } x O J -QLM` 0$ Q!1\ P1P!Z#:  P i$0@ZlTv 0U  U$0R D0[L00S^P 0U Y10SX Z:U?:0SH   L`H H`R D0T0ST0 $ z0 T p00V00S4M@P) U&$R D00HpSW Z $U* -@ 9 aL0S $ 0P  -L M`$ Rp1 p!Q@!@1T00 :(K $0PS  Y RO 0TO0U,0 : 0W7y3'D0 0S,P  0@ 00S$ D0$0  0a c , K00X 0PW $ R 00S W* aD0 $ h@?@`h@P ' -LM<0 `$ 8 (040 ,p 0 PN < P0@, 408@ $DPTPq -LMRP4 0 `P p 0@00 S P(K@ :#:S (, d  Q 00S Pt00@T Uf,&nj,  0, 0 4 0 PPCX 0 00W P2 H40#&Rz\ 004 4 60Rn:40 0[PP 400 4  RT#00,0@7`p ,0 40 Ƞ, T 0,@Ȍ, `p0& 0 0@0 /00 c 0Px4 0  t@P0r Ux40   c0@_ 00SP P> 0a400 P30,@ >0>009p -LM ʠ,ʠ\ 0R lR >0. R 0^  0P  0-LM@ʠ,ʠ\ 0^+ @l^ >0^ 0T.Ơ0 H R P 4d 6R0  0P 88`0S*#8p -L A -LQ 0 0 ` 2P P0#00@-@ʠ,ʠ\  0R lR >0. R 0^ Tr2r2r2 r2(r2q2q2  0@]  0@F  0@O-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0&@-@ʠ,ʠ\  0R lR >0. R 0^  0@7 -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  0Q -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p  0P $PK0@ $@ P @  -LM00  0 0 , SpP 0 ed`Va0`0S0 Z > SW UU )YN>0^PUK  i:#:SD0QA0S>x3Q;,  C r  p0 h0 6@ Q 0@T; p@@0 `,K0.@P,000 R  JZ  0U@(K 0@pW P P @  0S  @S @$ 00SS@@ S R1S``/ 0 5  @ S S x0 P:00 z 0u  S0`  XʽW@ k 0K0 @P 0L 0S 0 @ kj 0CZ p@ j똠 p0 S -L,MH T H P :#:S0D >0 Z< * p0 8 40 \8 P L 4 S TD8 0P4 H4 PP , K<Pq ,P. 0< R*L`0,<$ QS` 0R]:D0<Y!0000 ( 0 0 0 R" Y0 Y0,>P,  0<Q PH T8 NLD8 L`4(K@ Y@  Y@ 0R0 , < a$P 0S0000S 0S,00 @4` @dP aP00 PH T8  040 4 -LM`@00 SpP (K 00Q, KrPP00@0S 0 0K PP000, R 00CS 0,l0,0 00@SP 0 0 00 M-LM0Z,  (KYzpP` ,:p@ Q P`ZY M-LlM00S@#vzD0 | x0 p XKl`Kt p 0]0@ ,0 B0  0 0 0, K0 tK0 Px F,Q *@@R (0 ( 4, @RRP@ZP  000000  ,@QQ, 0OpW0 6OtK Xt p 0ʡWp@t0 K@Qx(K0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -LTM@ < `K Kp@-d0 P0U#F"``@ 0T !P01Rb`0^ppjpq 0-00LS@(0P PR0 00 0  (G00C0(0 00 0000000  R 000( .00C0 R 0  0 pp 0-@PL(0h -@L(hF -(0L@ & R4 000(  00C000S(0 R0000 0| 00  0@@ RH0 0 ($ $00000 pp -00L0CS00@008@0 (000 00C 0pp 0-L@\ $0X(P 0hQ(PA (Pu A000A 0-(0L@ R 000  0( i 00C0(0&0   @@(PF`0   (0 D0 0hE00  @ @pp -L$MŸ`@0@VPU8 4 <0 /<0@PPOTF` 1@ ?S,) Z 0s ,0 S(0 SH1H!D0QBP`0@K  0 @0 ,@ PP @(KR0D0Q Po0RO 0@VU@0@< 8 K (P$IV 00 QS opoqp po -prL@T]`2$ RXX0S ^> 0\  \*RA 60 0 0 R0 < \*Q0C"!B60 0A0C Q0 T: `D^` 21C@PDP VV@4Q 0 Sࠃ$  $0 \:^uT `DV` 21C@PDP -V@ʮuA 60 0S00T `D^`"<0!B@PDP V@pjppqpq=@4=@ -LhP \0*0  0P 0@ 0P upX=@` -L MP0P`p00 4 ' @:#:S tU0,0 0 GZ%ƠJ, Rp'vN4@$F ,00!"&(Ko(K=@ -LM0.`p,@K 0@(@  , ,@T P000(Hu R000(0  0  0 ,@PT$K0j - LM t 0S0x,0 @ `0 PpT0 `pt0 0,  S, s(Kospj=@pq=@ >@,>@ -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KdP% $J CUYthh@0>0>0 0U ttxjnnpnqq4>@`>@>@ -"LMŸ0 @0, 嬒 0 @@x0#^ pt 0b\0L"6!v21C!@cw Pᬥ0SR  0`cW@"#s:21CcT E V P0& PƠʌ008 , @00D  H00L  P 0^:0^H! 00 0PUT0  c21Ccl0S 0pf`cV@* P 0, >0>00 00>00/0| 0P0X0 $  0, @ (00`\0T(XL(Kg0s,sppjpq5pqpn0pntj>@>@ -LMt4 \80 P 4Z*L"`Vm V80S (0 SQ21C  4 80 0000(K 4 pj21C! c0 0 {@P4 W,@ W ` VZ%&0RP08P@0D0H0L0 :8RYE (000`VT@Y) 021C, T B 4 80 0,[r4  (KoUrSr40@P 00Jrt(KoFr j21Cc, 80h7<s8s,sppjpqTj?@@@P?@?@?@0?@?@8@@ -@LPP`p (]00C0, 0 0, U ,00,0 `$pP(7 000 p-(L`P4@ Th (@3,00C0, 0 0, pTG(`A AR0 10 0  00C0( I RN 000 00C000S 0  00C 0 R 000 $0S0 (p0S (0``p(`?00C0, ( @, R 0  0 ppy@tj -QL&P`  pW& k(0T`VP @0Ds(0 <(0 (`VP !(t -LMP0KS4 0P , :  .0 Pq0@T( 6P` P ` 4000pH(4 R000,0  0  040@T(Kqp@@ 0-L0LP@L0-0 0P Ed0 $0dE@d6<0h-20p -L`\p@PP P W, (0(0  R (cP\@(< (0x R(0(0   0p  !  -LM00 pP@, 0 \     0 ,0  , 00 Vz 0 A`,0p0 0X1 0,@0t03TT/ 00w03 R0S ̠PxP3`W`, 00X (0T 0' T.UV(K0 ,@0t03TTS   00 0w03R0S , 00' 0$# T U 0  ,0p0 0 00  -L(MH L0 80K@0L0p 00K@ ,0 PS0 , 40 Sʔ 0K80K 0S @PoD#Q {x L 0 0S @#6:1Y<   *0D @0 L@DK P`P`Y ,0S<Y< 1@D0 @@ 40SE < R p(K5 H @P (    Q (p( (p~ 0S VY0@*A0DKP0`0D0 (pt00S ]80SPL`0`0j00`Sf*a80@SfP`8P 4` a -`LPp@T6U#:0`V @@d+$H04$ 00 F$0X:0S |h+@l0+TX0&ha<+0d#8 # 9:VpqqqpqTj 0-,P& L@S0hq -LDM008 ;pBf 40S0l0 00V70#4@hKH0@THl P0)R@(0@l  R00 S (@(PU@ Z0 ( HhKY 00 PMe(K,o -0@L2Tj -LMp P+aP U 0P 0S U@ P4# @TPU@$  0;`P0S U@`0` D0@Q@P404$0+ 8*pqpq@@qp -LM`@P V 0p @ZUJ 08 L0pCP  ,$r k q 0-PLqD*@0` 8Pd `@0@0S T0pqpqp|j0@-dd ,\O 0C2dS03S<0<<0!R?CQ@00@0,0dH00pVUUU - LM p0X0XW 4 5 S; 6&0PQ0 P`@ R 00R0SE 10 1D `(0 R  010010X0XW(KW  X_ 4 0S0S0K,0 000 \褟`p4@, K00KP @P4p@T X* (06(P_(0 #T`^ TP V (00`8!00 0X8!0 (0 ```@@ @|`O804 S0K,0 000 c40(0C40(0u$1 0$1(@00  p00p01Y0100`,10,1Q0@ 0SRJ+ h p0Si l0RO (00 000Y| PlW0@Y Y1( K0 00' @ 0(10(1(0004AtK@P`, , K00K4A0 P``@.00  0$#0 h@  0P:)(00 pL0F0T0  j 4K4 \pP  @a100 0$#m(@ 0$#e~0  (@ oop -2 Po"0PU`V0P@ 0eSLdB1011q d0Sa8?P12d R~@!\D`Plh0Qh p1@T4 eZ``WPP0 *X( Z``WPP0@ ( 0S; U  0P( V T<1X0J<1 0$# P (pGPP 00(( pG40(0C40( p0Q  ^ Rpl} opoppp -0LMp ԀL `A(``V  0#8``V 0I`0d(008 0B6C0 P%@ %U`<(,04@Z0v6(D'qpp0p(p?p pp -2LM 2刢D % `=t'd8P@UN 0 00, 0 <' 0,BS40 (0"@ ?CSD00D0UE 0KcP?@' ,0R0S)6U 0T00000 0R0d!000<0 0 6D'<4`'(8P@U$1@ P718P0U1 00 ,@ 0ȟ@ 00X@T0@`0P@W D0`0Q RO 0@W @VVqpppVUUU@@Xj oo 0-d0LM\ D0@QP DH'@500/0P,78$4j 0 Qqpp pp@@B( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q KpG0C0C+`P @n+06D0GKL4  0C@xt p$ t4 PD Hd ʹPdt0BKA00CAx+,P hVd/\@]0 /||(V@Doj`Doqqp(kF@\G@ p-`QLP@@Tp -LMp`0@,P@fTK0$@K0@ $ @ ` PV@P$(ײP R000 0  U @pp0j -70#L0`M)x0 000p  t yP| D W0X$80 S+:S %0 80 S :SQx t`Q$ ?MPAU$X |~lKi@ lK ptQ  PS|l@(K@P3P#D0Qx0S,#t0  0OF*p#J 6|Z0 2"`,0 Hp``뼂@`6Q<080 t0SM d2d"D0h2\@0`"000 @ Pp | @0`j l00l0x0S0 k |Pp@`*`(VZJ|(0Kp# p倀| Kz$00x;@@P00 6|ZpW$`Yj Z *Ž|0`S0S P`XKa8Z p|lK|Z 0j,oqpGo!CeEo@ h2 -L`@Mt0q0 t0  p<09L KpPPp0 0p0p00  -L M0 S0d @\0!@@@A0P  0x@{Mh d0@sMKhD05P 0T,TEoqqpG@qqG@qqG@qqjpG@G@0@- x0Sl061cQ*0!a"400@_#& U l0T -LM pP `@P; @1R  @P3 <` H0 ,0 ( D0-H0 0 R 0R 8 $0r40 $000 S100 x0R :l061cR80 58 00R*0(0  < KP $KaT0jG@ -L8M< @ 8 D ᴀp(`}PP@z D000@ t< @1R PPh D0hH0 0 R 1R `$v8 ^#x0V3:8l061cV`1^ ,<,4R<̠(Č"Č!̌f04 ,  D<@4 K0` pPP@ 0 `p` <D p0 ,0@W@P  ,0  CPP(KS0jG@ -LM0 p>0nt`Q70 a@P$0S, d060>0. V  b 0 K@P0 P  ahS K f 0d 0f#&Bd 0S* 0d 0c#&d  H@ P-0L R.  . hfS0H@ 00 0 -L,M0T P ` Zf @<0x"00S[ R@@ TT p 3ZPJ 0R00}T0 0@0@T0 B? 0!@00KP0 0 H` Dp < , L 80 @ 4 V 0S.0 PK0 P0@@. T@ 0X0X0Sb@( TF0 0C0 S/ T(K" Sf0 PK0 20@@0 Z Z00R0S ` !0S|? 4@P  T{PH@q -LM> -L M@H \?pP` 0 \p:@P`0s PP,  (0  X 0  0\00 p0\P P(K(㪮,000P0\`p \:@`pPUY   U  R(,  (0 u0!,^PU (d,PP 0 P/ R, PPU ,K 0PPP ,@(S,,000, (0 k, (B,hH@\H@ -0LS0S\QxpD0 0@`,PXWpH@ M-LM 0  0 0U@` | x t 0 |t\7zx0KpP` \P(:@p Q P`|@T 0x@K0`@ P P,0 P ` K<P a ( a  D0(@㣭( { @V 0Ql :PK`@P|`\P ` \ Q 0S @0000$n0S0 =0(KS`p00 @P`@P |` VPK`P`0xP t` ڀ0 |@ 0q|tP  (  0 S0@0   (@0")PK`2@P`P ` Ps ! 0 S0pK p`K, K0 ,` 0 xPK``PK` P`_P   `Vm 0^\ ,0Pq (0S(@G @ 0Q# 000^0 =ڐ,0Pq0 S@ 0R01 R00 ( H0(@ \0Ux QQ`VB0!m TZOPXO@   ㇬0pKj x@R,I@H@H@H@ -LM0`p @0U `p KT0 Z 0-LM0@. 00H00 0 PE0S P0000| .0S 0 Sj00    Q$0$0$000 K0K0hWOI@(I@ 0-LM 0@C^ 940 0P405  0   0 S 0 " P0  0 0S    R$0$0$0  0 0K0hEK00 K0h8I@ p-LMP8414a@0TH=L0S @T U0 0S3 0 0 R(0( 0@ @T@T|(@T 01 P 0S0  Q$0$0$ 0<0`(@TKph.ε 0rqrqrq -0LpWP  `0V0 践 04@0 0 6 )q -LpMp 008"0,0\{  0SQ 0 0 0  0S 0  0$0p0$<0@60\0< !0K  P"pPK`t 000P`@P0 80S 0  0$0p0$<0I  "0 0@0 K6 0x0  40  L( K0 P$0P0( @(`0 @Qd&x , 21C0Q@xTI@rqqjjhd0 rqrq`I@ RQ-L P P00S00S0P00.NhI@ RQ-L P00 P00S00NI@ p-`PL@ Pa00P30@ p p-`PL@ PH00P30,@ p -L0M`PV, pX 0S , 0 R(K0S P HK0FVSD0  T L0 (8#"xuT2@0P0 Z l0` ' T R ,0S00SD 0L00^00S @0S p0:0S\  tP@0S W 3S @@0S<0S80S40SX 3SXQ PX @,@K tP @40S80SH0S 40X tP 0Sz0S0Stg@Kt0XVpX },@K qtP |-0>> -LM@`= 0 7, l09 r P eAq喏`PUPEY10C8#8S1USS:A 0fP04,$D X,0@)P C8 0,0 l0 1!08!x#W4@X)PUPE 108#8W1X*qA 0,P04,$D p,0@P UPE1(Kqዪ,0, @W rqjjjj -LM@`d2P< P,0 E 3SD,0SA00S>40S;80S89 0 Qy 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SI  0 sP 0 1(K 0 000  0, X,  (Ko04(4 S:0 0APP @0 ,00 ,较50S0S P ,ꐑqrq -L4M⠢ 0 ( L H S@"0S/0Sr 0S 0S0si ,0,`Sg DKDPKqQ- 0`SࠑQ R0  R 0SQ0S0 P0S0 P Q 0S 0S Q1@-0\\ 0S Q @ 0 0R 0 0^@0 0Tn\ \ R 0S0S 00S0 \ A-000`00#"B@Pp0W60S3V:00:00p`V@ W 0TS 0T#"` 0T0  0TV#"P 0T@0 :0 000E0TSpV:0000  :PjnT>0  2  0 2P0 0  %d0S A0AS-0Qx"R 5Ph  h P01:0S S*S P P1:0S RࠁQ^$00Qjj -@LI   h 0-|PL @R 0S0S R 60 0@0 S00 00Tn 0- LP @  R00 00 -LM@9@0T0 @T 0 R0 K)W@T p-L M`0@P$K 0 ςT  0R& KphAIzT00  \a00 PQ K0 S  0RKp!!@DoL>I@>> R-L@p`pIR00Q zpP /.00 S 0bS1 RSI@ -0LS@ 0P P S T NpPP P0P P P> -@L@Pԑ -LM`pV 43PU,P  0 , PUD 81S@T@T@T 0S,0S 0iSk PJj \2 R ,0  0\0 P0Sjd V;0 0n,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,0 IG,` \PmʗPV 0 0bSPPYXVV Q yjxjȄqJ@ 0-@LTP@T Q 0S ;oP0 -L M0@PK8a@p$0 6y8K0 @0K?K&P 4 00S 80S0C80$ 0R K<0S80S0C80%%@Do,> -LIMp0P 0 T 0`0CS 0  0R(K}D R000 P 0S0C 0 Kx@0 JK01K/!K-K,6t%@Do2i <> -@LP6 -h0L@T@T 0S P R0600 hTn -LJMpH0,0 0P 0P 0S 0S+ P,6 Pq 0 0@PT 0S `V% @T6P100Pl, 0RN(KPUPU  8nP 00 0P@ 0 0 0R 0OK0⠀0.xqMKW0<1K0C;aK0 S/KP R0600 c 0S0C 0 PP$D PP700@Do1i L> p-P`L@ 6 p0PP700  POP@ p6,P - L@T 0S 0S( @T1PU<PU9 0R@T p 00 R 0@V @p@ ` 0S0C 0T$PU p 00 0@0S00PVPpP ` 0S0C 07$-FTnTJ@ p-PL@` U00 0S! U000S @ Q @ \00CS\0 00 0S0C 0 ph#( E\ EꐑqxJ@J@ -1LM 0HK, h0 Q.wAdK*w@K\K⬐K`p DG`KHpKc`KdpKw \1X  |0 0dK 8  h0K&PP 1X0A@ 0P{EX h0S  /X h 800C80, 0R"(Kh0S @ Q 0S0C 0 0h 0 0@h 80S080h#y# .@Do >>J@J@J@\> p-0L@`T P0 lPPUʜ@TU p :$P 40 <0% 800C80phPꐑq p-LM@ PGO0 `0S R Q000 Rxh (`P000 0f 00`D$K@ 0- 0LP8!#@P 40 800C800<0% 800C8000h -@LP pR 0S 0S RQd0S `l0$0P X5S1S  `P `005Sa0S '`P000 i ~4 -LMtP0UPp, 0 `z 5`0H0SqVSm HPHPgH@K,I-0S p t0SVRm8 RVN H0S |0SM|HG0[S hq@(00000q (00000 GP 4d00d 7 0 @Z@fG0[S@0[S?0[0S[P %04"48#P , 0R~(KP 07 Ru00 Z V  000(0 6()  5 p0`000|00 `R 0S` hSEFzP005S3rP d0 BQ-0S S / hC<@Kh jPI 000`=`0T MCKt<9K00K圀K%@K04"49K$0 0 $0C K 0KP 0S0 0000 D0KtxK0dK0K倀Ktxğ\K0c0KdK%0L0 04"45KdK8!#"@P   ejP 80S0C80@KDut3( 0 d0K0 0K 0 8 0o#P w  KeP 00S 0000h3 d0K P HtDß0 d0Kc K04 45KL dK8!!@P   jPa 80S0C80Ť@KD%td0K0 0K0 2( 0 8 0#P ' K PG 0S0 0000Y1 R xB1 R  00iBZ {%P0 t1 R 0 TB80S0C80l i80S0C80Ŵ 1 R  006B  KP 0S0 0000ZX 0 RE BAY X0 RH  l00 B>%04"43KB W@Dojjq L@p>8L@>>ZoZo>xK@L@L@K@ -LlM`S, p@ 7#QP 7Q 47Q 7QUB  CP, 0R(K7Q0CQ*0CQ d7T,0CT*P7T 0T&8A-P,7Q $7Q7Q 0Q7T 0T/Z !6R/PU&P6T 6T5 1CT4 1CT/ 6Tb0CTC*U1CT@ x6T< ,0T9 X6TI0CTX:Z @6T 46T 6T 1S  P-PU  0Py|Pq5T :50SQ 0S0S 00S GD@5T $0CT 5T0CT*"0CTM1CT n4Ts 4TP74T 0TUm ZO p 4  R:p |4  R:qL$00000q,$00P0P00 4T . 0CTS 0Tj r 10aR001#050%p9 10bP001#P3P#050%1P,3Tn 0Tk 0CT.gD3T~ 0T;@rx2.zP3T 0T*5`=P o$P(10P0d0lhG@ PUP K`Pq ` YP4K` Kd@K|KK0P 00 P@0[d 0@0K@["tp0  K@ KT0 P %TP + 0S00 \00\0U$O@qx2 yPDP %04"48#P R 5R00K KQWP0S?P$$ %04"40@DoliHLi0Ni0WiHPi iildiHM@Ji(KiUii eiHi"i ix%i i Mi >>Ii i Qi jRi Si !i PM@ -LMM$0YZ,0 0T X1  4Q 1CQ 1CQ -d, 0R(K0  0Sq0Sn1SSj1SSf Rc3Xb 1CX_ 1CX0I P P@QN@0`SI0SFpKxp  p Kp@T00   1FSK00KTp X 0_ p\`K p\P<0X@P80T@40P00  \P X@ T P fPP  ~<@Kp0)P2X  \Kp P! pWIpWF 0SP1S L`K pLP<0H@P80D@40@00 \K LP H@ D @ efP|1X3 S_Kxip  hp(OK( dp5 NK`` \p|| XpT X 01!KIpT00   ` NK:p(( 8p5 `F` 1p00`>F!ppKx`p  pK p.@Doiixii >|M@ -LhM0,0 FP!T @0SgT`VW` p0S0S 00S- W`&HPKFo5,@@KD#D8!0H0KGKCK_PP <`VU , 0Rp(K R000 P0& 0S0C 0 p V00 0S0C 0E 0S> V00 0S0C 04( 8!@P PKDyo40\0 r@|00 儠 删 08 0s@KDdo40\0 0 0  8r _00 R  0 =)@Do>qjM@h> -LMq q3Q^$ `$ 0R^ K\_0S\ .SZ ^ 0  PM .PK P 0   0 a?R0a 0tPK0Ke0[ K T At [R A0BS 00 R@KXn; K [4PKn00 <0 %04"4  0 n 0 a0@Dox> -LlMp@K0`X 0 nh0 `0PK n0 000#0 QK ~@DoZoZo> -LM 0夐K0 x,0 n eT@KpPK`K@p0   pK哀K\pK[KxpKwK40 00 @ PL, 0R (K<0 R 0  <4@Do> >jM@> -L@\\ 0SQ  R dPGPp P %P P P UP#P P GPUU` dP  dP U U00 0  00  0 00  00#0  m  cPjj -LM@pPPa0S4$KT P X1@T T tP08@TP;`0S 0 *<`0S 000 <0 <0S 0 @ P `p tP@ P`p<8`0S 0004 ;0$7;jjN@LN@ N@O@tN@N@ -"LM0PAK @0x,0 ]m  c5%#00KH2 >K4 KK 0 _ r`K 0 0K K唀 吀 @  IZX  @P 5d0S 0 000匀K`mP d@KKK4K0 0Q0@0[A0@0K@ [ @ KP T hOP , 0 R&(K KP 0 R tW; R/Z80 R 0 $B;@Do>j4O@LO@> p-LM4ad 0R@0 P *h0 S*1 R 0 ; 0R&Kp0BSh0 S:Zd0S 58J0 R 0 ;|0 R bP LUH,KPP @DojO@O@j>> -@L˘0000#0 -LM`\@pe:,KAl<,$!$P(,, %pK0SpA SK 0p 000 00 00Rp' R/ 1p"[2[[0[0!0000 0!00VTP 0T* 0S @T`00V00S 0 0dS1!Q00Spa @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0`0W0VWx \ p  W 1 1Q00Spb 8#8%P @ @0TA @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX( 8#8%8S*1 P9  P 05 00S S R P RM ("(04"4 8#PAQ <@ ]P R <0S@00y100@Dojj> -LM`@ 0R0% ::PH 0 0QR0%p A:W= PEU@ R0 U00UR   bp% 0PcU@0@P  a (0KgP ( 0R:0PD (0KgP ( 0R0%p *5Ȅq@0 rq -PLU%@@o   0l@484 <S  ZP| ZPh p Rl@00J,0 8 l0 p@,$8 j#8Qd0 (K0 0S0J  00#T^K 4 Rğğ0R&0<0 0PP lP 00Sl@l 00@@ P 048`jQ@-; Q! Q `0 0@`0d@Q" Q(0 0@(0,@X0 0@X0\@R^ RS R@0 0@@0D@R 33ؤ333R00 0@004@R80 0@80<@ 0 0@ 0$@0 0@0@0 0@0@0 0@0 @ 0@P0 0@P0T@H0 0@H0L@} -L MQ@ KP 0@S P*0P P@F0 @Kh00 Khjrq p-LHMPP` 400S Kp\@KDTb40 ,0 X 00T0  0P r O0hP@ p-LHMPP` 400S T00X0Kp\@KD-b40 ,0 X 00T  P r (0P@ -LLM p`PP% 40h@KDb080 d` 00`0 r $0KpP$LL$PD0 <0CP KPPjئ3 -0L p3jj\n -Lp:RP`@ P00T0S,\PPS *P0S (] 0 aPPS T *P[T(P R(PP Q aPP -pRL M@kP `VPP\ P 4 ; B\14 R(KX 0W0 0 `@  Ya p`(ZT  Yk* 0.S  \R0,0 _V0 ^* Y 1P11Y*p@0S .S p W@:00 0R0D>S@ALaL 0RS00L S0SA Na0NRS00N ST` ALaL0QS0L P`0 P-\QPNN0`@T Z0.SP P00S U* , , 00 Rl,0S 00,0 S`00c 0a%[] -L -QLM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P TP,0pcXj Y X`Y@   TP X0j S -L M0(  @ $(,L<4,4"| W@P( 0Ri$K18 T+ 10SPD@K^0 C0KD K<`K0S7 (nP 4080S0C80?1@T @T00ST0X0W*< x20Sh  h S*S0@P Xp00S0 $!$#KS0S S:0 @Dojjjjq> -LM@P1`.p+$@0 p+K\nP@ -&LM0`,0 0\Q@4R@Q@Q@tR@R@ jjH3R@' -LtMş/R 0 , pU 00 S0% :Pe   ` P 3V *+Vk ,V V& 0R0% :PN 3V000011`PP 0@S0% :P; 0$4 R`P<V 0Z0#X( dK[0 S0d0Kc K \@K L dK0P 4 R?V 0 l0K"\Pp3@P $(ß, 0R(K 0R0%@ ,:T 0 0Ra`P|0S 0S0% :P 0 @2  0 l0K[P l 00R6:0S l0K[P l 0R':0@ l0K[P l 0R:0_ l0K[P l 0R :0=l 00R0% \**@@KHKZ[0 H0KGKSc 0 HK 0~@P_ 048<:Q0  D0 0HKSp 删 P x  匀 p`K 0 21C0 !100SR dK KK)2\@K  Bc0 $(, <4!4" -L@M0'T,0  t9 R&UX, 0RP(K(Tu 0/Sn :0 000 (0(0 0@ -0#L0M0,0 P0T0 0L0 R0% :Zy HKOXT0 H0KG KbX HK @T p@TH l0  v0:S,0S00S_ T , NP0S 0Sk X NPQ 0"0 # Wd !07UP] l 10Sf VP@HK L0fPI VRLPF RRDWF l h10S L K 9P@HK L0fP9RLP6R, 0R8(K40S80S @\ P0K XP P 0R0% d*_&$0S(0S @\0L0 pjRT0@PP PT  L K y@Do\qʚ;@Ȅqh> -LMR8 <0  08$0 P 4 p`U @T@T 0 R0&0   @WpTYL 0&W00SX P`S00S0 @ P@= P7 P0  0 0  < R1Q0,0  !0Q0,0   b <4!4"<,0  ,K &W  "W00S <040C<0 4 P00  0   8 04<#$ 04(K100S  0 4 00 0Po4 jj -L M4 000 0SJPH 0 ,1`VC @T= p,p @T 0 RZ0P NP& P' P  0   @pT,0S`V p(K000P BLP0,0 'P    pp40`j -L,MPş 0  S0, L0 @P` D:X( @T@ HK@@KqV0 TG0KHKlVHK(YP| 0 $(f"pAZ 33330S* Sp P@l, 0R(K0SWp`ZO Z* Z y383833 P0KyVP P 0R:0R W0  O@0[S S T LPH`Kp |3  0L K28` VkP@Py  bOPVD V:OPMP@2  <`@0[S?0[0Sz2 P@P 0S 0S 0R0%0"` :V  0P Pp~p<`8` ;P1 ` `( U0(` UZ L3 3h3300 00880!000 P 0S0 00s00O18 00 ON0L 8 0000PK4 P0 hU0000W`p 4:?0[0S:17 0S%04"43K/?0[0S S)  P0KUP P 0R0%` h*#O>@DojZoZo|>@ -L M@ ,  `0Rpf x" 0@,W@-P>`0@ 8$H0S x2  ,YO (K 0 S4`  K:XY @,: 0<@ PP. ̟! !=0@@8DH@Ti JTe T TL,P x2@0  <@T^3D3,3833; R+P(8,H`0@(8,H,0S 00KTP 0 0R0% *l ?#, T;@P $(T5 Ty 3:T T ; R, 0#Px@0,Ks,00S x2@08 8< <@T t 8H 0@8H<\W8 >0@*084HTV T,P x2@0( (, <@T[ :T,,,0SO x2 00@0@, ,, @ 0,"PT,00S x2@0  W}T :0DSivT:WT ,0S x2@0x x| ,d(0P@P X,00S x" @00@@0D@<0S]F,0S; x2@00 04 ,.,00S x2@0h hl <@T9'WF,`'0PP s,00S x2@0` `d <@TW),&0PP  Q0,00S x2@0H HL <@T,|&0PPO  t>,00S x2@0P PT <@TW,&0ePP\  m<50S W W,%0RPP PP 5 8X!@>,#0OpP 1 0Y 8p USMP8 8 Q@ PQ80 QPQ81<8  @0080( @PR R80 0 0f(00 J8(~04 p(0<  "p8X`0@84 4$D8X 0@ 8$H$rqjTT@@ 0-PL @R 0S0S R  "P @0$ S00 009jpT@ -Lk$00 0jjj j -QLM# @P`p, ( v@P 5", K  kpf`0, K $K -`L|4|0@!0c48|0!0c4<|0P 0c4D|0 0c4C@@D0@ 00Q0 00Q D|P@10 R d0H, 00 S0 L 0C # 0 VpPPVP@ꫪj -, 0LRP"* L0So|, 0S*4@pD`@` V@X4<0,0 H8@K00 sP|, 0S:j,j -L$j(Q0( ,S  3S001 001 R0P 0-L MQ090L+S+ 333|3|3|3|3|3|3|3|3|3|3|33|3|3|33|3|3|3|3|3|3|3|3|3|3|3|3|3|3|3|3|3|3|3|3|3|3|3|331\0 0K0-0 K0ht0 K0hX0 K0hT,,0 PK0hjT@>rqȄqx -L8Mlr@PP$ ` 1$ 0R KQ<R33333333333333333333333333333333333333333L333333333333333333330Q:N0K hHVN0[0M0[ 01PڢQ: V0KUH%[00SVV0[0(Q:L0K( CHVF0[00Q:N0K 6HVN0[0M0[ 01Prpd (@Do>T@ p-PSLMPK0C`@0%T  @0FPx@x -LM p0@4(`bV`!3T (P  1T +T (KZP*0V':.0K G,0[S! -0[.@[01PY3T0V:*0K G3T)0[)0[1001*@[PP<T000 -LM"0K@ pG3T!0[!0[00QQuIPU@; H1` T ` `FU* 0G PMH@ -L(M0@,0  Ply /  DK)0D dYPll 0 R 0 0( P @3T 0T6 P PP p3T0000aa 0V 3T T#P00P0 @GG2@P  t, 0R(K<T<T G+T+Tl0 3  l0 2  )0XP0P0P0 @G@@K MM@0[S` SS ZZ 0SV l0.  )00 XPllfL@K ,1XPW 048< ̠<Č,ʠDK= )0D XPllT (@P  00Qwl0 1  )0X0SQGl??0[0S SK?0[0S @DoȄq> 0-0L0@SP ڀS S )G0S00 0@0@ 0S 1  G0T@00@ P @P00 0Ȅq -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K _L00 <4("4!<^00 >SM: 0V R*KDL"[04"48#8 00@P  F+00h n`*0p@0@P0h @P],0T0h `@0p@P@PL,00h Ȅq -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KLP , 0R:0( ,0KLP , 0R0% *8Y0 EP00@Ȅq@ -0LM40 < ! 0S 0/9I 0@/9I0S @ > > #=0@8H<0S x" 0@<.P`0@ d~'RP00`S1 D.P0`0@0@0S x2  < E(K (WJP< 00@X0@ x2  0x-10`p  H-Pd Q0SW Pl 0Si0Sf0Sc0%d,P0`0@0@0S x2  $ <0P t,10@#P (bD,#= 0@(,8HW,'= 0@+9IL+8H 0@+8HA 0S$0S00@0@0Sd x2  $ <ZQ0SR 0SG P 0SQ Q0S 0s ,K %P' *P0`0@0@<0S x28 8< <0S x2  <  ,00S 0S0S0S<0@p0@0 0 $(00 ,0 P`> <0 (0BS^:(R 0S 00< (00<0S T  0S 0S0s 0S0S 0s <)P00 @WP0T@ x2@ @D 8V X@@0V00S8 <K21C010  8`P 0S @S<,0 RP(P0`0@0 @0S x20 04 <0S0S 0S$0Si <5x Q Q ^ ^ p5 ^ :00@@0 S^ lg0S 40J8'> 0@'pP#0S !hP @T< 0'S  0R ( 80KJHP 8 0R0% *00Sx}< 0 0@ 0 @t 9I 0@<T 9IPh0 R< @  0<H<ȄqDoljȃqjqqqDj@jT@ 0-PL 1@hT0 R*0h_\  @00C@0U@00C@0L@q -,@LG hqn4 p-L >PC AnA#!B30b0020aA00 S0P\!* n4\4*0 R0S 8ChV N#!B30b0020a4A\4:00,D 0phjȃqj@qT@ -LM1 Pp0S 0S 0S0C0 MRM.0>DU, 'PU 40`?80S0C80ůڴǟ00GFǟ007  Npǟ0D 0Y3  @<T ,P@`0 0@0@@D <0S x28 8< 6Ɵ 0 R, R  0A6 R `6P 40 80S0C80p0Ɵ00(K 0Sz0Sw0St6fV ş@00 @P@0D@(Ko@00@|00 XY 40 0Sx 80S0C80'%00 00  4Yf4@,P \  0 0(Ko4 0<td0`QU00B %0S S 0S S <@x2 Rh h R: R/ \-Rg*P 0@P  ,\H <x2 0Sh hS:0S P0, 33h30S 0@ % 0 0P<@000@ @H ` ;PŸ0S "P`2@,P P %  0  0jPK <0S x" X00@X0\@1@@P @D , R 7^+ ^[ (^& , 000SU000Q 00SH0 0 0D 00S S>00S S<,P ,?MP80`0@80<@<0S x2H HL Z H00@H0L@ %㉠ X}P <剠%Z, Xj,0Se 0 __ꔑqqȄqhjjjLjT@Pj(U@j긑q)긑q - 0L(S``?pPO?7Q PQ@ QPQ100@000 00 (A(  ( ` D` 0-0L@P AP 1 0'S 0S S% 0S S  00h6(CP000S000 00S0 0 000S S 00S Sʚ; -@PLQ000 R5h軱 p-PL`@? U  U U -p0V 0 00p0V 0  Q 50p0V 0 00p00p 0 pXj -pL@(D0h00d0 p-q``q.QLP@P{e00/U00S00=U00S0d00U00S P 80S0C80@0 0P{D001U00S 0P{9000#U00S 4P{.0403U00S 8P{#<0P80 80S0C80 0<02U00S `P{0`0pyw -L @`Pph \0DS=^\^ #0DS/0D+S1#4T%4$4%4#4 $4<"4<"4<"4<"4<"4<"4<"4<"4<"4<"4#4<"4<"4<"4<"4<"4<"4%4<"4<"4<"4#4T%4$4%4#4 $4<"4<"4<"4<"4<"4<"4<"4<"4<"4$&4"4 #450S * 0S 0S 0S0S0S PU 0S!P 0S0S0S 0S  U0S 0S l0 0l0U.T @4 Q*Q (4 Q Q{ 㝰P  C P U U00⃁U#T 2T TP { zP  B U U 0U0SR @0S3{ XP8n  B ePd U U U0S/ WRz0Su 0St S 0So0{ -PC B :/TQ4UX0 S -Q0S+ UE UJ00UF1b{ P0  ~B U40PS  h+U)0 S d" 7 l0 0l080S `PW 4PS3, ' 1" 0S0S0S 0 00SzH0 R80 Q,<$!$ , l  jj -LM@0pSP` @  @LK{ p0 -@PL {h? -`0LdlSpdl {]PP" @ 000S { KP  A00S 0{0A :PX07 0A40S 0{0A #PX4  4A`0S 0{0A PX`  `A8P 0{0A PXPP8 8 vA -QPLM@pP K2U80S P` U @ R00S000PU@ U `0 R0S0)S B 0 yP000PU@ 4P -LM@0TpP+ `U` 0S{WPX HP  00 PP@ {:p{ e@q -PL@p` Pk 40P280S0C80d00$@0 0 j\(W A x20Qh  Q Q: 0X h Q* P 6P\ W -L$MВ0,0 #A0D L0 Q44l44l44l44l44l44l4454l44l44l44X54l44H64h645454l44l44l44l44l44l44l44l44l445464*, 0R(KPH 4PE 0P0a V(p>:W@V   >PpphPLPK``$:W@ ;v9P PpP`@@K>pP`P `P`PpP 8PP d0SpdP`pDPK`P l0p0HPK`H0 P PP`P 0Pp0HPK`H0 0@Do> 0-L@)R P\ 8@0@0S*@ P00\0S 8P 0 :RPP9 0@ 0PP@\ 0S @0@ 0 :RP@ -L4Mt`P( LP p@ )R@ 0 P P( 0R$KX Q8PP?D;Q;4<4<4<4<4;4;4;4;4;4;4<4<4<4<4;4;4<4;4;4;4;4<4;4<4;4<4<4<4<4<4t;4;4;4;4;4;4;4t;4;4:4<4t;4<4t;4t;4t;4t;4<4:4:4:4$84;4<4;4:4t;4t;4:4PDp@X;Q=4H=4H=4H=4H=4=4=4=4=4=4=4H=4H=4H=4H=4 >4 >4H=4 >4 >4 >4=4H=4=4H=4=4H=4H=4H=4H=4H=4T>4=4=4=4<4<4<4P=4=4H=4H=4T>4=4T>4T>4T>4T>4H=4<4<4<4<4=4H=4=4<4P=4P=4 =4l0   L 80 0 L0P0[8 0P 0 P0P 9PJ PK0H PPPPA4)P0H@KS P '=P0,0 8 0 =, P&80P 00DS񟗳?4?4:4?4x:4?4 P7Q񟗤@4:4:4:4:4:4:4:4:4:4t@4:4:4:4:4:4:4:4:4:4:4:4:4\@4:4H@4:4:4:4:4:4:4?4?4?4?44@4 @4:4@4:4:4:4:4:4:4:4:4:4:4:4:4:4?4:4?4*PPX )7WP X 0Sa PX 0S P00*PX R0LK0PL pzPX 0S0PL  P Pl0P00l0 P VPX 0S0D L Q񟗚PA4 A4@4@4@4A4l0X  0S 0Pp6P0L 7Q{C4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4C4@4lC4@4@4@4@4@4@4@C4C4B4B4B4dB4@44B4@4@4@4B4@4@4@4@4@4@4@4@4@4A4@4A4l0#:0L0 l0#90L0 l080L0 l0#80L0 l0;0L0 l0#;0L0 l0?L0 l0:0L0 l090L0 l0=0L0 #00S0L0 l0L0  00L0 L0 {0L0 xP W l01l0LP 7 7PPl0l0W l01l0LP77PPl0l0l01l0LP88PPl0l0l01l0LP88PPl0l0l01l0LP66PPl0l0\l0l055P Pl0l0l0\55P Pl0l0l00/LK PpQPPj \l0l011P Pl0l0l0\66P Pl0l0l0\77P Pl0l0l0\77P Pl0l0l0\66P Pl0l0ul0}\88P Pl0l0jl0r\88P Pl0l0_\l0l033P Pl0l0U3S],0SZ00SW40ST80SQ0 R \K P>0 SPP8Tl0P0 0l00l0P 00l0*P\1P$@Do>>  R-L@p`L6PP T V @  :P; 51*577 (R-LPp( B(07P @@0S1` 6P  0 0 7d3P 000 0 0 0 -LMP`U5P1 @0 0P <(4"4!< $K= 0 `: 000,3P @ Z5pP ; 51477 0 @0 0 000  -:0@4Pp -LM @4 8 4<,$@a8#$@D  X00(@0 pR@m4p4PP@e P  c3@P`1 (@`` A @ 4 ,0K0@PN40,("Ƞ0l08#80 #0R!$ ,000 g4<0#$ 0L08#8 $#$"  06P!  R4 000,0) , )<)00p,08 Q C4@PP7@(K|o -LMHϟdU@jXj p-LM@P 0`R :P" 0S* 0 @0@P0f @Px 0K5P  0R0% *T)D0@P0  x0 01 xȄq@ -LMP8 `GPy 00pPq 0P 8!( @@0( 0@0 0`0Y0 0* B6=Vw  0=`0 0@80P0PPPPPPP =0S7 ( :04K 40  580Pp1`00@ X0@0 K4  x2  80S S) S Y00 P(K 00S P PX x2 !X x2  X x2B  !` <  <z/rqln> -pL0S0 @` T& `@V P`P( R  BR0( 0 UT` `@VTVi-0$0VPnq 0-0@%x04"40 dPL04!40$ R 0 D*P 00S 0hTjdj -LM 0R0%@`P .:U:  0S . 00S0S6 S1@0S 00S P 0S 0S P 00S0C 0 0 (0KN4P ( 0R0%P *2@P $(50S 0S0S0S0S P 0S 0S P0S 00S5 $#$"   4Ă,4! C\5 $#$ `V.0S$0S!Z? (0S S E`41 ( `V p )P 00S0S 0S  r)P0SFg`Vb`V  _)P0$0(00S1R 0$0(5 $#$"  60@rqMbTjn 0-L@㡻0%P04"4  0-)P 00S 2_00 ($ 0$0(00h׺Tjn 0-P0P@LMKP0`0 00P 3 00@8ndnlnd0GS S S SS 5S S S p-`@L(P20V00@ 0`p -LM< D @ -4 <P@ <0000 20 pW,p  0,0 <P 00< S8 $*T R<0  08R#21C<0,Z, pW< Rs D0,@ S @3@#4M(K <2 @  PPL00X 80$0< ( 0538 r0,0 H10aR001#,05,0%\040P !0 T`V ) 8`V! 8#X"B0 08P#(:8 00@   `08V#(21C<0#6$ ,@0<@jU@ -LM`, wV0P0@PTp* p@U(PT(p" V(0 X:(20 0  0U01(p10 0 %"@(PTVp@ ,0pS @3@# ᐹq S-PLp@P`Q`R00SPRV  >P P U U*P X  0p03X0SP V  t4P | -P!Ll@p dP P +T 00S 9+3000  00  00@T e0 4+0  U1U@U@ -L0St0   00PH0@ <<0@$hhjnqqPk4V@ -Ly p0`V x2P@T 0>CS0`Vh踸@0$E D ]0( #5#3 0Pk4qjjMb P-L \  R @T 0 S *01 0 S00@ 0(0 pn0V@PV@ 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q -6L M6, \H @o h6\ \6\ T6\M P4, 0R(K(6\ 46\ 6\x2H P$ 0C\ 0\ㄷ5pPU 0`S 5P 0@@ 0Sy TVPPX5\ 0\D5P H0 H~.S 5D ZS H@  6L0 0X $ 80(0< , 053@ 0 TPU0- @ `1"0Hr 0@880S900S # H0 8²0 8P`U VP`U8#830%0@0Z0 Q0S@ ȀDSPP 00StH0 -0LS6 1\"\ 0SP0 0 ( "0 , "0 0 " 0 4 "0 Rx0 R  P 00S0 $#$("Q 5SjDjq q -LP`᪵VpP0H0@H40 0$Xh0 00$7Bj -LMp0SP@ "P` 0@  0@TF 40`0 YV?  = H@VT? "0 00@0@% 18SS C8Ss 01P?'0 S `VN @( p`P 80< 0CR80= A@X %'`P@x2 ⺰0 `.@0 P   `P@:PdP 40 `40@00x"0 0Ba&0 `@Z4`0( Pd40 `c01h \00  18o8C0,04 0 18cjW@BMbjxj -L,Mȕ0P,0 P`0Hj X@nn|4jjjDo>jhX@HX@ -LP@) 4 00 S H^ 00S 0S1ST0p 00S0 S! <0D x 0h:Q  PjB -1L\M℡P P( 8@KpH`,̲ <p P; \ 1S  W R !0\00 a`< 019|@KD`A* 0 <x0 p 8r 0?( 0R$K1S <r (0 Dj@DojBj> -LMpP@ Q 0S0S  `PL 4 ;00 20 SHX 0PU 0S h`(K0S 0S`0Z0S0 ,0 80 4 <@Y00S&,0!H $2$"0 o @T P P 0 ` 0T]   `P 4 0 Z0 100CS(D4P484440 e P ᗭ@  00 @4 R T 0S 0Q01R 1S 0 R0 R| [z00S 00S8  01# Pe0 0 e P)uY 0 BjX@Dj\jX@X@ p-haPLP $0@S 0SG TP $0@S 0S9 T1P S, T 5S. 0 R0 R$@0S0Q S P 0 R 0S 5Rh0Qp0\0\LJ qj qDj\jj -LM@, 0S ri|PU <`V} Hx2Q p Q|Ww 10Sh4444X4h44841 Q>001 1BaA0 iDP 000010!$10 %1 Q `V p p<00 0 P" p0S 0S 00l0 d0Ba  040( |jBMbjjY@X@TY@,Y@ -d0@Sh0L0 l0Q QX0 R :00 @00 R*h莬h 0R 0jpY@vx2 0-|LP 8{00T0@  0@T0< #5: /#3 00 000uMbd0GS S S S S 5SS 80 P0S0SPn -L Mp`P> 0P @宫00@ 0000 @噫0@0  0  R0 p00  0| ͔ 0S0C 0 @ 00C0K KhY@(Z@TZ@nrqY@ -@PL P000hxZ@ -@PL P 0Sh000Z@ 0-0L PR0k@P y R0 P00  0| u 0S0C 0 00C00jnrq 0- @P Lq0h 긞4 -LM  PK$,  &e@!P d 00 @00S81(0 R @00 0 pp    0: 0`000 0HKd`K&&\PKPHKGKdKcKQR S ,04!45K4%KT P0 X @ .K &@0K0@( 0K婽P @K  .(`w0(0@0 .0Sj S 0S ^ 0S~ ˠ@,* *4*(:0 0( @@ 40K K0@@Y x"P`00@0@x"00@0@2@X\$P PX\$ 80S0C80 ڼ, 0Rg(K; 19 1 <1 KK嘐 5 00S0 0 0<1 R9P 80S0C80?] 00S Sw e0R| 000 Ru e@ 0 @@ 0P 0%1 0 e %@("(04"ă[ҩ@ 0G @Do|orqjZ@> -LM(PK$0 , %0S e@L P d 00 @00S008!U( 0S @00 0 pp    0: 0`0@0d`K HK@y%v%0 UG0KH Kc0Kd K \@K h-Q R R 0 (SK Y%0K ( 0K`P @@K E-(` x0(0     0 8-0S S 0Sk +@"40 0( :@@и 40K0^0 K@@Z x"P`00@0@x"00@0@\2@EP PPT$ 80S0C80y, 0R~(K1 <10 K0K嘠 M; 1=EPx rPs @@K ,@@K$z P e@ 0 @@ 0P 0$1 0 e $@("(04"$t 00Sk0 0 0g% 04"4P ,5KP@K4\@K%KXP T0  00S SRp0 R P 80S0C8084v( 0K@Do|orqjZ@$> -LM0 005  @0000 0 -PL㞬UpV u`PY -B 0S5 0RQ0 0S0R0SY0!00SV R0 l10  0| f 0S0C 0* ^@L^@BjX@Dj -LM@0 s 3X R7 Hd0S LLKe< 4 R \K[ yT@Q0 00Si <KD _c0S[ L [ \K ϦPp`P`6 lK@+X e0 00S b0S8 \K Ae0<K P P <0S 80S40S00S O!@KK( 00KK|@P 40  00 Rs a0S L[0[0S%04"45K71 R 9H0SD0S@0[S <0RPP@S@ !80S40S00ST0%% P00 Ġ"Č0 <K\ KK~@ 0<K @a0%  `@R000 <K\ Kdv<Km o GPP 0p` `0@DoDjjq@rq^@x_@4`@L`@^@`@^@_@ _@D>L_@>_@TP0S0SPp4 0000 0p 00000jP|0 PP h0 Q X 0S P<0 8000   jj q n p-P0L@`TP @T 0S Ppq -LHM0P\p 0S K P40 d@KD`4 0P0@ 4 ` \P X` p -L@PEp0`S hZ00S 04!40 T4 -L<8 Q l0 R  0Tq@ 00D00D0|$ 00 0@0@0jd`@j -LM\#X@0p<K,0 傣 BPP` ڡTW00Kx0 O  K0K 0K00KD0 <80 4`0X@  @ 堀 >0 0000 4 0000 8 0000 < 0000 0 |0K<K0tK{0K<08 P0 T `0@0`0 eK@ PḥUW K⟤1 R], 0R`(K`0L@K0 `0  ᆱ<L08H 4P0`D0P@ P`0`@00 0@tK |0K<K0{0K@ <08 P0 RT 0P T RCJ #310" cb ` P `0 R K⧡0 PP`0 0,q@Doj: QN`@`@T> 0-\0L@PT@T 0SX X0RբP 0j -T@LT  oP HP 1S@T|\000圊 -0L@pT"V@ HS0S P0T0SPU P0S0@ 0S00Sj p-LLM\`K@DP< 00 \X0 T P   @0H0 D 4 0Kp -LM┢P0 , L Pp p2 R X0 T[, 0RS(K,2@T@T T P0 X0X R%P 㠠`PS HK@K(0H0K @PL@ L@ @KD 00 0`0 0儀 0 8 L0KPLQ rLP00P0Q800C80b0 RL ~@XPy` v0 0` L`V 0 R `V80 R XX0 0$n@Doj(a@j`>a@Xa@ -LMLP0 0, h0 (2 R 4X0 P, 0R(K0HK0 @` @KdpKG`KH@KPK (\Kc`Kd@K DH0K0 p 8 h0KPP#P0h0QP0(1@T T P0X0X R @Th R 80S080h0 R @KԟX0 0PF`'P pP D0 R ở0X0 0$p*@Dojb@t>jb@Lb@ p-LMS@T @T L0 &P @@2 R T5L0 P0J PP00P0@T 0S00S@T@TL0 P0PUG L01@T 0S00S@TQ@T 0@ 0S P2@T R 0@00 RxPP0P00P0 3PP 01 R &X0 P`P 0 RP0@T 0@ 0S P000000@TxX0 t`rP0T L0 P00P0@Tv 0S00Sjqqjb@ - L@`0T#1P`p5 p@T 0 R0@ =X0P 0P 00Sp`0WV`\00C\0/PP\0`0\0%PP\0p0\0 -LMP0 xbP< 8 \0SK4@P 0 R uX0 0@㿢 pR000 TP @|㨇T 00CS 0|㛇Kh 0 j(c@hc@ 0- L@P |㷇P PT0S0T0T@0h0 -LMhQ0pS@xb ?R70S2`| 㒇PP, ` "TP@XT@((0( @0T0T0S0 00P奡L0X  00 0 K @P @0 R םX0 0@Hjjjc@ -L0MP@pT@@  1 ; S00@0 &`P L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0 W GP L0o @TZ p@TM 0 R0X0P 0ўP 0@ < KH H0 84 pQ*<00^*r 8200`RL0 2% 30%`  ` 2QR:R40 @ R 4 <K0 D HD!00Y ` 0w03"! 80S \0@0\00l!@rP\00C\0@ Ƞ(K@P| ,1 Rx  X0 0@|l80,` S L0 , K@P 0 R ,X0 0^Q,P L0`J8@,0<@,:,`B4 8<4 8<mj 4jc@(d@ -$LM0ȠK DHpK,0 d`K℀ PKx@K0  @H0KG K0Kd0K Kc Kh p P ` @ 8  0KQ j 80S04$0, 0R(K0802Q@Do> -$0L@T @Tq -,LM0pHKdK,0 `Kp PMȠKI DFx@KP0H KHKGPK0 KdKPKcPKhp ` 开 匠 0 8P8 0K2@Q  800C80T0$0ϟ, 0R(K@Do> -Ld1pQD1 R@ @T: `P@T V? $00S0U  RPU00S b@TV7 U  P HP 1S@TV Ubiu0 R  h0l4 P HP 1S``ӱU `V`Dj\jqd@jxd@ -0  LRPxb0 R)$0Sp! R 000  0 @T 3P @TW_00CS0 |h趄p 0 Dj\jqjd@ - 0PLxr妟@ J`PL ATd $0 S A5 @T6 R0000 0p @T P@T P @ 0``000Þ00  0``@Tᯞ1S 0 R0R(| kP `LAᏞ`00 R$0 R  qjDj\j -LM40P,0 x™<0K 0 @p<K 6 R 0Ɵ, 0R(K`V 6 R 6@P 哚@␚0 0T<0[S 06 R <K~$ ;0[0S 0R0%P :Us @KG vP 0 4 d`K8( LTu\K0TL0K 0$0H0 $KD  <(4"4@%$LT0T @B0$%#5$  %#3 000 0 4 8  <,$!$ , P`P% @ P 01@\:0SQE 44 R  <w0ּ,4@P $(AQ 0S \; 0 A9 e0 00T4 3 R9 <Kיe0 DJ/ 0K P  0R0%P Q*TbPU3 R  ,.2 R  % @ 0<K@ @0Sz St 0 S PK`0 K0KK0x [0  #x K0x [2 00x0KlK0 $(, <4!4"<0 0 $(, <4!4"<| 0 PF @0 $(, <4!4"\ U *(1 RT < 0DL Rh0 h0R@1*T:0PU> <@00S0 R  p0 R&  0@@Un 40 R  0\t@Do\jjq e@Xe@j6Mbje@>rq@g@@e@e@f@Df@f@pf@ -LHMP`@0p,0 <K X2 RL2 R!,, 0R(KX 2 R 2@P  ᮘ@⫘0 0<0S80S* 0R0% =:P1 h@KJ P d\? 0 A= e0 00T8 1 R <Kye0 D40S00S 0 R 0@P $( @0KP @ 0R0% *X @ 0@ <K@r(@Do\jDjjqg@g@g@rq@>-Q P-R 8Pʥ$q 0-)RLP@ :R PPw0@0h4S @0h@0h --dLM0p,0 0 0 0 0 Y P`0U @K3 0 hP @ < 0 :R) ( pP: @  @0K  P4 00 Y @K Dȟ, 0R(K 0S0  0(0 pPWpP700 0 :R,0K@ H00 厪PY  vH R 40<00 p0  0#$#̠`#8 0v00僨 0 :R0 q 0\:( 0KP P@0( l0( 20 K` 0 :R ,6@0P 04 f0S100 _0S x2A0 0@0@\ 񟗥40444\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\4\44P4444p4844440S x" 00@0@ R 0S x" 00@0@0 #0 0@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" B?0@1 A0S x" <0@1A0S x" 00@0@0S x" 00@0@t0Sq x" 00@0@f0Sc x" 00@0@X0SU x" 00@0@J0SG x" 00@0@<@Do$q>rq -L0M\ Q, L @P`0 8#8^[L4P4 44444444L4D4444444-0L0 X L, 0R(KsV P ~00c5 0@S 0L0 }90L0 V_T 0SHK @G0[S_ /0L0 0@S2 R 0S 10L0 V 0L0  w2p dPL h`6PL bP0 v@0 ~P { 00 P៑႑~0 w|T80L0 tHK 0@K G0KHK 0L d`000Y,1 R 0SL0K,p 0pH0ɧP+ X<勷]70S 0S 0ss S0S,$僣Pd 0aP0L0S10L0 8)4 0L0 @Doj>0h@$h@ -LM0PS`@ $K0SP0@S'P% P 0 R Tp  0R0V0Sp  t00P vP Zp0p@, 0Ptj0>\q|- -L0Mğ0堔,0 Pp`0@`L 0P ST  0S 0S0S HK0 X H0KG KHKX 剥PU TS PUC @0 l0  v0S,0S00ST , P0S 0S$0S X P0s\ 00@0 @P0 T0b bP"I 00@0@Zm l 20S4P0@HK L0dP LP (0 0@(0,@40S80S @, 0R(K 0sm 0sa L KZ& !0 @P l 10S[P @HK L0PI LP (0 0@(0,@0L0 L(0Sq jP0`0@0@!  00@ 0$@T;\" Pp0S x2( (, 0 0c Wl0@PP PT @S\ L Kص@Do$q\qʚ;Ȅq>5\q -LMßPp, S0@0 3@0 `K3 0\P `  & X K 8, 0R(K T 0S 00 0S/00 0S 0S 0S$0S(@T| 800 0S 0Sb ,  0 pP700  Z0 (1"(1(`0241"4101 #0 !0p0@  0# #$#8`00 0HQ 40<~ R N 0(  PH, l0 , 2(0H P e$0S(0S900 [ 0SW100 THKH`K[0@K DP[@ ,KH0@P 3S@ K n ᎏP@0K 0 f &@Doqp> -`0@ 1 !0L  ^0$1C* 1A00 P  10!R C 00!00>0^P peW0^*"!B0  0pP  >0> 0 c/!o6YYYZ&PZ& -p`q @ !0>0#6610  !0^L$1Q*2h1C P 10!R B 0 0 p0^;*21C P 10!R B0 00p0!0>0^ P`eV0^*"!Bh0  0p`P pp mXXXXZ&PZ& -0`1@L  ! 001 $!0Sa <0S[a 0RN*2h1C   P 10!R 0B: p0 p 0R/*21C   P 10!R B0:0p 0R*21C   0  p  ppmIX.X *X &X 0S [&PZ&@-@\   0 S  0 \T 0As0 -LWMP  y0`0S0@+  @0S00f+cYU ,0KSpW0/Sp y(K\2 ,00 SPC/R 0u/S @0 tKL H0  0Cp0 l D t` =P/00%Y0`, ,0 0@fP?p  P 0p@0H0 0CtKLp l p0 t` D =P p,0KpCy`SI\NI@ 0LKP 0 p 匠 d=PP0`K 0^PP 0 aK^PP !p1R!l1RP#I`!Ipu -LM  4 0 , 0 P  0$00 00S (K ŸK0j^P0UX# R 1  yp2 l W`Py0LŸ0 @ P< P< KH0 8 \ X0 DP L T P  x0P 04K \K0K,0K5_PpL0 pcW]0PP`\ 4Q0 0 S+ 40 0C40 phW*`U 40SG XDE0S U0 0-  P1U0O 0ApbW40 `P0,0S X Pax|0 >_Yxb R ? 00 ` Q000q -L`p4 P@ P! P9 T00PU0S+ 4 P@00P P P00W l|`FpGW@ Lt@T0gG F`p(ip@ @0Lh@0@Hh@l?0tq@-@ tϠ0Cl$ !B l10b1 0!0c"0 0cb# a10` bP@tq_ Nn @-@R 0 0#\P0S SS0S0S  S 0SQQQQQ!Q1Q!Q1R 0S  R@R  0R\ P0Qc-R 0R^8#8S    2  0> P0 P 0Qc R-L" 0S 0S \ @`R 0S  ^00NSa00@R  R 0S0  R000Sa@R P0SbR 0PP  R0QcR0S0  RR B0 0Q0 0QQ 0S0S QbQ- * 0 0 QaR *0\ 0 S RbR0@-P@! A0L\aL  S00`P0S 0zP ^00@P0S ZP\\  R0 `0ȠR@-,Ƞp` Q R2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0N("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApq>0@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 00>Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@z5z50% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_@5555|5555555555555 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0Q1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P a4`0P =("((8#R  < 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH << 0 h(̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  X; 0 < 0  ,0H,0(8S0b0h@Ph@>6>i@0i@Hi@h@h@h@G-0l0 $0 #44$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d @T*00(0S, 00000R00#3,05$ 02,0(00@c T: l (0,00 d `4d (0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4c(0,00 04d W,@0 S E B0P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 SB5 4565P75xC5lC5PB5DB5F545<55h55:5pA5>5\45h@5$?5E5t;5;5=50=5C5C5A5tB5hB5\B5V_ L`F0zL Z0Sp6 ? 0 0VK L `F0zL  Z0\"'X?P  Ud 'w\`Pd JRh ? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sv  8T\aH  D00L@P(08pS<0S h@dh@i@Bi@i@i@Ph@\'>&>i@hi@h@h@h@VM L`F0zL Z<D b 0@  0\ 00 0S^ H0 l80S'4<,'<$0 0 R DP1 l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Ts 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R8 080 0  0bC1 @00@@0@d0U0P0S PV pp$(,80>P 0[SP# 0C 0;4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,/>\/>.>->P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES\ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S x8 0 80 #4 0 8q000S 8 P T  06 T XP ZB0SiS= 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y& 00S#l 6;CRP' q c0#2cQl0S 8!JG [800SS@SP  BR# 6 0S   0p W p  0 S,0S ^* n8(8 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:x 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#@ 0 \ ,0S ^* n880 R I00 0_U n88 n888!if 0SF~[00hg00nI00+ n8n8R n8f8z ]8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0 r 0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR0X0>0>B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P pX0> -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSU``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPXbtPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z008 l0\00 RtZ\ R80 b0$ l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z2>0>  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b0 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X2>0>  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0vl0\0E0 R l \,0 aA?C0CR:Q800_l0\0.0 RpRt0p03VQS \l P80 `V00>l0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  6@8(@)L0D, 00 < @CL   BD2`21C 0 0|` H@l@\@t@x h@p X0> -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0M_z5z50> -LM@ 0 0=K @0`0>Z Z 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@jj,jG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10\^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z < VCP 008#800 "$ 0 c\ 0C0PU0:0. $e0nPuʰ 0PU00*Y   Z  0000C^ Zb \" 10. ppP0gU\058#800 "$ 0 c\ 0C00`F3pP0gUo#058#800 "$ 0 c\ 0C00tsPUJhF058#80 0 0"$ 0`!Q@ V?3pP0gU+= 0%r0P UڬF058#80 0 0"$ 0`!Q @U Ѝ<F0 5 0KŸ 2 % 2pP0gU-1 %qP U>ڬ F058#80 0 0"$ 0`!Q @D0 5 0I$4!058#800 "$ 0 c\ 0C0p0P Uʰ F0 5 0+-058#800 "$ 0 c\ 0C04p0P U[F0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  2>0> G-4@ MP %!0t`P0fUl058#800 "$ 0 c\ 0C004 Q*03 0CⲐ Yp 3+ 0ण` P0fUڐ058#800 "$ 0 c\ 0C0 0<3QU ,3  e^`aß0>8#800 0"$ (0a"(R#A IX223pӗqӅ!0p` P0fUw\058#800 "$ 0 c\ 0C0 02QUw 衟2  e^`a\0>8#800 0"$ (0a"(R#Al1  QV:0L{`P0fUD4058#800 "$ 0 c\ 0C00 0 Ѝ0 5 0[00 5 00x0 5 0X 0 >0 < 0 >0` 0 5 02>9>x9>0>9>d:> -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Utx058#800 0"$ 0a\à A 2RpgPL+0Რ08#800 "$ 0 cZ"0C0 0!a0P 00eS% U8h0 %PQ XH<0>8#800 "$ 0 cZ"0C0 0g0  ;㳠 0 0 0 % 058#800 0"$ @P0a\à AX 0 >03>@-0@0Sڀ  0#4 0 L L000S00 0 0000 -0L@ ^pP`=0>8#800 0"$ 8 a#8S2 A0 0!< 0 ! !0U0 0 \  0 >0 -LM`pPP00 @2RU+&(+뤅@010> 0 R@DT0pş  d5 0 ^ !0S  W R0QS3 U@ T000 4 0$00S (Ko40S 9 S Q<S Q Q00408#800 0"$  8 a#8S2 A0 S@ TJ048#80 0 0"$ 0`!Q @Z㈂P10 10> 0 ("(  0#40 P0b\à B U  B p P0 10> 0P U ,0P&M C@   00u00S%(K00H048#80 0 0"$ 0`!Q @00058#80 0 0"$ 0`!Q @tJ0 4 0mT0H . H4A0 5 0# Q8>3>x8>0 ## p-L@MXPKX T0 H `l @0D ( 0 , F@P Kp,P@ }T@D@00v@ @ -LM ^(;> o g(  -LPp5x5555555555Ȟ5О5؞555  $(,04@DHj@( (0 -L04 hn5Pj -h0L0S P q00P0S p3 p3qq -2LMS`p2P:W) @P0@0PU P Pޱ(KQ 4 P< ,, K00KaP ,  ZG Z 啱A8;01%J 466cRJ80 [104 8\! l\4  0 R0PZ4 Z&  104 R080 :#:N:cR@80 0<0 00 R 0 H,00 R ,h H00<P0 R 04 H, H `!Bj@qj@Вqq -L@` PPT T pT *p00 p@P0T0P@iPPj@ 0- <LM00CP@ S ꔤ555555d55555,寱1??3 0 008 0  0   00#2+!  RĤ5̤555h00 K0"8\81 00  Kt8 0A100 0L0 j@UU33 p-L`p P 0 RxHL l j`@P000r M m 00C0IjL xoj@xqLj 0-PSL@2~s 00H00H00 R-L@( R-L@ R-L@ -L M4  @,  R uRu B,  tR RQX10P400C`s0 40 * U( @  x  `  00 Ep6S 8 Q q U:*P400Cs40 (Ku, RPE @`04 @D 00` tU: PP p QP L1T,P @ 4 xqk@k@0@k@@l@l@k@k@l@k@ -QLM@|h衯p垯h囯`嗯P咯$@卯H4,凯D h胯4l@Xl@pl@|l@l@l@l@m@ Q-L Ax? p-LM0PK  % @`P  0ax5 0- L@P 0h0@58 -0L`p3 0-@PL|> `S  X0$$  H000 # $00m@@C>B>n@Ե?B> C>0C>C>8C>Tm@(z@0@m@dm@`m@`z@lm@tm@@d@m@?m@m@m@m@m@k@\m@m@m@m@m@?m@m@@|m@/@/@ Bm@@m@h^A?m@h@@DAm@ 14;>>m@ -pL`@PL LE8P$1( <0D $00HL!0C00wwww -tt0 @ ,0L H0 R5hb, DH!0H1pqȒq 0-H0L @0rP 0Pjidh 1PP0O Pa2 7@0L!0*4  40L0C0$K訓qGoqВqqqqU=jTjp@(j,j kpq@ -t L@Q00  h[c8h90  "!2 HjPq@(q@@-@Q >0^ 00\R 00$0(000Mp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ 2P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K 0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , K4p 8("(8Q, "*46*, (00S 0p q  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p0. .  Tj -Lpxq@ ->0LMd1@ 4 ^ P0 @A 4 0R0  800` p,0 P00U:& Z0SjzGW2 3 0@P! @@X4 Z0SjzG,04 0S,0 <@(K$ 0 TjqВqq@ -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V O0 Kpq -LpP 00S 0 Q Q 5555X2XĤ娥妥 0GSt55555@TU W: WE Pf@TU 0Sc0` S`1`!WH0U@ $W W PfU @0Sc0` S`1`!WH@@ 0D 0D` 0 8@$DHz,Вqr@ r@q@Tqq@00$0(000C -Lp@@`  ,PCP `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM@dPQ $3\ b  S] 2"S0"xp峣ᰣp1E媣p1@8 奣p1 8堣2XRR0S Z$ t"10@T ``"$Km艣P2 RJ D2D R ,, A0B%@rZ$Klp1  gd 0!!dpPPQLNZ2 : Zp18lDp1 0\?T$Km:H1 1R0 \a0@PLŠB%0P @`p1c`]  $KmAPC>t@@q8S@hr@r@r@0@PqHqE>ts@HU=8q@qXqF>dq s@r@r@r@Xr@r@r@4r@`qDq4s@lr@|r@r@r@s@s@ 0-<@L`40P 0h1ld!0hqВq-0 .!  !!-0 .!  !! p-LM@0P`XT T T |K0p03V0S 0[0xK0p03V0S xK0p03V0S 00x1[0xВqx@ p-LM@84P SP`< 0!10 W S % OLHC$>4;00S @D 3H0|t(8< d#H T Hy@\?I>y@8y@Xy@pl@y@y@y@ z@@z@Tz@dz@$z@,z@dy@y@ -x!LM0@00 0.!0 S=41HpPwL1@  0psYhX W&: `N @03 P 0bP P040S! 0S0 F/ x  0pHYX0 RH  0?  0p5Y0pqpz@Ēq -LML@\ 00 H   -LM \`Pp@  0 `0!L1 -L(MDpH #D 000 0, !D3#P`3UPQ\LXpH0H0XN@ :S6? ` 0 PP X aW(K /DH 0HN@t T*2 R0S H 0R6BS 0"0SHD0C 80 4 0 , 08, 40XH0&R P20S 6S 828"0S`` 0B P 2 R)0@  0 0i@0P< 0$X L80K0DH 0 PX 080 DH0 4 00 , 0SL0 ; 00 H {X@\ <0H0q<  0垠DH 0(< Q 080 <0 SHD4 0 , 040S 0S0 F/ t| 080 `vLDH 00ВqpqI>Goz@ĒqTjn {@pz@z@ 88#4 S #00S - - 88L#Đ<0 40@ Q: EP@qj - 8LM8#tP`pB` 0P0V0S @Qv W5t5P55555555555\^!0 l`P `0S a0S^  Q# Y`0S`` `Q@1H#R) PG  Y`0AS .00 O 0 `Q! Y`* = 00~0 0CS xP}W8@0Sjp J?`@q|@Dqqq@-@ 0 @@00D| 0^D@ L0H000L0H0 0404550055 0404q-@P@0S 0S0S00 40C4P0 Q L0H00C0CL0H0550C0C55q@-@@\,\) 0Q0RD0 0D0 0@0 @"  4400C44 0Q  L H0 0CH0L H L0 0CL0H  %5 0C5%%5 0C5%q@-x@Q0000  00 0 0S00  0n- 0S Q000000 0 B 0S H Q 000000  0n - :8LP#  Pp#$ 2C 0S0 0*"%`Q000 0000x 00S `0H0*"%`Q 0@@0qqqВq@-0$,@0S!*4*6 ,<10P  21C0P : #P 0S ( 8. :(#8 #:T000 -,0LQ  08qВq 0-08 L  0 RP@0 h0 Q X1S 0,PH@0蘖qqqВqnq0 0 Xqhq 0-PL,:8#*! #P! 2C 0S0  ! 00+0L 00S<@ 4@H00ĒqqqВq-  0 0 0 2 100s00#:$ 1  !!:10!\ 2C 0S0 0 0200 020Ēq@-`Pp !:H$$X 00S | $:1 0P  21C0P :#500C0 -LM !Q:0Q*0b"!B10b0 @ R  R 0S0P 0`0 0 K0K@P4 0L000S 0H KpqqqВq p-@LP`LT pphP$ !:1  T0 R 0S0S R: #:dj -L\  \X0> 0+ 0!04 00S 0H0xqqВq\q -0!>00@ +.  0L;>00 <0+. R 0H 00@輖qВqdj0dq@-X0@P R 0S \ Rdq@-X0@P R 0S \ Rdq0-0L 0 00 0A0/ B 0 0 0 x0x p0p p0?00?X0 䌖qq qLqtqqPqqq486q6qlqq|qxqTq\qq 0 R 0a B0ᤖq -0L0Όn`VPp@ZJ%:P %6;#;K jV! /0?0000?傜ljhj|@ -LMP< 0 S S 4 8 0 X2X"0 80 L20 040 >0>0S,0 T 8>0 + 00*< 01 <0RWHX; @46XS#PP <*: R[PS 8#8XS#&0*5 p ?=@`PU@ VU>0001 R 1PHU@HX,(K 40 *5   0 SHt0H`0HX0X 0 80 L00 040 x 8ٛ 0֛,ԛxqTqqqВq\qqqh}@<}@}@ p-``LM^P @ 00040@^Kpdq -L@\pP \`0`$: RP  d$5  P0 R 80H,0` {x댖qqВqq}@}@ p-`SL@P .:8#*l! #8\ 0"!B Q 00S:#50 600pIq}@ p-!:@L P0S P9 :#0L R@" L00 00S`@p 0 0S : 00p 00Sd` @pp<`H$`H댖qqВqxq $~@ -Ls 0 dnq00 R$0 Q! 00wꈖqpjtj -0LM0S | 0@T00 KKh{L00.*@ @@@:0@ꈖqtjTjpj 0-0@0 0LP$0   R00 Rt tP ` `000@0  0@0$0)$v눖qqnnL~@ -L  -L  0-L\80[0P 00SDP 8PH,@0o0hJ괖qqВqn p-0L0b8#^@(0P% `0P$0 2 0S 0 R 0R 0 RX%1?00CS0 p0\phJH0 R <0H 0Hqqqn(nВq -!!:LM1@!T, $ ,0Pr`j0S 0j0(Kא 0  000S 0 A000,00PP @0S0000nq(n - 0Lap@L90 R ?= ?0R% >SP 00#! @R00  00#!H0S  S 0 0iuR0SqВqq - PLPD*%!*41! %::6 Sp1 p!P!8 2C 0S0/ :U# @! #* @`ZU@*0S 0@0Z00U0`@:8#(00b0L0 RY00j  0HqВqq -qL0PS* N@$:8#*! #P, 2C 0S0# :#Š0L R` L000 Rx`0+,0S 80H`H꼖qqqВq - PL` %7*&!*0! &::6 Sp1 p!P!) 2C 0S0 :W#@@PL0HS @000jV@:D 0SYhHВqqq -L$M (2 " BϠ01l! 40 *74Qj 1< 8 DP_ 1  0K@ B0P @0 , @"PQ0PiUX5*PPPq@0PJUV(8 $*(": 1 0"P 2C 0S0 *"%0L000Q H8  <8 H408 S <@0(< P<(K0ޗn(nBTjqqqqВqqt~@~@ -3sLMP00L 0, P U3 0So`@P %1?^ 0"!B  APP0 " !B 000 Q GP P⣖ UYZ @: JT * 4P \J␖T:LbLR :#5p^8 Q8>0( &#&R+:0R(*0a"!B10b @\\ 0T0U 0 D  D 00C D#&R:0R: q 0h0$  0S 0 R- 0a"!B10b @\\ 0T0UD  D 00 0@0 R  pHHpqВqqP-0 R0P  0S 0S  R00L00 08   0 000nqn -@LPP @ `$4Q 0 `R Q 0\` @R^\RT PJ @3\ @TB \ 0``` *(":1 ` 0 p^" 2C 0S0 0*"% PL X 0S 2 R 2Q 2 R 0R 2H@T2p2U  \ R V TJ*PH @ `A ^ 2V^:`p(*(":1 p0"\2 2C 0S0)  ! 0L0 0SB  0S x10d1 R H1Q* D1 R& 0R# @T0*"% PLy Uw} 0S $0Dp0So 00k 0H0S t0 0S 0SW L0 S80@p0PpqqqВqq -@PpUL`  0S 0` RH  \Q% R U @T ^  \ 0h0hS 5S 0h PPU\  i - 0LS@ 0L0000Вq 0-0LS@P 0SP2000T( 00S 0 T 00 R 0S 0S  R00p00 0\   0 0 00P00Вqqqnn -LM@08 S:(K M084 Q8#:8#*a$#8@00 T9 0 Par0f0 R 0f0P4@T @T 0$"*>!00Q `$H@T086Q00$<$4,4Lp:#:S,3#$PQ,KOPt '*(":10"P 2C 0S0 ,00*"%0X0Q* P*:#:"*S3*3#$@Q  0P: 80,0 %*(":10"P 2C 0S0 ,00*"%0h0Q*8@0PpP<2 PB2$"$Q,KP PJ 0CP 8, )*(":10,1\"Q 2C 0S0H : #5 L Q? *T0S 1H  0 21Cf  000 0+ ;0 0P 80,0 ,,KxPdPX H@24 He HlpqqnqВqnpqnqn -L,M0PSpT $6P~ 6 Rz 0Rw 0S 0L L 0TW* H '!*! '::T6 S1\! 0"!B P 0P W0#D0 %*:#eD @L RpL 1(K0L L  `DzD Y`u Rz 40C4"&R:0R*0a"!B10b@  %R55SSH0SL L R0R01$$0XD0`0óD0D0` 3U  DD0`00D0Z @ 0S@ 0 0S@@ 0L RL R{ 0ST 0S00D3 R 03HL RTH0R0H0 C <`K0S 0S0Sx00 R 2UA 2 R= 0R: L X` @Tp2 0S 0SG 0S 0@0S 0Se0S 20H0SL  0Si000L0 PD 6TQ(K1H p 0S80S/<040, H!0S 0L 0$1L@Xm 0Sj 00e0  60H00L00p0@X0P[D0 80L0 (0L qqpqI>dnqВq`jq -`PL 0S 0Sw000pCWp 1VV 10S 0 V0 謡0s1!VLG 10S 0 V? *.X0  0 ( 0R10m1 R 0S 0S  R0000 0   0 0 0@00#! 0lP0  00#!8000qqĒqGo kq`qnnnВq -LM@4 ` 04 SPa40 U3#T0` %*0` $!*! $::4p6Sp1\!m 0"!B Pf 00Sb Wa:#e\V T ,&Rk:0Rh*0a"!B10bPp"000SbU , 4  0  , %R55SSH0SL L R0R01!0XD0`0óD0D0` 1ZF   -D0`00D0Y-00, 000 JW`@4 R~Y 0 0S> 0  0S 1,  (K0 00PS 0H, 0S ,0 0S 00  0S `0 (Ko@0H10S 000pqqI>qВq -LM` PP "&R :0R*0a"!B10b080 8 p@@@@V  iY I (K**(":10"P 2C 0S0 Y : #50P0 40  0>0S8 #&R:0R *0a"!B10b8 R D08 d7\ ,  \x < <p%R5 SH0SL  0R01&0QUD0`0óD0hD0`e P0`00Q00S8 0@rxV x6 Z,  , 00S000$ $,0P &VW $6 RS 0RP ,04 00S 8 Rr %Rh85S8 SH0SYL R0R01|%0ATR \5V  888D0`00D00 Vo  < <D0`00D0W@\ 8D0V @S40,D0SJ4, ZQ *:$  0S 0S P4H80L 858 D0`L R<<5S000S K 0SH  3D@0Sk 30f4|3H  < j<T0SR 83 MW 0P,0 ,P V 2 Z2, , \ P < <p%R55SSH0SL L R0R01X"0ATD0`0óD0D0` "Vu  < <D0`00D0 P0`00P00S 0SU  0S ^ 1Dރ88D0`0D0?|< 善<Pp P I 0!V0   @ + 8 0S 0P08 @^ 0PS `00 W 0H 0@s 0S d0P  < < 00@,:눖qpqqqI>ĒqqqВq@dn@ 0-LM\0P0 04PT@b80q,0 08nĒqq P-LPF 10S 0Aq@p`T P 0S ` U  Q`PV Q 0 S- 0S0 S 0S 10#U@T% 0DT# 0<0 0 0S t0P 0S T0L0000@0HqqВq -08PL@8@{K@ p@0S0[ ` @P00hu@`H0[0 0Q HꄖqqqВqnn -LM@PUq 0!L0P0H0 R 0!0, ,0 1p㴑02C 0S0`< 40C4 :#%4 0C40  0 pR 41T( 01 R$ 0R!  @RTP X@,0T 0T.*(":10"P` HX@@ 0S , 0S X0,, @D0, 0S $0, @qqqqdnВq -LM< D 0@@0 TD n 4 <0< 0,0 0 4 * `(p":1 0\"X 2C 0S0O :#5,Q080 P `E <0P |"`0 0Ph2ZG  L0H 0C L0H 0Q 0`,0SQ 0Sj  0S 1@PU 81P R'0S,  0S.@T(K 0SL 5<0P H1Z 5%0C 5%18H0S0S 0 00 0S  0S 0DP 0S 0Q l0@ 0S H0PP 0S $0P0HꘖqqВqq -D0L0 -D0L0AQt?6l?6p?6l?6t?6l?6p?6l 0-0Lp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@0(kjjj|jqq -3LM , c3< r C0S xC0S!((!"$PuL30p82 $P@ n 0Sk @Pbt OK㚻2~Ϡ K,2 ( <Po00 @pP_"0S? 0" 0-LM0PS K@P K0S@00X @  08@Вq p-00L ` HP`N@^P@@eN@ 0,0 L 0L0H p.q,j@ -LM00 ( H >~p@g00^0L PU@`H@ $@K,0  $ 40}ZUzj K,jq@ -`1LM0800 0(0KpP (KKpP@(04 P 4 Kp0p , 0 >pP0@@ 0_  Kp0 ,pP000GH6 0-LM  $ (0 L!\ + 0.L 0L!.@ L1:40  4PL1L@E@0L!L $Q( 0800` E`0(0004 K00崿qG= kp@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5\`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xhjp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4Sj40 $ R ((0"4Sj 0j 0  8Do -l LM0S 00LH0H@ @@@0P ,0 $=nI>jjj BȀ@ P0-L |1R t1 0hA00XQ 00D!S SS@ 0S SSQ00 R R 0 -R R0Q @a0AS@W6V68W60W6V6V6V6V6V6V6V6V6V6V6V6V6V6V6(W6X 0Q00@ @ + DSBO8Doqjj@ -LMe(P@ԃ, K00K9̓0嬧,`.VǟP@fwǟ$F@`xǟx 0E`Pd尃D0 T0b#6`P0X7 @T:00C)0ܵ`0*V0c140 ! I@9#9S &@0^:6BAD@L*t庵0 1`0b*V0PX} I$ITyƟ0 C\ fs:00C *0嚵0 C\Ub:0ܥ0C05 *㈵ş 0B10a\0tJ:0 0C0t5*q`ş0 0B1\<0a03:0 0C05*Zş 0B1\0a0:0 0C04*Cğx 0B1\0a0:0 0C0l4*,Xğ 0B10a^0:$4L*#NSA EG2T PC  =Z @C0pßS@ ^㘣N@PƠ`@&l0@  0e@Ÿ: @: @: @": @4 9@hB{o  @P: TL2 $\2 0<pŸ0>0>0 a"&2 !A   t1!1XL4T  X!X1X T1T!P1 YI  !0 )4 " 1 00 :0 @|0 (KЂ΂ʂ@j4@qq qjqqX@ĜqqqԜqqqqȜqqqqB?pq_1"q ĒqI>kВqUUUUqGo 5k5khJ= kq8Do@@@ -0L @R  @;0  "!  囁噁h咁b@$h %<B? S7 <B? S<@}0J>@@@؂@,@(@8@P@t@\@ -LM80,$ Q0 范@@ p-40P@L qT4`  0 p0DS 3S@p 096098078:<9 0 \1PX!X ~;0S=0<8?<> 01@P&BQ  @P ph] 0phTR60 @ HExAp>h;60,X6 L260,꤃@`z@@@@@`@̄@ԃ@@0@@@@,@<@@ -0L0S S S@ 0TLH @D/KP 41Cc:踀o@ 0-40L0p0CS Pࠃ @^   00060 ^k6k6k64l6pl6l6l6 m6k6(k6(k6k6k6k6$0( R0@(0 @@@@X0SC @0A P$RFD1R;B0CS0h@0A $R2 1R:BSV@@ A04R SV@@ *@0A $R@@@ A04)8n6`@ -L Mp0`$ K@$0 %9  lR0000 0  0R00|Q P P 0S0SP00000PP P 8P0C8 8S P0 H8S8$ R P000 0 0$ RKo6h@ -LM@80S ,0 H0S h8p@ -L,Mp00PK@` 0 pP KH@K$ 0$^>o6 0- Px@Lr0hq -LPpX  `Ts@P @G0 ` P 0xpq' -L4M0 8PK( @`p $KXK  0@p P @P    a,@Tf]>o6 -LpP`@P P 000 00 P$00Cp0Pu -LPp`@P P 00 00 P$`@0V01#Z 0 pzPM -LPp`o@P P 00 00 P$`V010# 0 pSP& 0-PLM@P P D0U<00 0 P07P 00u' 0-2P LP+@P P 00000 0 P0P0 -LMP `pP0 @P P 8 00 0 pP' 0-LM@PP@ 0$ :q  t  p  l$  h@8 0-PL@P P 00$0 P0 P0' - L@P  yh^|@-  6 -PLu@@zpp\`qT W 0m  < q -PLpu@@x``Lp T V i7  q -LMp`H@PqP  `@P 0QKqH6 p-LM`P@@hqP  P@ 0@QKpq6 -L Mx@T K\ 0T|@@r@r8 4 0@rKhrXn@q@q -RL(M000 `  L0 \spP  PP D# 000 p$0@T08 <0$@ Y0H D0  08 <040Hs>0"0H@Qt0@uL  R  pspPm  PPe 42 0a0  p$0 @ @ @}P OP\s0@,0  Y0 040  8 0<0 P 0 8 <040P r 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  r@0s PH K `P`(KY0P`0P`rP`rP`r N6_> -L M0S` Rp 0@ 0SZ" S <00SO >0"0Q] 0+PP7 04SP1Z00 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0PPP"GP0 SP R00 0S 0 480 00S 0 480@P6_> N -LPp`P@P P 000$ 0"U0 P$  05P -LpP`,@P P 0000$P `審 %%%Ġ_0 P0pP -LM0*S$ SD AS S08 <04@  (0, $  S (S S |x08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040ꬅ@ -0LS@`LtPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0p700, R00 R 0( Pp0 00 0 000000C2Cp pP 0$0  `P j` -0LSPpF 0SpB`P p=  |00 P600;000p PpP0:0 00 @ @[@F Z ,0S6T6666t6,60[0 R 06 P Op pP p 0$00[0( $00b $0[ |u Y 4((0[0 Y 4( 0[00[0 mpP p@@ 0-Ld\P P1\ H1\0 Q@ 0- LP|@ 0\ 0| 0\004PP 0S0SP40044\040 R00R@-@  R R R R R\000QA S S S S SL\00\ R*R Q 00\  R\R R R 0B_S Ĕ\00 "#0  0@801000  0  0  @00000C0S0Q -P@L ` vPp@ 0@`p0P  -LM #o A`  0+pP 0pn(K  o, , 0pP , n@ 0DP 㫮L ⧮,0 @⡮ 0x\j -LM nA`  0pP V n(K0 $Pn  0pP8@0dS,K 6a)[0` S @/+0[0 A RY, [4 00 < 8 YUYp00P P P 4 <0AQ8 0xX 7np\j p-LMx@PT x $cn>0 0`Q" 0$ eP 0ă \ #\ @ 0S@ S Q PT $xhmUP 6_>\j -LM0R pO , 4 P`,  VP- 0`S0S+8 ⵛP "4 ⬛P0 0  ⣛84000P 0R ,P ,(K Q-L[sP@ -LM< 0p,0 @P= 8`P XßX ^`KD PK=@KL \  0 P@.s2 s )s"20 sx@T \ 0SY 0CS1|6l66P6Px20  P Xv666 666Ĝ6̜6Ԝ6ܜ66666666666666666666666rx 02 0SP U0S rx 0PS@ QQ 0A_S3|rx P0@S0, 0RF(K>0@!08r0s,s0SPrx0P @Rrx rx rx rx ĠGE꼠C긠A괠?갠=ꬠ;ꨠ9ꤠ7ꠠ5꜠3꘠1ꔠ/XsK@Do`z@h@x@@@@@@@m@@6_>@`@@@@@@l??@@@@@@@,@@@@@@@$_> Q-L@Er@ -LMp`P`& PP` 0j@00@0@H4| (0|`庠p000 0S P W``(K0S 2W02 : l@P 3  <` : 3:9lV W`2 {000 Q <0 @R xRy R   0w03WP@80  2  xQ xP Q R 0S ! 0,K >0"0Q_C 202202  202,04@KS!2$022003 S2ձ02ű0 4P jOpPX 80S 2 7?1 -Y 1Oa2 `  X1 -E]`Rr0Sn$ P 1!\2:2B2<2  P 0S:kP 000   뼠 :wkx'qxP8 X60 ReLP`< : 8P` Xk6\j@_>6_>P66d6d6?@-Q@0 2^2S00? 0R@ -LQp`0P/2\,2 S00?& 0R#@P 2`,L`P2 00 0SxPK`;A -PQL`0p2U2S 0S @ KP 0@ PP 0S  -0`L2SpP P@ "PP@PR -L M P`0p[P  P 2 L 0S@ 0S CP@(K>0 !0QjP 0 0P)08 <041S,0  p @,0@S 0pS Z   Pj Kj6_>\j' p-0PL2`S@2@Sp0Q 0Qq0s q0sK r  r 0Z Q 0-LP@ᤳ0h4 0-L@hP T,P T0J0J0 -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 05o03S0 @00h&o040T"P Hoxh4o00$Po0UP(0 0-PLN@P P  00}.A0 P0=P0 -LpP`4@P P P 00 00G0P0p`0000P N -Lp`P @  0L 0'̠''D;0(T @0pP@@  p-L`P@P P  0, 0f0C P0`Pp@  -pL@` hPP p @P p  0 0_0C$p P0  $0#$ 0 pW 4Mh 0$ R p80u -L@` rhPP p# @P p" 0$000 R0 P0  $0#$ 0 |pOW 0 $ BQ ph0u -pL@` 7hPP p Z@P p  0| 0_0C$p P0  03 0$ "4 0?pW g+ȟ0u -L@` hPP p# %@P p 0$0p00 R0 P0  $!40 00 pW00  g0u -@Lp gP @2 PP @) p$00 0` S$8666x6س666L66X66 6[ 0  00$;0@T0#30^g@@\0 @00 30 0  BA0$@:0@wT00 [0 0030 0 $+ @bT [0 0030 0 $+ w@JT  @\0 @00 30 0  B0$@:0Y@,T0000[00 0""Ġ " 030 0 $+ 9@ Tr03 0 "#  0 #200弞b[0 0030 0 $+ @TO000K[00 \0#?  0@= [0 00$ ;0@T-0#30 !  000  00\00    0$:0@ 0u -L@PT f`P e @P \ T0$0x10 R0 `0  $!40 00{XDP@hp10T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PTe0u0SX6\6`6d6h6p -Lp P`C@P P l 00 P$`Ɲ C0W0000&4 0`#P p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K ep PP% T%J 0S0a0a010 @ B Q0B RJ 0 @PXeP0D@T ;J 0-0@0@PK@2L  0 0 S:;;S @0S 0@0@00cS -LMPp@`$@ SeP   $0K `@@@@kP $Q 00  00  d K -L MP $ 2pL@1!e`P @+ (K $0K@@@ p8@P$ R@ 00$000$ 0S (0S T0 @d K0 O@ N -L,M@`,@ pdPP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 _@Pd(K@Id(0 @=d N -L M@`,@ pidPP @( 0K ,0K@@@ p@P,0S@ ,0 ,   ,0 0 R T0 @d(K0 @ N -`LepPޛ d0( 008,d 0U40" O P G 00 <A,0 '7<I c@ P0 0bQ 00  0  1R0cc'88# ,408 0i[  00,@?WEV6<@ 0-DL!88#P!XI@P 0 <( 40bS<0 000hrD0tj -LM  05 66 -LM) 0( 66 p- 0, LP,@p` RX6p6x6x66d6p6x6x6 60S0C00 <+0400 @0 ()a0Me#@"phDp0000Cs0 phB<00 ()a0M*0E<0ph>040( <@ P4(0<@0 -LM p,0@L2K 0,0 PB `(PD@$0;@B@ <0E@ᠡ20  Pi1 0V* (  $$$Ġ% P@ V :;0 0 H00 0< 0$ t00p8M0 ! <0o82 46S0S V 000$$0P@0,TPo0u6 p-DL!88#P!H`P 0@ 04000< ;00@ "@L!V phSC0"040 Gp Mph@Cpu"@,!tj 8 8-#TL%`H@P 0@ %C0pL VHPU LC.%0" "2 E=  2<2tj Q- L Q 0@000S A  - 88LM#DP$:H`P 0@ Bp0 OLpP@0T X,@ @@S 2Tp 0, GpP202Q ,LB2T0-.2 Pp W T .2 02 .pP2T02P 2p02 .ip0 \tj 0-PL@dL 0L06 p-`@`0 S00Ɓ0,( L0LP%2  0\ 0Q000@@f4 "E (n;00X0phLܪ66_>0@6t6 -LMK 0  KXb> -P L d M@, &mGpP 0@ A@$K 9T ,9Tz K0CT 0CT 9T 0S@: A9T '|9T Xd9T :c6T/ `2`0FSPC_@'H6T:6x6T3 p6T3/ @ @Q QU @@P @_P ` 0@@P&0"  04"400S@  ᝗_@T @ _P @@0@@P0"  <(4"4!<0 2  04"400 S0S00o_u@P 0@ @g@`0F,S0_ 0P`@P 0 $ R ! @09_q4@me/%@g <@b 7@] v@W 3T D3TM@PL@ 0@/@? Q0@82T 0T.  0@( 0 @t20S @ 0PI@P 8M@rI (2T 1T 4@ 0@1T 1T@@ 0@P00S 0"  04"40  BR !]@^ 0p@00 0S!Q0RPZ!  00002  <4("4!<0^LZtjc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA@-0Q0 ""D0@ 0p@-0Q""H"T *(,d @P` pA-0Q#l#x# 0""H"T 0@P `p0G-,MLQ.#L$@( #H#@@. 0@@ "$"h"DL h`@ ##x#T0. 0 @0 @0,ЍR \ \ 0L_S BR00 0-PL2  0@P  5000 +0C0 P0 000h꠆ -LM@PP<0 r,8 8#)"Re0!R8 ` `( RP@ Z ?0 20 Q, Y4 9p00 B F@0@P4`0@P/` R.+ Y#8 `P+ ,0@ 0ʌP P@@<@$ P 0@@`T 8 00(KQ \nj' p-LM@`  F]PP @  0`N@\x p-LMP  `@,]@P P @ 0P4PP @\x 04<S-P08 <041 (0, $! -LMP  \P=  0@P`P 0t\Z   \P& 0 @P`P  \0S`W S Q 0S QP-` ` 0-L@PP 0qP0hQ -L M0   ,0 L\P * pP  <`K?@ a0 P<0K0 K2 K1 K;@K/PK 2p1@0$P @ h@\ @ +\@ , 0 RA(K 0@,Hp`0@ PD`p0@ P #D p<P`0@!(p#L4P `  0 8 <040 #000000:@Do Nb> -L M0  pL \`P  0PP  *@K 㸓%0*0K 峛 000 $ 0 `X [ K08 <04@0 @0@ 0(,0 $00 N 0-0L> h0 @\PP 0P0S0S0h0h6_> -L0M0P<0 ,0 00 40 80 pPE0E[P P`p' @@K P 80K @@@PP @0S 0S 202" ` 0SYP`p '[@ 0 0S<0S< 0 S  S  S (KP000C[P P`p S  S  SR0D#P<3 0 0 0_P0@00 W00V ? U0 P0S<00S S_ 20"S *((0 "4#220$ 00 T 00, 0R(K$ ㊇7@Do@@WEV6p@b> -L M0,0 `[p-@ (K 0P@/YP @D D@ 0K ,0K @PPPC@P,\@  1X ! 0X  X^% ^00000S, , 00000000S 0` 0 @08 0 F@0Q\jvdud@ N p-LM@P $X`တD @L \ $ 0P  $mXx  奆$dXx@ -P L D$`(>pP 0@ c9@  2V -2Vh <2Vm 0Vp R @H92V 2V 2V @ @ 0@P2V H2VR42V8 2V_ 2V0"0 @1VW 1V e/@1V! :10S @0 B@P  AF@Pt1V@ wB  @0S<@2 e7@ 00e/㮏@~ 0"@w Q@p 0 P@i @d4,0H @jrdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gd6 -LM  0W66 -LM) 0J66 p- 0, LP,@p` R6666h6666660SH0C040<S04000@;000 ()a0A@<phdp04000Cs0 phc<00 ()a0AK0C00ph3040( <@ P4(0<@0p00 -LM p,`0@a2a , P0 V 0 0D(040 P @0@<0 8@ 40@$0<@K0@0P4< 0L ᦕ20  YC 0@Q Z  0 U0$!:0 0 0H0 000< l1$ t00@0@p@AA0 00 000. (K (Ko< ;0 00H0 0< 0$ t00pA2 0@Q  R0S0  ,KP I(Koz R 8#8 S  0 ,0  `6 p-DL!88#P!<`P 0@ 04000< ;00@ w@.V ph5702004040p;p I*ph7S@ j 8 8-#DL$`t<PP 0@ 70p@ 4<@T0 !22 022  C1Ij@6  2<2.j - 88@#tLMP'(<`P 0䀖@ 6P 2 6 P0 5@PP p0W Z,p ppS 2WP , 0;PQ0"22 02 @60" W-.r202.PP W2"02P 2P02.p.l0 Pj - 8 8LM#T%;Pp 0@ p 36 P0" 0" p\  * 0 P 20 Rp(PT00` @u(  0 *, 6P,j 0-P@L(?Q0'@0<6j -LM`2`x2t"0 S2p<24XS2֡(92ơ ^,p 0,"0Q000IO]Z" C.0" X 2P -P@C 2;T@`l@0 00 d0`-Z0@G8'ZL(@Kf c VP(0S!  0P' 0@ K } @ r O0 t(0 )\X 0wPDY<Y@\j66_>0@(6t6@ud@j6vd@@ -LMK 0 Kb> p-2 1C`L P hR0000 0  000 @Tphꄡqp p-P@ `L0S R0000 0  wph 0@p-LP`S7770707<7<7\PZ@ %P 28 1C0P `0p@@@@q 0-0@LP 0 9PPU@0脡q Q-L@   6Y 3Y,@8@ Q-L 'Yx? 0-0L00@HPY@ 60S  00h| 0@7 -0LRp3 p-LM @0Ps ,`K 400 ,0 02K0@ $0 0 P 07Kp?7 -LM ("(\`0 ,      0  P(K0S$, @ @DptG T,0Y+ 0S= T  PPp@DtGP0 PPp@ @T :  PPp  0SQ0 PPW  PPp0 PP -LMK@ K0K!(0K@ @rK -LMȠ@ K,(00K @@`K -LMȠ@ 0,(0@OK, 0S  R0q p-0LM K [PQPRPU`0@l0K  0KP PP01K0![04"48#Kpq`ndn 0-0LMK [@Q@R@TpP0\0 0KK @P00K0[K0q`ndn -L$M4@P`@PXT d0`8T#V00PV00S (KmPjUpa@^@HTz IV3pPWZY00 Z8 ,0 pGC@@@HTq J8|3pP,, W, RZ 0R0ZY40 000 S@ L <   0 80S <Q 4 Rg L0SW000Z 0 g PJ4XJ PJ pW|L R @ @ pWo W h@@HTz@@HTpp@@HT@@HTyy0H P8 D  P 1001@P+ P &80@!0<4 0! R R R`ĐP`P} D H wD00D0 Vq@0n @ pW h WX a 0@PZPB X@P@H@ 0-$P@LP 0z0en -L@ 0P`@ PP-L +P)PpP`@P PP@Vp TWUNPLP @PU@T 0MPp@h@ -鼏0L>@0IPP HaP P% P `NAP GP #P` AP Pg HP }U JxPl -Ux .U ,0E@Tl9i* (0ES-0ES-U| TTxpW ~0S V9 P a#P AP.U,U`` /U ,0E@TJ.Uf =;'P =7'P VLU" .U* =-3P =)4P- T|0,S 0Pn .UM V/U?P}@dmy wUP \Ps,0ESp?iP4ml ?`P mf ?P m` ?PZlYPV,0ES|0,SPHPL?P ?PD@l@ >?P:GP6@`l2 0JUHU KU0MP MP MP$GPl#LU MU&P"?PkUPN P: MP0E)US+U*UKP L0ESH0ES+PkO|\P/ OxPU@tNpJ kOjP<f Xb1P V E[yPWQPS\P OP@KkEAP*@A@PTj :P 6@ 2.{Pl@*P@%\P !P@kHW 0(S% HP  )`P00NPP@PV@\PTiN`P@PV@\P i@~NpPu$@P @sOP OPzF@vX1Pphx j8P x8P( MP  TP  TP TPX (8Pj 8Po 8Pz 7P! 7P| P;7P6OPg15;P/@`+@|T$ x@uT!q@nT"j@gTcPg H0ESZPVR Pf00LUIP@EA=951-)(fLU"?PfLUU MUm LU!P@* PeL0EpW0E)US@@+U*U T+U*U0Pa Wc?_ Pe00XPv]PrE4Pn&PjXPderPd@P P\PXTPL8dQ F,0ES ?iP| ?lP"Pc?Pc.U,U /U?P@c HzP@v|0,Stc?m P hAdB`,c |0,S?W P'SpIOPb@H MULU NUMULUD NUPA7`P ?3jP|b=-pPlbMULU7 NU5 9X!1Py F!P4b v0@SabP ?jPaxV@ \Pa @@XPaH E10 Sa'YP +ZV P0La0VN)> P> @%L10Saz   10S`o 00 S 00S`a q @$@@$@,@@P@p@@@$@@\@h@@1J )@@@@@@@@@@@@@@H@@`@@,@X@t@8@@@@@@@@@P@@@@h@@@,@@@@@@@@@|@@@@@8@@@@x@@@L@T@@@@@@8@@@@@H@ ! P! @ ` K?UGP0a0M P @P(a4A@T-P }/Phawt10 S~qoPayk10 S|ePav? sP ?rP ?hPan ?`P ?bPbd`=vP,b[HPPHP5@Ptb [Pb =uPb=PH?DPb?AP P 1P* P,c& 4P!1@* Ppc@Pc-@?P0c0=vbP@#@rPd; lPd=fP0d [`QP]N@\PXX PddS=R0P =N1P&J" FpBp>pd ?8 P ?3P @.e V@(<$P(e6G@P~ zPv@le| p= fP'@Peq=hP)@pPef Pe`>@/P+fb %*% P!4fT rP@f 3@PLf| qPmXfx?P@|f/ /@l phpf! b yAuBf ofO0P@fKzPgH P9 gD\@B g>\@j 4g8 0,0/dn`nen -772P-- -L|M0pH0 @2D@ `{~G@` pG< "8 D`H0@4 C<`N8`ᒦ1!oHafAL 僁!P \ 儁!Qd 偀 ጀ ` 兀 ጡp 匀L X 兡t 僠ᔠ 匀 唀P 匠 \ X厐`d 0h t p0 x 倀H0 匀 hD0 0hT0 <@0ijh800hl0 x40  0h|0 0 pcT 2l|@PBRb0 0 P @`0K/0K.K,K-@K+PK*`K4 (0K`(00K`c"(P@ P @P 000RN(K00gfff̔@ -L!H L P 4 L P 8 @P < H@@D LPp PP` 0 00 @ p-LM00 KP@4 `0K(0c K"(@P @P 00 MKp00@ p-xLP@M0`00 X04 @0P P0D H0H H08L 8@P`  ph$@`1717*7*7q 0-LMP@KdPK0 p-LM@ PK ` P@ 0 Kp -LM@0K 0K @dK 0-L@KM000dP0  `0K v0K 08 -LM@0K 0K @2K -LM00p娡P`%K @ 0PQx0p1x RL47(47(47(47373737370x0`VDP00& K0P,% [R- R&0[-&0[S*0@d0h@%[ $!B30b 03dh% [31C03Od0h@% [31C03Od0h@x00x0&0[S Ӆdh4j0G` p-LM0P00 #\ K0b`P6[  !sL 0 600@ &tl@ <t08A@@|aaH22 P@o 38@!TLBLx\@>L00x3LxX@l@270@@p@ -L wtp3@ -QLM0P@)0KQ0)0K)4 `()K0"(*Kp 0@` p/P &2*[0 Œ4 0("( 0*K`` p00(K Q0 0)0K)0K p-LM00P`V000K0K4 (0K"(@0K @00[0PKp -LM0@`SP  K0 `K0 P0f"pK0P P P0 0!Kp PPP -LM0`004@P%K&KU0L00C0HP%0K%0K4 (0"( p 0 pP P&0[US20T0@808 <040@ D08`(JK00$K\77`67\67@ 0- PL @vP0xc> 0- PL0@k(0( 0$0 0P 00xc>x;7;7t;7;7;7 0- PL0@R(0( 0$0 0P 00xc>;7H<7;7;7;70  0-LM@TP(Q*0R840D d00 8 -LK@ -LK@ -LK(@ -LKP@ 0-N@0@@P@@eL7H0 0h1qTj -LM`\DVA*0Q`= 0`0 . ~N0@pdnPP + :#: 0T0!*`JWZ V$ K(0Kd/P(X 0L000S <0JHWZ KTjqqВq p-LP`P pN@@N^P@@e±0 ph辮Tj -LMp@ۭP;>00>N0 @`dPP * 0d 0V0! pjVJZ  ㉫W$ K(0K|ĬP(p 0L000S T0HjVJZ0剶 K 00b 00TjqqВq -@L pP,` , ,<0?c `p0p x3l0L#H3d d0T#P3\ \0\#X3T T0d#`3L L0l#h3D D0@p3t#<5555555455X5555 -4L\MT04@0c?0<@ \4<D P0\4@< L0\4< H0\d04@0c?0<P \4< \0\4@< X0\t04@0c?0<T \4<X p0\4@< l0\4<$ h0\04@0c?0< \4< 0\4@< |0\4< x0\4@< 2\4<\ 0\4@<` 0\4<d 0\4@<h 0\4<l 0\4@0< \40< ,4Q? <0 \U? 0  p l0|"0!20 2"p1p!2"h1h! 2$"`1`!(2,"X1X!024"P1P!t82<"D1D!@2D" (1`V pϏ@K048  0@` < 8 0@ ,P 4 x' `V40 <,|`KLP T<$D@z| o d 0x t pp l` T@ X R'(Kq5555555455X5555,d>?7 qx@808 040 0, ,0 0$ $00 G7E7E7E7E7F7F7 R!800P500\!400 -LMP@ p 0`40< , P0 S 000P 0# Հ%$    0-LM(0K@P K00P  "!4 (0<\40< K9P 0!!40< ,40< \00 -LMp,0K`P0@  "!4<,0 \4P0< \@0  "!K 0S00j0@-tQt@QU 0R PQPI R0ĠC00P0 R 04! 00 Q0@ TP 0R 000R000R000R0 00 RT0 , !160 !!0qqqܢq06@0 - -L@@00S0  "!q -0L  "!d0@S s0 S #0 000 R㼓ʀ0  "!᠓ 060  "! 0!!"0!!  !@160 !!0 R "0 000 Rؒʀ0  "!ἒ 060  "! 0!!0!!  !@160 !!0 R " 000 RO 0!!0!!  !@160 !!0 lQ d! 000 RP7 0!!0!!  !@160 !! 1 6 0 !!0  "!ᘐ 060  "!0  "!T 060  "! 0!!jܢqqqq0!!H H160  !! 0 1ܢqqqq -0L@ܢq-0  "!H0C  0  ! 0!ꔥqܢqq -0L@  "! R"10L 000 0 4 R0 0!!q - PL@`p.8 VPP& 2! 0W` `4p@  '1  0@!! B 0@0 PP0  "!NFq@P-0P !!,160 !!ܢqq -鐑Lp?o`s>J"1d!Z0 !!@160 !! 0 !PU PP 0@  PU0!! & ?o`sZ|0  , !T 160 !$ 00, 1oܢqqqpqq -X0LM RK@Ki000S  P Djq@ p-(1LMP@`;Q0S4  KP 0 &S  R0 @ 0 ,DKp Q  (K31C01( $0 BV | 0d#@Ph0 T`0 XB(`PD @ 0 <|D8@`0wD>qt@E.P@H@X@@> @ 0-L@ `0P}?0d0D!s "Q 0 b 0h>꘥qqq(1@- @Ơ3 1C 0!02@$!Bb  @130` 0Na3QM0 RT d00 R00C0 R@TЍ&60cQ*d00 R00C0 R00C0 RYѭhq -0L6f 0bSQ0@l  0bSp0 VZP帀wk00C 0@ c0 ` 0 VJ0L0cR01 S 0 S$0`` 06 06$0`蜥qhnqqqnqq -1L Mq1d 㬡 1\0. 0`K P'0  "!0P00@T V 00T 0!eÁ0`S0c!S0 0!!0@0| . . 0  0 06 &06&0C68 l0@ 0@/T0 (KIoqIoq MbqB@jhnn@jW7qqjq06 &0C6 B&0600 0 S  -@LP  -@LP 00 p-LM@PB400  `P  xhB`pN0@0h04 0\040 \0@ 4h0\xh@@@ -00 LR 0jp3 p-0LM| @0x0D L0p p0P T0h h0@`(PKX \0H`<t@<@00 ( $@ Z!Kp_7_7\]7 ]78_7^7<^7D@(7 -Lh0040 \d -Lh0040 \d -L`{dPPU 004 ,@ 0;P0 410*0`PRhA0S 0P  ?0 :K 0$$L04 P T0*4\@dplpt`0 H`X``h`|`x``` $3 d0l "3*pt`0 L`H`P`T`\X```LADA<A4@,@qq@qXj@8@`@@@ -40LQ 0Mhp3q 0- @LP P 0  4     4P@0 -RL M@0 , 40 OPDpp W? 0  P0("(R R ! ` % `Z0  Ph0 P` P  ,4000S(KV 0 p-LM@ `$0KP K0 0K$% P$0 K?Kp@ -L(M` @0  P (0340 5|*0P<0 QWÙ0 ,0 10 40PUO 0@   00 cp08 #0R00 <0 cp, WÙ ,K80  p@ 0<00<0 80\  ,0p>0 40PU< \|30|30 <0\>(K8#8@ 0P 4 ~ 8>|30|3 4 u j0@(@@P@L@T@@ p-<0`LP@ ,0 phF j4o7 p-<0`LP@ 0 ph1 j\m7 p-<0`LP@ 0 ph jHn7 -L@ `TpP  R T 0Q+P `0  0 8#8ST *> j\@ -L@ `TpP  R T  0+P `0  0 8#8ST= j\@ -LM`PV@p  0SPV0Q: 0L0S:1  =0S $K0 @+PP`0 0 0P  0H=0 ,= = jp@@@@ -L M3#@P `D0@@@ +#0 @@@+q08O0 0 0&30S 0S30S 0S00|3 x0n\0 K|PKh/=DD,=|,(=,$$=@@ jm7l7`l7@@@@ 0 000$00 ( ,0r7r7s7r7@ 0] -@0L  <n@ -LM Pp 0 4<H`, L,0K T0(0K$ K$D@$0S 0H< L@($@< KPP ( @ @P 0S L0S 0H<   00H< @ĥq -0L`PVp# 0S @1@S 0   08P `V\p<0P @T 8e<4 0$T0 0 j4@ĥq@`jj -\0LM 0 K00   00 0 0 s00 0 0 Kjv7 -@L0<q ,<x@@00  -$ L@< hȥq0@u7 -40LQ 0Zdp3ȥq0  -L<@ -L<@ p-LP`ᲟP pN@@N^P@@e`0 ph\Tj -LMp@yP:>00nN0`@dࡢPP * 0d 0V0!pJVZ (W$ K(0K|cP(p 0L000S T0JHVZ0( K 00b 00TjqqВq00s0j p-LM@4P 0 0   P Txh_;>(< q0@ 0@ R-T % 0>0>@>00>00 > 0><01H q !N PPP 489m S/qx@ - !L80PdqV 0 @)04zh 0-$1LS@ڼP$1 0C$1@#h$1SmP0 -LCM⤁1 a$ @0!0P$1KR7h77$77 7>@@3SD7<00 @)a0=$10$1$ 0R: KQ  IOK   p-DP!88#L!Z`P040 (304000< ;00@ @ΆmV ph\p 0<(pP040>@3Qphp@ᧆFj 0-@LP E(\QR00蔁7j Q-L@ Q 18 C"P >" 1840J/g'B -LlM08JO$1 x x ( _ 0 40 !0 03 =PWωQK0 R0 S 00 0C(P R00|6 $ y1`S00x 6u? @3 ( (( @(H@ 3.@H_,C0S%0P6sO0@tPK[ sb h0 8#8 Ϡt Kh 6K#P xx6xLѸ\X" 0P\ D % 000Q( 0Rx$K2P0C0C0`0 0h `@PpHP`#H8P `,S0c0%sO`P60@tPK tPK h,0  Ƞ,Ƞt0KU ?n Kh0 K_#P x560   mh 0  Ƞ,Ƞt0K ?n Kh0 KF#Px x6tx60 0 _,C0S%@ P6Tx\5xT@DoB@@D@@j{7ԅ7$@@@@.*`@@|d> -LP`0>@>0>400( ^01< q P P 1Sȑ77T7`7l7S , 0R7(K3616-641 (010AS0!0cS01 $<S0!,@P`< 0,1KKOK  <x(5t&5h"5`5X5H700j@Dojjj$@8@@@0@|@@`@d>8 00000S0C00000 000 0003 4 0  <040 0 @00 p-L `@PK 0 000 0 B4 p8ph p-0L @` P 0(0000 8 phK -L$M# 200l1 0(K@,0 0PLŸR00 y00! (Ÿ0 200 c 20008 < 00i10 > A00H 3@E 8^B4@ 0  @@Sd2@ ,0P 00 00! (\ 40S 0  01<8@00i10 0 >@0400:@e313 0004 \XPH}<,(ȯР7@ @@@@@,@@@@ -LMp 200l>@ TP 04 @`=Up20 sP( 00  Z0@6 0T R P0000r P 0 F1000U@ 0@010@000h$KP 0  00 001000R000I0$ P` 0 0@  0@$ 000$ bQڰ0?\{P000  0 @01ȯT@@@@8@d@ 0- L0P@Kb0hȯ p-PL@8`P+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 400ppģ7Р77 -LMP \`Qp @p @T V4 0`D @0XT(  0jj`z@Ե?(z@@ - 0L00S@ 00S00 00S[0 0  -L M<`Kp@ Pcb0<0K0 60K@?4 K7@KSK00 5 K;P3[ K -L M@pK0@ `?b0  @ 09 K!@0K080K4  y*PP 0l3K0P ,` P@ ,* K ^0@0K18 K40 9 K3[} * b09 S" 6 04"40(Q(A 04"40Q. 04"40P)3(( SS) 'NEFX -LP@p$A@`  0S v=o@ -0LSpP@(`0\ 06`P M0 S0%Ll2@l D00# T@ X0`00S00P0X0S0dQ S@@ @`@#`@ -@ LP 0 0 - 0LS@ 00 0  000000 00sS 0S  p-0@` PL0 P `pnn0   nnQ - Ll0p0X00 SX0S -0@L0X@ -@0L R 000S 0S  0nnn -,L\ \ nn 0- 0 @@ @ @ @RLP t0S pl  0t@0R Q 0 0# 0@00 SQ 0 0  00 0 0 00 S  (-"H 8TL`P#x. 0T% 0CT 0S :h 0@Sh0 0 : Sp0Tx0S \0 R00h 9h :{ 0j -LM`0 Q Pk U Rd0Ra0 0@ QP  00KPPP0; S Q Q Q K 0<0 0PUQ W \P\ 0l@L00Tq@P ;; S" 0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q108#XQ0 *@K VO ;q0 9a0 0[0 0U0 0O0 0I0 0C0 0=0 @070 010 <+  0pC p>0Sa00 RLPhWD0W@ ;g80Q= 0Q1<  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4 0 KpnnjnnPH 0P 0Q \0SX0S  4j-00 Ƞ Ƞ,1XP 4j -LD M\`@ %(4\ :40S P 4\# 43\i B3\ 3\ 0p0  0lP K3\ 3\ 3\ t3\@< S0< S< 0S@hP43\= 3\ 0\s 3\0SJP2\ 0\x 2\2\ 2\M 2\|0P       00  0P0 0       0 00p 00lP!0p g :`PPB ,q0P0m 0R 1  `P`PP8Z0P     00 M   0P0  Bp0| 0|PP{ 2  eh Hh0(K 0 (0 $@ PP3 W W WW @W W@WWW@ W @ljW WW\j -LM\ 0\ 0\ XP, 0 P0\ 0p XQ 00S00XP 0 r 04 Q}f~fvt|f 0-LMP@@0@0CS08B8@- @.@4j -h0L Ƞ Ƞ,A0S 0400=00CS04j 0-0 (("ALXPU 0 X0 q\0S 0 0 P P *4j@ Q-Ly*@ - (L(" PP#0AT PP 0SP \0S X`VP 4p90H0PP X`#P4j p-X@LT` 0 ! PaU  2`PO80S0Sp0 ph, ph*00|0S @ p-\0LSPx0SH1  X@T% 0S" 0`0CS0000 R0080S/0S&0 31C P0Q!ژ 0 S00 S P0 ̗pP)0 00nB<@j$j 7D@ -l1` 00x 0P SpLpW90)0S3 1h0h0 P hl 0 p0 0 Bt 0 @P/h0 |0@00 Ri)WP lh[) $h00 hI000PK)$.*xjd@n\jlj0@@n@l@0Q 0`c 4S @08#<@8oS: S>; SP 00Sd> -L@Q 777477000000<000000000000000000 -<00000@ L  pW`V 0S \ R P0 U*\ 00aWbWvt}fW`WcW@- @.@j  - L@pPP 0S \0SX`V 4@!0H0H 88 #Q 01S 00="Rj p-<2LS 00pdBP `0S ph000 0@@0D 0R0!R00 10<P j Q-L @ 0-0LS@0g0PS 0  0S0h@ 0-0L@0M0PS * R% 000 00S0  S 00S0 0h R <0 R 0  0 q̥qإq 0-L@P0h -00 ="@0L80 S @0S 4 0 8L0dP 0 0d2 p-L@PP p0`   R h05 :R`0 0P0R Hph%80  @@0 إq̥qqqq0QD@2L p-QL@` Q Pp008Pp00V= L0S XP P P@X0PP@Pp 00 p-LM0@=2S @2+ `2S0 R8L|Kp KPl 0h 0`Q8 P`=iB0PEB mBT31C 0/L#b1 Rbm 080T 0 @2 `2S E0 @20@2 0S0C0ԥqMb -LMŸPŸ @,P .`0 =rW@ 2QP 2Q1 5Q @Ÿ, 0R(Kt2Qό@ 0B~S1 0< R 42(2 q$b rKr 00OK8008q1S@ 0B~S1 0 (0- @L )h&qq p-LM`P@T @T' Q0000 00001P 00S0@T~ P0  q̥q@ p-L`P@T @T' R0000 0 0000P 00S0@TCᮻ? P(@T0  `qqإq@ -HL@ @0奻P0 000垻P 7j@j7@@ @0@-D0P <<<@P880@P 0@Eq̥qqإq 7q -LMP@~0@DR00}/#`B1T0 0=2$KTKʸ봁p0`S0 <20<20 @20@210@X0\P`pd`00 Id0d2S: 4 0@ P(@T0S: 008 R 0 +0 <20C<200="Rh'00`"R 000008$KmuT 00=r0S d00=r00T 8004=r$KmtjD@X@0@ -LXeI\0I 0\0 R0X0R \0 S08 40 L0 T XK 0P y@P \\e QPX| \X0 AX0\0!m` d0XgWe@Ta "P@eUq3888@ -L M`QP I0S@)pK$0[S I0@S P K 30 -#0LMAD(0K0CP(K #@K'K&0K%K$K"K!K`@P  K p2 @P0 0pW@W  @ -#0LM`AD$0K0CP$K #K"0K@K!K `KKKpgP K @2 P0 0@TT -LM4 @P0 `e ク`PPs ,0 00-0 X3,  0 P0? @./12 00 `Q 0XS _ 0S[  R00 !  0 PP98pd@ 0pP5 2@[T0 1 00, K.@D 0pP 2@DTP@D1P0@, K}7 0pxPP  (KX! 90S%  PT0 ^0 0 S  Q 0 S & P?0@S@0?080S? B4100 PP0PP   P 0 1 0 <`P 0 0`"R 00d014 00PP ,@K  j>@@ -LMB4( @pT TD@ P-L 00 e>@n -LM0K0K⠠P.KBD/K -KNL`(pK0,PK+@K*K)KPP(0S @ 0DĠ)K*@KP(0 0$K -LBMPpQ@P` P(K!rJKI8 ,K 0P,0pVp?0@CVT JK 04("8  00X00S" ! 01 R101 01XQY QP@S G N60+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0  0S 0 4 \\T 01[O?H 0KhP!  -LCMXJOKP@D`K p0,P 0  !@ 5W@ p = p<0d 5@;E0:PD`d  Td 5@ d 5Pep  5@ d5` 08 , 0R(K@Do@$@4@<@@@e> p- L@` 㒬P ;p -`LPVp $@T-x Qq T qH V , q x?X@l@L@,@0@- @ 0 XPX ăP Q0 S $0R ^0 0(f>Xj>R R0J4J -00LT`V( 44j pW0P0@0 PR@ 0WPfԫ8PfЫ0Pf̫fɫ0 0T0 -00QLT X Zp`000 PU XP P @5X0@PpZ` -LMT p4 000 P 50 @0S0 0S ,4  0S'`T00 @B P P0  DPZ P T0S 4 ` 0S(K V 0S 0' L  M K mP> P 04  0 00  0`PP6 T0S  !0S00 0  ,  x 0S00, xo 0 l i 00 Pc 00 <] ~00 (W  @@@@`@@ -LLM`0`,0 P 0P,P8 0S;_0`KTpK`0K_K0 ]0KZKYK^K\K[KR@[0p03T0SbPT00TT 8PfX 0Pff㔪0T0, 0RR(K 4 4f 㴪P @f 㭪P 0\ 2TH0S 00S 0S X K8PXpP< 00S T 0B 0Q1 0CĠ YKZ0K) B<f cP8 <X 40 `P  y f qb00>0S Sf 6Pa T>p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  P u0 h= 0 R0@0/T 00@Dol@@@68@@@j> 58@@8@ -@Lf 0S 0 S Q0 pj0   @   ,D  -t0L \ |0x  -t0L \ |0x  0-t0L@\P 0x|  0 00h p-@0@0LQP`' Q 0CQ Q  t0V  ph0 000000p000ltmt 0- p0@0L0 S*$0S (S 0(090S PPt00S |xPl0< 20000 S0pjj -L~ 00s ^ 0 Q-L@& q " d@p@ -LM@@Q LDH04  DMP KB8 -L MP@l81 RR` 0S @ " KR @P (pK$K 0 t0\  0x| _p$00Cs$0 (0(0 p$ ,P  Ꜷj|@@ 0-LMR@P 0S 3t00t0K0@^$ R0K h0  c t @0t00t0 l0P 20hSH. 0KꜶj -LM`!p00Q@ R Kt0pa`V ?"H0S HP`.P t00t0d0P 0 t0\ 0Kx|` 00 X@T |@\`0  @ \_` TB \p`0 @ pjHD8 p-LMt0P`\ x| 0@  0 @!xxl0 20x蜶j -LMpPW@` (Kl `P 0\*`Pt0 \ 0x| 0 0 P`=(1@X1 1X1 0CX ``0X& ;1X`0X! 0X`00S `0`0``P00e`Ꜷj]t@yt \tzt  0-LMTQ@@i0@0CS088pj 0-p0LA0SP 0000l40  0P0CS0pjj 0-p0LA0SP 0000l40 0P0CS0pjj -0L @  0 hBTj 0-P@PL@P 4@@PXP -XXPDP 40S DP\P 40S 0\00\ -`@LPp XP @0@0CS0 W t0 0B)t0 #K0Q ڈ 0SP00S PU@ 0@t 0tW 00Pj$jPO8 0- 0LSP@ ][$ 0 (080 T 0<0 4 0L0 P 0d0 h ,0t00 x 0|0000 00 000h趦@0@@BPE8@8@ -@L00CS0h0 00$ - LQ@`pt0 l0  t0 0t0@ $t00S x|pjj -p L 8M   P, \0 0QU 0S@(0@,, 0R(KS `R0<q 8@0$P@ ឿw480l0< D L0p0P \ h0d\KP@` t00S x|@Ph00w@M`ot0pp @   \P  RC t0 00a W@$PQ0H<0 R< H@\  D0%< %0 0b 0l00l  3 05 0% # 0-1L."0  R@ 41020!0D0 1s s 0 P00S S Sd080 00SPD080<00@F00800jHjjj 0-@ K0) KP`& ['0[VTP t`00 P 8` -LMp@0%KPP T%0[T0@P P$K0, KPP&K, PP&0[S @D`,0 31"0 0 &[0@ Q   ,PP &0[S ,@D` 0 3à1"0  0&[,0@ Qp ,P -LMR4 pE ,0K ]@0HS=:0  0$0 80 @T D P `@@`U@1 K=@0D 0S@0<0Pd@0U`00080X00 0 441 00(K,0QD @T<0% d 0 H@H0%0 0? Z8 -RLM@ R R K0K < * 000 0 -LpPD`@00@ PT^ U3 P00CS0 ND3!C@T<wd0QX X0 S 00 S P0 xpDj$je8 -AML1MܡP( 0pfQP 20!0D0` 00S5 SP ( 0RU$K0nPI  0Q!Q, C BNK@D@D =PPBKNL0N @P PP PP p-h0L   QT@0 j0`0CS0pzpjD -IMLPM@T, pQp 20!00Co 0P P PpB H, 0R(K-p0S 0#0 0L0" "#3 0"0 00pS` p h R@0T0W0S T@#T@!PK 0( qpP pH@P-p 0"0 0L0" !#3g 0!0 00pS( H@p@`T@! DpPKHD0PH<%@H%PA  0R0W0S: P:D0@`T@!#PC P #P@ P H@0;P pg 0 SP1[#U# T JNK@DL0D @D @P pP4U D ԺA Ѻ#p=pPp Pp p-h0L   QT@0 0`0CS0pZpjD -1LM 2, 41 2#0pZ, 00 D0` P  00S S@&'<P f0<0Zp 040P@TP:U@j -L0M 0"  \ }0 QUy 3 RuD 4Q\P040X 3" 1 <  D00_ 0S\  < 0C?V 0SS 1"0<0X00 = D0p `L 00S2g8g8|g8f8XA  0D9 f ḟ8 <8 'p< hŸ@0@ @"P <fn8&(K0 JPXȐD0401L0X  0.P 0$, ,0!C@b@A@ f e@<@HD@ 0P/0 `Pp0P@4 . T@,P8#004!2 \0P  0 X@L@0 4 0 00`S<f00 0PQ0U 1Q "Q0PP0R@PJ5PU@DZ tjH[8 Z8 -LM0@P 50S QP 0S P1 R  @@- K P!K@PD`,^1!0[S4p!0[pS.0P( KsP("K_P"0[S(@ D0"[ 3à1"0  0(0@ ^PI@k> -L1 g2S p-P`L@ o@d0Pp -L` $Rp |R60h t44p0S* QG ^!1P!B00^u8u8lu8t8u8xp0S:0 $ (U **0DS;w8v8v8v8\v8 0U T񟗾x8x8x8x8x8x8x8 x8x8$x8,x8Xx80 @0PU 7p T; w8lw8w8w8w8w8 w8w8x8w8w8$pX0 0C\ X0 d X60t4 4S 0t4x4#ptX0 0X0\ Te  ?60t4 p[^ 0 ^8 #8t$,R10 tt$H^0 x40 ^8 #80:^ 0 ^8 #84.D,<*@(8&L$P"H d0(l0h hjh @5pp@ p@lPh 5lP(plp8 0 $@\0`/ h x4$S 0|4h 04Q t4! St0t4P0x4t40CP0110t |, h 5l0d 0 l0d 0,0h 5lhd0d@"tDl xDVhAAxAAA 0-PpLP d@㽚Tp@0h趚 -LhM ` dPPpK l@P <0S SZp0S$KD0SlV@P -LhMp t 4`KP?@P @0S<p0 St0 SX80K 0SX@(K -LhMp Pp@`KP p0S<0SW,p,4 00*Pig0P$K - 0Lq 0Q 0s00 00 0\00` -LML0S  $@T0K@4KA -LM40@4 00 -LlMp4P^ `@ cS 0RKK K|44@K004 0@P@Do k> -LM`4Pp00 40pPP ՙ40@ 0N4004 4 0PPᓙ -|1LMQP d1Q& 1CQ KD1Q400Q* Q< Q@0 0 & 0$K KX 0$ S;#0 0 4Q Q Q@0 0  D0 0  0P D0 0 4@ 0@T@p0 KT` VH0 0 H0 0  3UDUU@ 0-50L0@ 050l PBUlPPPjTPgLP LLP8P 88PDP fDP0 -LM50`0P@050l  Rl  @KHP f40D@PH@ 80@ @P@0xP< @ Xq  4L0P@ 0gPP 0bPTL8 @85Df㳘50p050PlpP8pLp PpTP Tpꠂ8 0-LM@P0K  ;T Td0DS Q020C0 !1*h0\ 50K08  < A Q-L@Q AA -P8LP&\PfQd\ p p`@h0!R h 01dp@\` Qp-L@` pdQ` `P h0!R Pdd` QP0p0p p-LhM0 d0 @P`Kd0T@P:Kp -LBM P0004P`p  @ X 0S@00SX 0@SP~   00S~@ 0@S@0s 2R~ (K$ Kf0( \Po($\`< @P_P0d TP2TL"L @<f ϗPh~ 0Td@H0uCKp H0($ 6PpH0PHWH0PT08` H0 1<K!4P h0P180PW @0 $(P0 $( P0$ (P 0p0 K0p00p00S S Sm0@$0 v$f iP( $ 1t0p0 p0  _`@0$0 0T0H0@jA`z@?A0@||8p8A(AhAjDAkYkA - LP@ P 0S 0 PPQ<0P R 0-0 ((L"!@0S1s s 0D0pP80< ϱ00@&00pP800kk$k 0-@  0`p 0RCK,1Q $1Q 1QQx xP0x0000 xP 0 Q000 0KP Q 4 @0R0 K%P|0-0|00|00|0@Do}fpUAUvtnU~fLk> 0-LM` @.Q@@v0@0CS088k 0-0LS@D0PU 0 LZP 00L P0 0-\0L Ƞ Ƞ,A0000P0CS000k -LMp|0@`, p 4 @0@R@PK 0PP@ P, 0R6(K㎰PP0S0-| P |  0PS&P |00|0 ЯP R@0T0U0S T@#T@!PK P ٯPP $ Ჯ#PP@DoA\k> 0-\0L Ƞ Ƞ,A0000P0CS00Q0k 0-D0 (("ALPPLfxP0k 0- 88 #PL*0AT 0S P0PPP Df #|0L0|0xP0k 0-PP@L |0 luxP  0h蕫0|0lgxP0 0-50L@0Q!ڌ 0 S00 S P0 *c0㴯0P0CS0P~j$jԐ8 p-0LM<00P00@4 K Kw`0 *@0 $D0 D 0H@ Kpx8A`1S`-T1S0T0 cB80K1 0 !p0@ 0 1SWpp# 0P@Iφ  0 pΆ  0 pOφ  0 pRφ 0p p(K80S00 1S480K^Eφ0 1 ᆕA p-L?L`@P€ - 00@0@p -LM0`S qWDq $ D  H PH!2@  D 0(KP0RFC Q<00D 0W@ !PA \> R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ e-D1S BT\1S 㴭`DP ]K0 \  D@T(KK A-D_W - 1LSPp @`1 1S`@ ! -b1S 2S a1S 2S h+_ -Yh _ -Yhg 0-a1LS@P \PPP?0X 0 Aq 0-DPLMXa@ $K 0$ P  o\K04k7 -@Lp`PP D{W30, Xb10Ya1P 8S@q8 0 qQ Q 0S 0-@LPnP h1l!PP @  P@T0複> -`hl1pPQL @ ,P@T iꠇ> 0l 0-LM00P@K4uU 㡬p8p8 p-T2@SLPP`004T2S0L P2ph) 0-LMt3@S 8PKL P  0x8 -L|M Q@pP` - Q `p 00L 0` KiW@ p-PQL@ t3S` L`PU ph#p p-1LS@`P 3SL php 0-@LL50P0 Q-L@ P0t3 -02LM<00`00p4,K( KP(@0 ,@0( ,D0( ,yH0L0@,(0 $@ P@P h1 R8 \1R #Q@"1LS 500. l K0 S j#Q0At 1S 0 @HP0$K,(x @P $0 X0X UUP03H03 ꘠8S0@>>4kt>88 -LM@K K= 0PK R00 1p@-QA 1CQ 1Q p00S0C0p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSp! 10! 1 0! 10! 10pA !01 !01 !01 !%W A W@00 -LM P `p 0S`r "30,0 0,0 H$0 D0@@<<0di1`SS1S Q qAW 0!0ll<)0 !0dd6)0Spp@AH P0D S00 d24p0@S0  000 0S 0 pS f,@0 0+(Ko赩 00CS(K1S0000 P 0-LM0@S P 0 0S S S \K L 0P  lK00( ?`z@8A0@7HAXAPA -LM` ! 0@000p000 00P,K l#0P[PPQ(K, 00@00$ #0PDP :S 3, 0000 S &0 P "0 PP p ,0< 0S0000#000 P 8"0 P ,00S0 -LM@K KM 0PKY0S 0r0Ss 0Rr0 ZR R0S0w000S 0{ z0 0$S$0w00 p-LM8P00 K^X`!KED`!K K0@KK`K`K`KPK`K`P[Kp -0@SL  1S01 1S P 01P P1 0C110C1 5A -LM@P  K8#T0 0 @0700 <Q Pk p-LM8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp0S0 00 0 B 0 R00 -LQPp` 0 1 s@N=00 00 00 00 00r`  'r 0@P00 <Q A p-LM`PV800@0NĠL0MQN`O`PR`S` L0@`NKp -LMP@U`p10@0<0NĠL0MQNPOPPRPSP L0+K -LM@P  K0 08#T0 0 K00 <Q P -L M0`S@- 0BS*Ꜷ88X88808ط88  0K@i RY0S 0S00S S S 00 b0K\T T 0R0 R B&D 0@@P  RTXpWd  00 b0T T00 =T1  XT%  ,T[00 TK0Q0  0T700 @ 0  0T5 T 00Q q 0@0 PH 0PP_ i[ m f _0Si %d00 05@ 0@H:S 1S AAHApAAA p-LM0PS@E 0BS꠼88l8888`8880S V%T00@0CS0000 0PP KphB R 0PR 0($ 0,0Kp 4RC@ 0T\ @`840# <S  j i(h0$k0 0@S<0S =Q X0S| S~ 004 D0PS4< @0PLX0St 00`@YP`@> VX 0BSP2 X RW .:R,1T0Y 0BS78@8@888d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< iniX@Y@\@`@Y0PX0.BiYi>0S=}`0T04> H0'P hAlA?\AAA>A|AA@AAAA> -@L0 0 4JS00X0ĵX0ĥ -L@40S 0 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKK04 -8LMȠ,Ƞ#83 2> -@Lݡ00h4 -@Lӡ0S00@(S010,0RR00,0,00 ,0S P, P0,0 f0,0 -LM@Q` ( pSJ88882 %㼠 <00 " 0>40 01 0@0 T0%(KQ, 0 R*$0Q'0,00 ,0S P, P0,0 (KoVf`0,00(Koh0e0 0 !0,00,08A<0S8<0ć -LM @P4`0S3$pW00 0=0 0 ! $T@  0 P0(Ko"0+ R  RW\[0,0(Koe T@$ 0AP(K8<A p-L!M` 4 0PS  0RKp0 "K@KS PK1Q K1@K L4 0 Qqx0@Do\A> p-PL Ņ@`@ @0 l02408P40012` 902`p88|k p-LM`2 <2PK0@!2 00004  00CS0xxx`6 p-LM`022 < ;PK@ 200004  00CS0xMx`6 -L(Mb@T=0KKP4KKK. K0@KP@K@K@K@KK -LM6`pI $K=004K40K3KC0 & K00K.K-K2K1K/K=0P4K4K@D0,K.K-@K3PK2@K1@K0@K/@KP08 R06=04KP.K\@ 03K-@K2@K1@K0@K/@KP64K,KP6L -\ LR`p@P<0PS 0\ <0R@ Q-L`p \ Rpp@P<0S P\ \ pPR@0b0 -LM 0S  0 Ƞ8,Ƞ#8 P > -LMP@` P d0b0(K, KpP 4 08 Ƞ,Ƞ#8 6 8 2 ,,;0P4帀K\0 2@>K ` Xp PP L H0 d D` P6 = [>0[4S\00\0  >0K 0S/88888`0[S\0w0\0@PtpK [10ERt0 T  !B200 p0 l p0 l !1\ <R@Pʃ1T0 P0p0 tP lP 0S;p@0@S,oP  0S00S0@pSWXtK 0< \0 S0 00 I0T0 0T0 0T0 0T0 p 0l T,S+Sj(hAA>kAA0B8A8?AAAA$AA@-@0 , 00\#^? 0-@LP&f30# 0 0-PLD<P 3hS CT h0@Te0 0-LM@PH ?P  K0HT 6>P  uHX \? @PP  T^̠\34/ P?\A|A88AX8 -2AML@`x3Pp0 |Sx 0x#C40tx3`7N``  tcP N 4DK303'8A p-@LPDPh3S 5  `0  BQr0Cp P0`FQ0S*DP ƚ5 ;%55;5p 10R!!  10C1 -@PL DWP Dhg p-L@DJP_ H`eh3S 3 30S 2 Sh#Yph苜p0 -PLD`p @P 8W;H8 WW" 0 0@0@ hnW i]0 0@0@  p 2S0PiK`7A p-LMP0 0@0@`XBٜ0 K@tn7t 1S&"Kp謕? -LD`PP 8@ U UUpp#R 00@`0@ 00@0@3 03CPU\hC' 0sA 0-t3P@SLpS|S DPt Px 070 -@RLp` @ ; 0 0PU PPPP7; 1 F7; 00A -LM`DpP.P 8@ U UU(K3 03P(Ua ̠A\0L  @d 00KP 00 00S0 0@0@C 0S븣+KA )0[PU)PK00 0C00 0 00 0@00@͛4  [7P tP    y4\0 0@0@X8@A 0-@PLS 47P 3S D4P P 070 Q-LD -LM 0S  0 Ƞ8,Ƞ#8F P D> -@L ⺁30CS3hy3 0 3ȁ -L M@Dp`KP K@0FD@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKP -L M`D@$pP K@0DND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@D`PP Kp?0DF"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0PD`0K@P Kp?0DF!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T ;>  ~$ f& ~b;> (0h讛~ V'`A 0-8P=@L8 XC ?\P 0P=\PB\S`P %PA`PF0`3dP PDdP0d3P I 03P 03|P = 0|3tP z0t30h30  \P  p \|`P  <s (mdyP  AtAAAAA p-@3LP%D♾D▾8`@O aJ00S 0@ᜪ30CS3+pqG -8LLp3 @@ TP, ` 4P`=QP@@0$gX  P` 8<8 iQ8<8 -LPDuP8@@ qpo @6T8 1 *7P. 7P0 H q j `\3S 8@0;8ᐘhWT @h~,hxP hq4 AP A -PL`D@pP@ x1T 0CT'  00;@4T- M,1T $1T0/p@% = S" @S+ @X 5l3@505O0 R0"@5@ 4@D@ 9l3  ~l3   si 5i 6i( -@LpP`: &< %_ ([@@T ( T hl A -LPD@`mpP   %5@ (1@@T ( T &W@H$l A 0-@Lg  30S7 \ 36S$ Q J DPP;> 0 08#8 0hg, $  0- L P# @@T #  T !0hB A p-L`@PP@4U0@p -LMP`pDS @P  K2"3#CCCC cc}$ Kw@P4 08 Ƞ,Ƞ#8F `$;>H!b0C p/p90PS00ST#0@S$-Pf   0PP# PX#P3SP T3SM X3SJ ^*@K})P H 414!8!,1,!1!0` `.1! 3 1_0p@$#(3 A 0s\ 0x_#R  JVᱪ #q]|yY ltT"0"/ A8D8 AD> A4 A888d88$80888 A A2S -@PL ,߾P ,h -`3 @SLh#\p# ,iP` Pd ` 7 -x3 @SL#t# ,NPx ȾP| x7 0-L@P ;  1P ; 000@ -LM`4 ,P@|P08@ U UU(K PsUx $H04  屾44 ,0KP,p 0 0@0@  pp=@tP  ㄓ ዕ,Q /08, #x Q @ 0K[2[ :,: 0#AS, Qp0 :08#x0c, ^PP0 0@0@ [H:8H A Q-L, -LM P  0 Ƞ8,Ƞ#8 P  > -L,ŽP h p-PL8`=8h\HP zP>H$PDHcLP oPDLPJ0L3PP cPIP P0P3P 03xP н0x3hP 0h3`P Ľ0`303pTC TC  H߿P TC |TC dLοP TC @TC (P彿P  Ad A A A A A -LM?`PB 0,8#8႒Ⴁ @ j"K2KT,K d@@Ld30 h0pP j@hS `d3L/  p[`寿P ;(K0K2Kd,K pꂒႡ j d3 6p303'8 0-@L3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP 5 ;%5 10R!!  10C1 -pL,P`ᚼP ♔V VV& 0 0@0@TS" V iړ8h;8 | ` 2S 0 0@0@iœ0L宿< A p-LM0 0@0@P`TXP0 K@`` 1S^ᙓKpX A p-3LP4LPHPPP,и,͸#3`0CS3:8@O -\{00S 0@)ͤ30CS3!\p⢯6 0-@LP[30# 0 0-PL3S CT 9^0@T[0 -LM`,Pp̻P @0?0(0K(0K:,CJGĠHC6 (K%K#K"0K!@K'PK&pK$K嘿P K 0-LMP@0( P,(4S  0P,  H0P,  08 0CP,  0P,< H0P, 0P (0P" 0-@MLP 0@xK 0q 0@k0h @e,(1[#4S>  <00@X,x 0 @O,Ko <0@@E,e 0@<,\ H0@3,S 0|@*, J 0@!K0 04@,9  0  " -LM`0PpT3,c @P  08 Ƞ,Ƞ #83ί3?SCCx3S3CC3.⊻P |$K!l30 p/pW0`<40S@00S@#0@S0EP   0P<# PD#,# 0S;94| υ0~p O0pr _ *@K@0@ 0υ(|?0T]M  0P`+1!81!1!1! 3!1o0p@$#(3 A!1sQ 0mZ#R*  ?Kᦥ , fW mR*@K0@$c`0>0U"0"pq8CxA04i >9t A<8 A6 `0hr@ A?9889999d98| A` A A A A -LMp00K`d (0 T,娹P ( 0RJ$K 0$2K1 [20[ t"pxP'x% @P Pᠣ$0K Q 0 U A @ PP  0< 8@0 0@DoԐ> > p-LM@M_`z0]7Pd c7P 0P73$ PZ3 PT3 EPN?0>0d( 00 ;X0< ?P TC hnKph^3#400@ ?нPP TC SKphC τ07PTAKph1H|3x/ P xt8@0;S8Kph,3 R09>T,Kph 4 AT Aa A8 A -LMP@`p坐1T# 0CT,  00ԣ@4T  K1T 1T0/@4T5@"@% = S$ @S8 @50@5 0 R0@@ 5@X34@DX3L"K 0e"0[! [04 @\yX3  "K0HO![" [80$0 Dai 5i 6i( -p0pLM@   8@ 3#0S 0S S" S036?0 A0S  S 0 8P (hD?  t A p-@PL ,ɷP_ Ǐ`W3S php -@L?v30CS3hü3 0?3v -LMP,@pᔷ`PX $KG4%0K&pKh 0`&K 0H @40`T T!  A -LMP,@_`PtW K"`K!`K 0`v"K0| o @d0`hT ?!["0[X  T  A 0-LM@ ?P  K0 2>PP  Lr̠3,/ PS姹\A|Ax9 -2QMLP`x3@p0 2|Cx#0x#C40tx3 7^``  &tzP e 4.=׳K303'9 A p-`L@家P 5  P0  BQr0Cp P0 5;5pPEQ 0S*DP ܋5 ;%5 10R!!  10C1 -@PL qP h聳 -PL`pb@P a8W;H8 WW" 0 0@0@ hW i蟍0 0@0@ = p 2S0{i荍 yA -LMP`"pP K0 0@0@\~0 K @t媶7t 1S_Gꬕ? -t3 @SL|#p# 匸Pt Px t,7 -@RLp` @ ; 0 0P PPPP07; <1 $7; 00A -LMP0,0 @p`ᤵP 8@ V VV(K303AP-V[ ̠A0 L @ڵ. ,0K` 0,   0 4 S,0 0 0@0@C 0먃0 0 @0@I,00@0 0@I0  _7P tP  ㊊ 0呌|0 0 @0@x9@A - @L#;7P 3S 峷P -P 7Q7 Q-L -LM 0S  0 Ƞ8,Ƞ#8 :P k 0-LM?0@ PK0KF0K0K@K@K@K@K@K岸PK03 A -L MPp@S P K!1 @/@1!3#ss Kv@P M0PS00S#0@S AP9   0P# P#&@Kw`HP  0 8!0 1!0@ 0p`Lᓜ H`ᮋ 0 A!9#9 A4 A8)9d99X9| A p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`KPKp -LM`pPP KG@0HD (K(0K'K%K#@K&pK$K"PK!PKP p-L M@`PP Kp?0F"0KB0"K K!KK0KPK PKPK`K÷P [0[ -LԳP i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0K坳@P Kp?0F!0KA0!K K KK0K@K@K@K`KkP[ -LM@}P K@0  K0KKKKKKKKNP㲾`A 0-8P=@L8` X4P P<PAS P P@ 嶵PE0 3$P PC$媵P0$3P 003P m03|P $0|3tP a0t300 y sP  pj \d pP  <[ (U$aP  AtAAAAA 0-3L@=~Ԋ8P@00S 0@ጛ!0gZ p-LM`<  <8 0@\(3  ?bx0@Q(3 P P@ P@++!(0U(Ph00 8 @D ?4x,农;;1(# (#j -LPZP8@@ Vp" +ogd @%T8`   >7P( 7P w$ #  "  3S 8@0;8xh?@}hn,whhP haP A4 A -PL`@pP@ d1T# 0T  00,4P@ >5@(@ 6% = S2 @S# @ 5@h3505b0 R @ @ V0r@@Jh3  ` `h3 ` i Qh 0-@8=PPL8X NP<PASP CP@PE03 P 7PC P0 3PP g0P3HP 0H3<P [0<34P 04300  嶳P ؿ pҿ \姳P ɿ <ÿ ( 嘳P  AtAAAAA 0-LM@  ?P  pK0 ?ݵPP  La̠HL3,/ PBH喳\A|Ax29 -2QMLP`83@p0 !7P H3S 峱PH -PL 070 p-i3LSPp`,P fk0,38@ 00S 0@᳗0i3FpR -LM 0S  0 Ƞ8,Ƞ#8! P > -L@ ûP/.咯P ! h`A p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`KyKp -L$MpBK4@P/50[6 [$R(K,K0 Km)P,P  ̠8Č#Č"̌ 0P  ,TkX!0\ <̠ČL8 ČD"̌#D!L  0@P ׼ ,,kP,<4("!4l̠ <($Č"Č%̌ 0aP L ,k R8 AD Ax A AH A A A -L MpB]P XK K⿮@P 單0PS00S#0@S 劮P   0P # P#`. 3S 3S<$ , 0P 3f1C jP,& 㙅O@`hP  3|0| 8!t0t 1!0@ 0p`l᳕0i3Є,~A A A| A8A4 AL?9.909`A p-`PL@ YP b!P0 @/D0@ R phM(ph 0ph7`Do AjT99 -@0L"MK K0KKKKK K K K -LMP&/00P00 `@p3 488S  P @,Vp `0 0   Ki0!B!O0,0,Õ(0 0P"  Ki -LM8P@` Kń@υ 0p@8/  00 00 s@ o7P {7P z3S 8@0;8KhLKh4KhlP Kh܃4 AP A -P@hsLW`@ pl1T# 0T  00⨗4P@ ẃ5@(@ ᲃ% = S1 @S# @ 5@$3505q0 R @ ᗃ@ 0 @@Y$3  0D   $3 ?   i Q, -RLM R R K0K 嚬C@-,3S 0 0@0@Mꬕ? 0-P3P@SLL`SXS rPP PT 070 -@RLp` @ ; 0 0P PPPP7; #1 7; 00A -LMP, ,3` S@(8@% R2 RR t3 S% TI t3@!ᜄt3 S0t3ʜA 0  @徫(K`0,3 <tÅ ,0K? ,,L, \ p ,  R 0 0@0@ 0 0 @00@ '0 V7P tP  h Ӗ0o0 0 @0@B9AA 0-@PL4HS 27P 83S 呭P8  P< 070 p-LM8@@ KpނPq 2SK 7P# 7P&  2>⦯P$ ?⟯`P Z (#KphQ Kph Kph Kph<38 / `8?8@0;8Kphτd ? @"P  ,Kph́|A\A4 AP AB9A9A 0-@8 =PPL8X $P< άPA S(P P@(ìPE0(3P PC巬P02@P =0@38P z083XP 10X3PP n0P300轸 그 匬P  pw꨸ \q(}P  <hꙸ (bnP AtAAAAA -`@,sLWP@ 0T 0T  004P@ + @ @ 5050 R@0r @@ F@ i -邡ႂLM0j`@PT3p /00 T\  @00 0! Q " $K0j 0T (@j@Xc0"!B PT3(/LL  PP $Kl30l3>'L9 0-@L,3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP ~~5 ;%5 10R!!  10C1 -LMPp,C`T K8V;H8 VV. 0 0@0@ᖷ _V) O$K 0剩 P `$0S 0 0@0@ 2S0~10 0@0@(A p-z3LSPp㽀8`@ 00S 0@ђu0z3p> 0-LM @P NPP  0 Ƞ8,Ƞ#8D  ߩP 8P 80 SS8舑> -LMp`r P' 08 Ƞ#8,Ƞ 幩P?8@K̩֩P pS ͩP 0$S0S? 0SpἩPw ,0S@,0@SLP(0P 0S(0!#6,0@S3S Ψ02 `R@0S2sP  @ 00S0"30S嬨@姨ܨP0p@P坨 #$#0`S0@0S$#0S厨Pg   0@0S#0S3s $3spW3s $3s Z` O?K0K0C ^POKX 2$KO0` P@KĒ< $8 #44"<,K ,0 A032i@ 1!8!1!1!0@ 0P`qḏ0z3~ Z0Sp $K233SC 0 $00B SAB Qa0B7 BSW B? 2"0 P2O TH<ꈑ>*4 AI9K9dA9AXApA؁?<AAAA -@L7je30CS3h)3 073xeP0 p-@LP0`P 5@00"00p3F`30\# p 0-PL0PX3xS TCT 2I0@T30hF0 -qLM0P3@0` C;QA40+ @/033H   303N3@0CS3T 2 d0⤣ K< a4<0>ᝫ303Y9DA p-@LP0oPx3S 5  `0  BQr0Cp P0`FQ0S*DP {5 ;%55;5p 10R!!  10C1 p-@PL 0/P3^ -~`Ex3S \3 `30S P2 Sx#P>php}pt -PL0`p@P ~=W;L= WW" B? 0@1 Aኴ SW iB}< 0@1A pP2St]i0}3H0330CS3A p-LMP0 0@0@`X}0 K@I 1S)|Kp謕? -3 @SL#|# 0,P $妥P ̥7 -@RLp` @ ; 0 0Pl PPPP7; 1 ]7; 00A -LM`0pPEP&U& UU h0l0h0PCUK 0Ÿ0BD0  @倥303ѧ30CS3'(K,0K P嵥,0S 04 C, 0  > 0@1A R"0 0@0@h@匳 0Th3D03/30CS3꿠0R P{00 @0@, t@ @| =7P P  z  r |z0 0@0@[9@A - @L#97P 3S 00P ,媤P 7Τ7 0-LM@0zPP K034038 D0LP  P30CS3|4< H07PP  HP<D3,9. P圤\A|A[9 Q-L0> p-LM@PP` 0)P Kp@ĠF@0  KK 0KK`KKKK3 030 K3P0CS3& -LM@P`P 0pP KLN@0 ' K#K(0K%pK!K&pK$K"K3 030(Kç3P0CS3 -LM@P`pP 0ʣP K@$L?0 KK$0K!K#K"K KK3 030$K┧3P0CS3Ǩ -0PLM @ K@b0P[ -LM@PP`p 0劣PU x @ JGĠ0 K KpKp  >   7O p-LM@PP` 0^PU xK @      K0 k% [0[x -L M⬁0`0$0 1PC= F-,pK %[ 0%K$P= @P P) K?0 Q0 U A( @ PP =<=P H $ 0R K; =<=/  0U@Do> 0-LP0¢@P 0  |{T @ 0h{' 0-5@=P5LUP=DP [P1DP6DPHP PP5HP0H0P 03P 03P t03P 030x30 hȿ T¿DΤP  4广 峿H忤P AtAAAt p-L@P9z`0/& {0 5  p t7P,vhyp] Z7PcUypH @ 8 3AH0S D0S 5@0;5,yPpDP !yp4 AP A -`LP0@pᵡP@ yl1T 0CT%  0t@4T+ x 1T 1T03.@5 - R" @R* @E @505>0 Rt3@5@ 14@D@ @ (@ @i 5i 6i( -d0LPt`$00By3p0CS3Y=@3N LA㚐t0S IxPȔy -LM 0S  0 Ƞ8,Ƞ#8  WP > -LM`Ppa0` @P X0$K2C3C7S^2CCS3( K⯡@PL(0 40 0 Ƞ8,Ƞ #8t?>4w080@0<0 `R>S4 0@S4iP/ 00S@8<0S80s$ <0s! @0s x.@K 0pP  w&h@LDO0߽  tP^1!=1!!20" d303Nh#t` l3P# 0Lc冏  0p@T#R  sڋP |L wN"0I"a؁? A`X9\A AAA AA`W9@j9,Z9c9b9T9U9@ P^@P P Tˠ,034/ @,N\A|At9Az9 -2AML@`Pp 3 S3 O\\  Ӟ'P  0ۻKD30D3x9lA 0-@LM3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP s5 ;%5 10R!!  10C1 -PLMC`Tp  v8W;H8 WW" 0 0@0@᦬ hoW i^u0 0@0@ p 2S0iLu 8A -3 @SL #$# zP P 7 -@RLp` @ ; 0 0P P PPP!7; -1 7; 00A -LMP0,0 pM`Q 8@ R RR(KP30P34P=VL ˠ4A0 L @͝!,0K , 0 0 @0@, 0@ @\u0  7P tP  r 0tPC߫ 04姺P0 0 @0@~z9@A - @L(8#V7P ,3S 弟P, 6P0 7,Z7 0-M3LS@8@ 0uP7P 7P 3S 8@0;80hMt@V0hGt,P0hAtP 0h:t4 AP A p-PLM3`S p0 0@0@(091S phWꬕ? -p@MSLU`@ t0T o0T s0CT@ s505 @s  Rh @@s@ @@ @@ ni 0-N3LS@0tt8P@ 00S000N3s0 -LMP` VP 庹R!1 `/`$ KPP$0`S00S#0PS$PA   0P" P#効2S+ 3S( 3S% t; 00! 1>p!80 ` 00P`@!0@`1hNcOs8W (R A AP~9w9}90r9 A| A -LM 0S  0 Ƞ8,Ƞ#8 P Hk -@L7Z30CS3hҠ3 073!Z -@PL 0妛P 0h趘 p-@LP0`ᗛP 5@00"00p3k;`30\# p 0-PL0偛PX3xS TCT =0@T30h$;0 -qLM0@P `3C ;R' @3H /  奛3033@0CS3T ک T壸0L K<b<I303T9A p-@LP0Px3S 5  `0  BQr0Cp P0`FQ0S*DP Jp5 ;%55;5p 10R!!  10C1 p-@PL 0ۚP3^ r`:x3S \3 `30S P2 Sx#Pphrpt -PL0`pᱚ@P r=W;L= WW" B? 0@1 A6 W iq< 0@1A pP2St]iq3H03ŝ30CS3ᐟA p-LMP0 0@0@`Xɷ`r0 K@ 1S)qKp謕? -3 @SL#|# 0؜P RP x7 -@RLp` @ ; 0 0P PgPPP|7; 1 p 7; 00A -LM`0pPP&U& UU h0l0h0唛P4Uk ̠AD0 L @-303~30CS3(K 00KPb 00 f00S0 0@0@͞h@H 0 h*KA G)0[ 0 0@0@00 @0Ct00 0 0q V7P P  n  8 p3D03弜30CS3ᇞ0 0@0@H9@A - @L#9&7P 3S 0P dP 7则7 0-LM@05PP K034038 D0P § 勶P30CS374< H0PP  HvP̠D3(9. PW嫛\A|AH9 Q-L0 -LM@PP`p# 0PU?0@0(0K(0K FH0%K# K$ K'0K!K&`K"K3 030(K⭜3P0CS3 Kܝ 0-@LMDĠ DKD\0KKPK@KPK0 -LM@ NĠ0KKK@PK -LM 0K c P K -`PLP@p 0{PU T T Qt0T 0d dѵThT T4 $ 7p>ABF -LM @0K@K@KMP [0[K -L`00PB= @L, h d$sWc @ PPp. P00 @@Up#  PP =<= L mD m;=<= 1W  ( @P t l m @Pt =<=i  P@&* -LM@0K @c P[K p-`PLP@ 0呗PU @pT T Q0T 0|x @T@pT T< H( H7A>BF 0-LP0S@P 0L@ mpT @ 0hap.' 0-5@=P5LUPՊDP P1D坙P6DPHP P5H咙P0H0P 03P U03P 03P I030x30藥 h`ꑥ TZDfP  4Qꂥ KHWP AtAAAt -pL`n_@ @-T $k  5 a 5  W T7PmE 5 ; "7Pm= 36H0S D0S 5@0;5mPㆊP m/4 AP A. -`LP0@pEP@ Bnh1T 0CT%  0ty@4T+ m1T 1T03.⮅@5 - R" @R) @= @50560 Rt@5@ 4@D@ @ F@ =@i 5i 6i( -d0LPt`$0‒0}m3p0CS3=@3N 5+t0S ~~mPYr -LM 0S  0 Ƞ8,Ƞ#8 P 蠖> -LM`Pp0` ሢ@P  0凕$K2C3C7S_S2CCS3( KB@PO(0 40 0 Ƞ8,Ƞ#8孖?>4 080@0<0 `RCS8 0@S4P3 00S@8<0S80s) <0s& @0s# 0m.@K`.0`1pP 凲 yl궣 t@ TvHr~ 0k  tP1!=1!2 0"d3 03Nt`h#l3PH 0Lc  0p,5T#R   }eP x׆ %lF"0Ԅ" A9Aܕ9> AAA A4 A99|9В9$9,9999R00Q00]Q(0R 1RH00U@XPQ X0]S  -L M4!00PpABdHD*0K*K!0C" K'K%@K$K#0K!`K)K(PK&K"pKI K -LMD0 Q!00K# "0C KK0K400@@C K@KK0KKK*K -LMTS0^4pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@K KT0STS0SSR R R -LMLp@` P@ K4P0ED!0 (K #@K(0K'K!K&K%K$PK"Kҗ@P -LM(0KC̠C$C0K00K@K: KKK0K  000K0K< S00K  S00K  S KPKS00K00K]0SR RRdh0Si0 So n0$R Hp @000 000X<<0A -@dLP NPdP 0d0 (dP  װ8A\A -LM`@q d0S Kh80Ld0 @P`9 -LM@0@,PK00`pᣔ᭔P 0S T$S0S00 S00 S00  哔P$K@T 0 S0S0s@ -L+8#+ -LMRL0L`i@0pATF@0 $K$0K#K!KPK"`K pK@K@KYK -L MH0`Sp]80S] Si ,@H44K0NT@0  40K3K1PK2K0K/K.@K-@K3PA ;@J   LL< S@ KS@0L@0D@ P 4K1K/K3PK2@K0K.0K-0KP0@1K2K 0< 0@20K1 K20K10K@00@  4K3K0K/@K.0K-0KP (K( K R" ʖR0 !KR0 R0,0 (,K(p S@  S@ R  R 0R 0,0 }0,0 zKR  R K R0,0 o0,0 l0,0 i0,0 f0,0 c0,0 ` -RLM` R R KSppt0@0NFT@0 $K$0K#K"pK!KPK `K@K@K僔 Spp 0 -L8M萟H0\`,0 @`K0A4p @[0K`K_K^K]K\pKZKYKZPP , 0R(K=̠X K00 P 00_0K 0C`K\pK[0K^PK]PKZPKYPK;Pކ@Do> 0-L<P\@010< < 0000 0-L@ @QP @AD呥 00C00A0` `0S -@DLP v0D0 Q-L@ DP㐈0H0 -L8M @Tp`(@ \ (媐P(040 S < < 00 8080X T 0S@V00S00#X  R00S1 T 0@S (⁐P $00H0$KX0s3 T0s: 0@@S00\0 <\KnD (@ 4 0H@ 8 0 < L@ ,` D  P( KiP -  P D#  0 $Ak0B8A8(AAAAA -LM 08 Ƞ,Ƞ@#8 崐P Q,00K 0R 0[S  0S K 㤚P KP 㗚 $0R0S>^Re00Qf00d0SH0R RRDjf e 0f0f f0f0 0 0f0f0f0f0<`<0f0f0j 0-dPLU@ DP ŐPDoPHfKDP0茝 ,Uꆝ OD[P AA -LMd0@S?@0s D0Sf LKLH<@ D0 @eP$hPU30$`K0D @p"K K$pK#PK!0K0K0K0K剒P0 0!K KKKK"0K$pK#PKzP K0 0 $pK#PK"0K!K KKKKhP꘴9 -LMh@^0Aa@0 K0KKK@K@K@K@K@KLK -QL!0M# 0K"0C KK0K800@@C K@KK0KKK0K -LMX\0~Xs ^S  8p@0NTGd!0" $K$0K#K!PK`K"K pK@K@K K0^ \0\0s  0Q0\0Q X r 0q03R0#S0Q0X0R R R 0-LM8P@0E@0 K0KKK@K@KPK@K@KˑPK0 -LMPp@` fP@ K8P0ED!0 (K #@K(0K'K!K&K%K$PK"K壑@P d p-LM(0KC̠C0K`C$00K@K: KKKP0K  000K0K< S00K  S00K  S K@P 0\0s X0s KpS00K.00K Q-L@ `P0d0 0-@DLPP &DҏHfPJ0D0`P ᮆ0`00 -L4MpP0@00pD T0 X0 啘@P ֛ 埪0d0(K0ߍP9 0ߍP 0S 0@S?0Ch0 h@4 @P4ɍ0`80 R)0S&4P  @ 00S@ 0 4L0ꗛ `0d0 Z0d0 S0d0@0sZ 4<0SF 0`80 R@00ST 0@S 4倍P   00SX X0sG T0s> 0\0X04\0 1,H 8p 4 00 < L D @ ,P P" A 0d0i0d0c iP4 , 0d0Tx0d0N\K` `0ň`GP0d0A<ܩ0d0;A AAAkAAXA4A0B8A8AA -LM 0S  0 Ƞ8,Ƞ#8( 垍P 蠠>Ra00Qb00`0SH0R RRD傏b a \  0b0b0<<b0 0-`PLU@ DP PD咎PHfIDP0诚 ,x꩚ rD~P AA -L M#1@R#R1K Qp ` 0 3 Q p ` 0 G Qp ` 0 K Q- p ` 08P00K@0EDK(0K<0C(K K pK`K'K#@K"0K!K&K%K$PK婏K] 4 (` RR00QS00 -\0SL@H P PPSR0XV0 0R0R00R0 S00S0S0 0S0S0<<S0h$\ %DhA -LM0&K(K!hP 0@p%K'K(pK$0K#0K"0K!0K傍@P&0 &̠0$@K#@K"@K!@K(pK'0K&K%Kq@P K& A 0-@( LK RPT ږ RM %ʖ RF K RB 0RF #KR? R;       < S$ SP00 R 0R R KR S  S EP 0    0-LM@K! @0PK0@K@K@K@K0KKK@P  qK0$AQ@Q0SQ550055QP0SQ550055PR R R 0-LM0@P 0KKK0K0K0K0K0K0K姌@P _ (K0@A 0-\PLU@ 0DP wPD!P HfEDP0> (DP 5 AA 0-L M?0@/PK0 K0KB0@K@K@K@K@KK0K^@P  ߥK0\A -LM\0@S @0s D0SV00P KV0.pP `K0 qV0PUf L 0 pELH4@` dD0 @ߌP @ 0⚥U BA9xA Q-L@ XP㠀0\0 0-@DLPP ׉D僊HfE0D0XP _0X00 -L4Mp@0@00pD L0 P0 FPP  $P0\0 K0合PZ 4 ⰈPP t =0\04倈0`80 R0P0s[ L0s^ @0sO 0504QPT0 h1̠@ < @ 0p , (0 4 D 8 $@ P0 C  0\000SL 0PS4JP   00SP  S@ 0 4L00\0 0\0TKl l0幃X\֤0\0HФ0\0~4ʤ0\0xAAHkAAA0B8A84AAA -LM 0S  0 Ƞ8,Ƞ#8 厈P |>RN00QO00 -LMT0PSD@R 0Sp` PN 0O0 Ki}RR K@ Ki\pv0 `p@ e0 S0 $0[A(A\A 0-TPLU@ @P P@VPDfC@P0s , -@8LP R~080 Q-L@ 8Pm}0@0 p-QL!0M# 0K"0C K0K 0 `K K0K0K0K0K@ PK0 㪈P @TKp p-QLMP !0"  0K K3 #4K0K K K K K@ `K0 ㅈP @TKp !0"  0K K p-QLMP !0"  0K K3 #4K0K K K K K@ `K0 UP @TKp !0"  0K KR- R R 信mA -LM 0S  0 Ƞ8,Ƞ#8 劅P ܡ> -LkA0B8A8AA$ART00QU00 -L8M U0$ S C0KB K0C BA0K@ K60 `?0K> KD0CD B@P4K=0K< K6@K5PK44S ) Sc  SF  S07@K40K3PK4.0PSF@  00Sp0@S94P @$ 0R K SP @S S040K3@K;@K:@K9@K8@K7@K 0 30K 02 K10KN n08@K7K4PK0 K/0K;K:@K9@K?0;0K070K` 08@K4 K30K:@K9@K4 H0K @P0ŅPP*H圅@ 0 ;0K0C70K5 K0 8@K40K0 K+K:@K9@K3K2K1K/K.K-K,K 070K4 K3@K; K:@K9@K8@K040K0C3@K00K`P@ 0 CKL0 0D@LKH @@^@H]*zhy@DoTA> -@0L@M 0K ?0CKK0K@K@K@K@K@K媆PK -0L@M0K 0CKK0K@K@K@K@K@K咆PK -RLM R KV0SV WV0^8pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@KeW0S W 0-LM@0@SLR RR"K00S PϟL@ 0 忟0 S *S<K0h诗HK0h蓅 04SUT >0U0U0 0U0 U0<0H0<0P@0 {0<00 0-LM 0@S( 08 Ƞ,Ƞ#8t P K 08 ȠP,Ƞ #8Xt݂U  0S 880S4> -L8MTK@p40t00  4 08 Ƞ,Ƞ#8寂4 PPH 0SE 0 80D L P P 0S@00SL 0@S4PB   00S5 SP 0@SP0sB L0s? 0@4`W@V@0 P!1@ ,` ( 4P T@ D < 8P $p [}< K$ 0S%  0SUD 0 4P0 t`0@00SHU@Q0@0 I4>k0B8A8$AA AAQ Q  Q0 D/H(0$ 0,B$ i..-08 ?0R<  C480ti.. 0-@LXL P0CQ 0S0hW/ =8Xi8/ 0-@L~X4 ,0RP / 0Di0hW4/0/ 0-PLgX( 0S W0@@W00/ 0-D0 L@RX0P 0000Si0hW'D/ 0-@0L@U<@< 000%00CS0H(AD(( -LM`0p 0 0S"R" RR9 R7 R@ 1QA 0%͠ %L @~000Q00CS0#K 0K 7~ R0 QF Q? 9CS9999d9d999 0 ᕂ@ 000绀00CS0ᆂΚʚ C kH((D(9@AlAA 0-L@ 0P0 0Pˋ 0x哚h P00CS00P 0D f, P0ABA -|LM kl1lA ` P 0ՁP  4Y@!00CS0K + ;0 㺁P u >@0 ;0\ PipP [ p$@d@d %͠0 +L0  p}V@D(('\A|A(9A4(8(9 0-P0| Sx0@0L \0%P %|@0P 0,0S70 (((('$(A 0-|P| 0@S=L X0~P %v|<0P 0(弙0S704(0('8(A p-0P@ LR p>TT` TT Њ 噙T phSl 2S0ph|S<@< 000c00CS0.H(AD(( -L d  C0?`% V Pm%-Pb$K0S2*@KP0RK"K2K2R4 0R0SN2K?2K*@K02K00C SBx:p:h:D:`:X:P:D:D:D:0:0,"02K0"K*@K2K 20S` 10SV S*@KK!PK0`20pLK&;W?F K4K2xP`V000000 R  Bh1! K 0@] 0P `{ 0@P @ h0 RQ 0*@K2K0"K2KE      '$$(A'($ $ (('@9. -2LM ?Rp` 2RS 0RD Bv2"p 0 00@0T2T"@ [0P8B8Ÿ   @?{-0 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 D$K0S@? *pK2K"Kl1 *pK2K"KT1PH!0S01R 0R0AS:::x:@:@:l:`:@:@:@:@:@:@:T:0 00 00p p <8# $ $(.. ((@9'(' -QLM0`(!(嵗$K1p 0 ?% X00DP\Z,0@ /, eP 0 +  oz|P 0( Hu 4%=n>HA/.$( ((' :4A A -LM?p`0 \`,0 M \@1Q  A1(A(Q0 60 10Q @>0 p0pᴠᶐ,0@000e0 [@0P}@ 8p  @z i\0@P@(K(Ko>'//$(. (('@9. -2L PRh x R 00 0000ScwQ{P400,AP zP%{P00yP倖rPaQ@p0ꥇ nꟇ hꙇ |b꓇ h\ꍇ TVꇇ @PI(D/D(//(((lAAAtAAA A -LM@P` ˅P / KypP8 1!@! 0 `p0C `d!(0CP\1p p pXy0`S @00S ; 0@S JyP   0P0  P0 0   P  ܕPbP `ЕT̕L0  @3 A''0/4/(( A/P A AA4 AI(9 -LM 0S  0 Ƞ8,Ƞ#8' yP >- 0S @Q 0 S  0S pk?#=?c1P20`<Pr0` -|LEMpp, wP <, 0RI(K(1^ L0p 0 ̇ p00@0 1  -LM%PA0AS`0  OŸ pW}  0 00S0N N. 0@ BT0S*8S 0A BT>0S*mO  0p0C 0N 1R0' '  $8$80C0C$8$80 $0  0$ =P05 EO  0p0C 0N$Q ᴲ5;5 1R0! !  11D0C0C11P  kL$ K⸿@P P  _LjN5;5 p-LM PP@` 0 0T TT T0 Kp0K w0S0 0@0@Ntt  0P0C0S 088;8+N0*0 0@0@0 z -LM5 A0AS%P  K0v`PpN00 @0@CM@`V@ 0S  0$K*wAC$ `zV@1SM! p-`RL@P0PS00 0S h0 00S v00U@p -0CMLP00@p`pVPt0xPh `Xv21CC=0P4  00 pW@7. p-@RL`kPP ; 17p@ ; 0 0P Pp7p; 00 -LMMĒ0P,0 2@`puP8A0AS 2ŸB0  @6vx, 0R(KW WW G |wW 2y>K pav01S 0 0$ BL 0! [L! 01H 0 0HLµD 0 0@0@M@  s7PB D0S <pp 0 p0 !0G@00 1 ,K -`0P| @pULpG?CwP HGuD0P F( 7P 76  Q-L 0u -QL`@pPp8 Q Q  |0yw P0P A`0qphS A00 0qhl -L M@pH`#T'Ġ$$H0K/ K+K)K.0K-PK,pK*@K(` L|p Ww 0K P \0 @`ux (0K@`DutK$K  -0LMp Q@  0R,K01g _K3 0PP  H`K(3 T0`PP yK j@Do  0> -2L`u0PS@0@0St2 0S\2tP   0@0S02 0SPP~]p 卑1G P1 0 0!001!@XXH80` 058 P@?*. *hPd1U@=08 0``414!801!1(!(10@!0\ṃ1!" 0  B0G ` X0,EG 0@g0  @00@0]0 @000hsx4 AkM=:3:T:h :5::87:|42A -p1LMh!p`A$ p0S@ R K$ KeP;$0 SP@! `$0`0dS$0   S@ȠK8#蠑ࠁ,Ƞ@ 0PP|PP F0K8 #H?0@ h0@fPP0  0,噐V?Cyu~kAA -L M@03 @?K -LM 0 @K@.P[K -4LM,2 (B`( $ p 0S@Q$K( KPP  0L1r K$p P0R0O R3 R? R= 1d~ 0R0O$/.K0 PP 0A P 0  @} p 0.@K@P (0 S@181#1K#8!#8! PpP T(00dpPP(0 $i/kAAA -L M <#83  K p-LMP0`@C-0P GP 嫏x1FrKpB- sPXπ L囏 P0S00!0000 P P 0S PKP0[SSS0 # > R K 0P 0 R l0 R g0L LH4 0(H Atk A`Do<%:j#: -L M0 @" @K -LM@`P&pKUPD0} P!0[S S X0 K -L`M|K`@P  P, pD0@A$|0KV0Cy Kx@KvPKu0KzKw`K *@ 0@@ P, 0R (KG4s0KtpKV tK g@DoD> -L M@Ƞ,Ƞ0@ }K -L8M0TpKP`0 $0 @,0' PKRKT0KQ@KS@K;: JK3: 00*0K*0K& Kp00 /0)K(0K0'K%0KP $ 0R  KU KKPU0[Sg@DoT> -0LM @RP `Ktp 0 S K U0 0KP [PP -@LPH5p=`5uP rAsp\@P r9spF( HC CiH 0-8L@@0P`0A0LmP0PgrD0Pcr00S \YY0 -L|MȂ0PKp (0 %χ 0@P ( 0R$K蔠Kl X2X" 0Q0Kh D2 K@K@K @K K K@K21Cc!0 0K#0P+ K0KKKK@KPK|9S@K SPK00K&MK@``KP21CcP U `% H)KHIdPE 0*KK,@K)PK+PK l @P  =@P@PP 0PP@P 0G@Px| 0>@Po 0P6@Pg 50P.@_[f@Do>* + `> -LMpPG5@%dP)vP!818ABm8` 0tP" G5@0;5FG@ 0F KIP B=<0 _tPp@p p0F-\( ` `orP FP A4 A6 @: -PL@`pVG10&S6 5:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:4:@(@3%1 @vF "4P@5A0AS?4@D50580 R0= S @S @ ' 00  0   -L@~4P 5A0AS 4@ -L8M0XpK`4 $0 j%H)@P00 NKX0KVKO@KT@KS@KR@KQ@KP@KWPKUPKQ0H)|0& KQt0.PK d0@-K- K*0K4 0C7%0K(K'@K,@K+@K)@K,$ 0R Ke@Dot> 0-0LPynPp00S S 0P PhF@00hE0hl0@ 00CSX8:`8:h8:p8:P8:8:x8:8: P P@7P,@nPX@l`0 $H0AhSwh::::::::::::::h::\::::::::::::\::::::::h::::P::::::::::::::::::::::::P::::::::::::::::::::::::D::::::::::::::::::::::::::::::::::::::::::::::::D::::::::::::::::::::::::::::::::::::::::::::::::D::::::::::::::::::::::::D::0 0 Rf Q Q0-L@P I  0@AT  08#0`08#0@jPj<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:=:<: =:<:<:<:<:<:<:<:<:<:<:<:=:<:<:<:<:<:<:<:<:<:<:<:=:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:$=:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:,=:<:<:<:<:<:<:<:<:<:<:<:4=:      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFhV Ƞ ,4V 0 8000L0Ba21C0aT  Q  R ,{0 0 颋.P0?:8?:@?:H?:P?:X?:(?:(?:(?:(?:(?:(?:(?:(?:(?:(?:`?:840,($ ? ???$?,?4??08 Q-L 0jll R0-LP 0h迉0 @0C 00h @B B-0@4< |404lP 0F 0hW`PAl -LM⨐ lP# 'lD`? p0K ,K0KFMX T0P/K@N+K0.K-K*PK)KnlnZC gn(Kl?: 0-CML,@P0PS 2l000U00 -LM!T K\@Cd@p$K$K#K!@KPK`K"@K0KoP fz /KlA p-p0LM@ KK!"T`  K@0 0KKPKK@K@KoP Dz KplA 0-0 @L$8P0 $ 0 $0h 0-0 @L$8P0 $ 0 $0h   0 R   V p-X0(  Q@P PL0@`[o  ph -d@L x8#H,"(q(R -(j(R  hbfdh -LM!T K\@Cd?p$K$K#K!@KPK`K"@K0KnP y nKlA F-0- PL@0NB B4<m{[@Q \00HS 0\ 0R B0HSQ$0jP 0F 0h^l 0-|0L MKP?0@!0KB0K KKK0K@K@K@KnP[K0Ry lA -,L@8    hD -,L@8   hT -LPp`@x  @T`hT @46%CA("(0$(1 0p -L@0w3`PPO P@l3l#0Pp1p#S,L:L:4M:4K:dM:0L:(#$3!3yDp V ""2! "8S 8S F V  F#NvlBiD2!\ (""2!#)D !!1!#@ !1!#)D }VP! -wT!rP1!m#@  f$1!a#)D [0V  T O K0!F#)D @ k -:8 6<0!1 - -X>0>>ب>P>>>h> -LM!T K\@Cd? p$K$K#K!@KPK`K"@K0KplP (w KlA p-LMPK 0@![B=  0[0K[!Š  !!R0!aP P` 0 `/0G-  0G- <0x 0-0h 50LSP0CS005 0hs(啅00 @0@0? 0-PPa#C C-0 ß  PgiPࠁehß, 0R(Kp3 PʌX 4!R Rڬ8S S0 x q#H0820 003\mX 4l4@D d@D \@H$H@H$(D8 < 81S'`` 74D(? 0@0'PS@ @ GŸ0 0/.000b0 q @B `P>HCM0 @00 >H!080 <8\p '.0 8P尰! X 0 P PfGiP@ ᙰJ 44@D^ @@H$DH p-LM5`=@SP x 10R''  $8 0C$800  P  ; gPo1  050(AR?@q8S q B 1AS T1 RL0A@T;0S*DP  Y; K⦮@P P  M; )P Q0r0 0@0@x0 Rʁ. 0@ BT0S*0 0  P 10R!!  10C15;5xx` 0-0CMLP00 @0POhPt eE=P 0@ T0<  0$ 0d`l $ADA -$1LM`p@)pK!hPP  00 ePe (KȐ  )0K pehpP e 0⪮0+S < 0 peh@el -RL@ ZZ s 嘂Z& 0 0@0@$=0`p lP因 0@H0 @ mc<0NhhA` 0-0@ Lg0P  eP 9PP ;] 1  d0 0T? 0<804$0lAA`?? -LM`LS@0 @DTD@D@=dTd >SdT[  "PP@ $K8p0(OpF-0 NXH M~c 021C! c.  P0vU1f1P@, !ԡB= 0  &i@P r 媁妁@1B}p  0i@Pl@P X品r D十8剁P 偁 @A!ˠ0C- bdfP@ (R B 5RN n   550;@05(R  @] B@WTJP̦>"VSlxp AAt`A@AAAd:DA -QpL`@cP@ c;1PT- |10Sp1TI 0?N@4T@ H1T# @1T  ᩔ4P@# :0e505 0S0C5@ @@ @ ሔ4P@8S 5A0AS@@ Y0?N@5A0AS @li ϖ1i i i -LMȢ0R,0 P` \\ \? "ˠB0L  @ce, 0R(K >Kc0!#R0 0@0@0@ TD D H! [pPo ;H!偭1 i1Ef p00p0pD0T 48<#8:#:0 0:@A@ 0S) 01  D 1p 0 K p0C 0D< 0 $1 1 0H! 1 `? -@TB]PLp`*_E ($VF "V 0 p`_l -1L@fbP*10P 8R0@T1T!8!L1L!1!,0@ 0`{ Ip1!1#2!m  X02 0 D0C @<0D BD0(K(Ko~ (Ko ~(Ko~lAtxpg:i:@:|XAM=]=b:W:4P:h?:g:i:!,TRA,A A -LM 0S  0 Ƞ8,Ƞ#8 aP > - 00 LR s  0 0-$@0 TLP,00  0@T P0 P 00 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -LMQ@ 0?.C""0T} Q}AA -PPppL* 0 $P `U 80S T V0@T404040@YTW H0 ST404040@ Y}A -LM`sx@V spp0$ 0QH< P$ R 800 QPR 40PP  X00 S P<0W)< < 4<8  4   4 @Kd d0, @@ 0 [P $000S$ 0040$0$40HP(00(0(K }Pq:o:A -LP00S 0 3@Ń 0S 0 S ?>#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0llRLT.N -X0L@laR 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00hNL0& N\0  L( 0NL0& N\0L0"{N\0  L0# qN\0  L0# fN\0X 0@ X h00<0L 00TNX0L0 h X0+0 BGN`0  LX  0h0X 0C+ 7N`0  X 0@ X h00<0L0 0%N`0 x 0-TL,0@ 0P 0P RMg0St0 gP S tx 00PPx0S -TP 00LR`p @$<0 T ,005@@h)5, \00Q0S 0-(0LP05X0@08X0 T0$4P0T 0h5 p-X0@L$!;98 T8}6P6dU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@ `0   @  P0T$8 8T$8 <8T>X0.L 0\ <#3  `0 + ;8#(0T$8 8X0@ `0T*, ,0$8 8T$8 <80 X000 XFS0@56}T 8 T0$4 @ @000l@X0 O}Q0BA8z: 0-LTP 5& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Kp0 -T`L0@' 2 1C P ^{zY$8 80T$8 8X0@80T$ 8 $84  X0  ht>A -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ES: :l::0% 8T0 $4V>0$T8 8Z)00C0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP > p-`L@P  xDA> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@PH:<:<:<:4:<:<:<:<:<:<:<: :<:<:<: :<:<:<::006000006000006000006000006000 -@L8T$ 08 0-(0PL@  0ES:,:x::0%W&00@0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP > p-`L@P  p9w(0hL0 P8 TP0X0T$8 40 \pph>DA> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-(0PL@  0ESL:d::@:0%X00r0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S+p -LP @> p-`L@P  pkv(0hL0 P8 TP0X0T$8 40 \pph0@>DA4> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-(0PL@  0ESx::܏:l:0%<000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S`p -LP 航> p-`L@P  pu(0hL0 P8 TP0X0T$8 40 \ppheꈪ>DA|> -@T08 L$4@ R\ &RZ X0`0B%S&ԑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ԑ:ؑ:ؑ:ԑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:ؑ:x:ԑ: &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 8 < T0$8 4PT$8 08T Q-L| p-T` @00@,0P8T0L $4T0@8$ 4 ,00,0 0@0@C0@ @0@pX0 @0@ @0@ @@0@0@ F0@0S p96@0S0@8 T0$4T0@8$ 4 00<00p p-(0L@`P# 0BS :$:p::0% i0 8T0 $4T98$ 8(ppBp L0"S p L0"S 8T0 $48;T$ 8p L0"Sp 0- @L8T0$4T98$ 8P}U /T0$8 4 P0 -LP 踪> p-PL`@  t(0$L018P0 0T@?>C2@0 0 X  8@0 SC S  T0$84  \ T0$8 4`phhX0  8T0 $4T@8$0 88T0 $4=8$T= 80$T8 8P0X0 T0$8 40 S@098$ T8P0@0긪>DA> -@L8T$ 1<8 0-(0L@P0  L0"SU U U )000% Lp080Pt A p-@LP`as(0L0 P8 T@00X0( R XphPs T0$84  \pph A> A - 0LT@მP0 3@50  S R ?  !AZ -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 P  P8T0$X 4 000 0008T0$ 4 00@ 000  000!A B -(0Lp L0,S@R R R 0%  T08$4! 0%!R T0 8`$@8P0  0T$8 8Zs!A 0- 0@ LhPP 00 3@5 ? 0pP  kP00> B!A p-L@P`hP  r(0xL0 P8 T`00X0T$8 40 \pphq>DA>D!A -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@L}8P$`T0 8@40 p 0-(0PL@  0ESx::ܡ:l:0%> 00'0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP > p-0L P3 LP@`( 0P?> S0P0w  q(0L0 T`8 0P X0T$8 40 \pph?( P 0 3L>>DA> 0-0BPL@ S أ:x::: L0"S0%(y00 L0"S 0 L0"Sbp -LP ,> p-`L@P  tp(0lL0 P8 TP00X0T$8 40 \pphf,>DA > 0-(0PL@  0ES\:t::P:0%E00.0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP P> p-`L@P  p'p(0hL0 P8 TP0X0T$8 40 \pphP>DAD> -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@L$8T 088T$ 1<8 0-(0PL@  0ESꨨ:: ::0%rA00[0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP t> p-`L@P  pTo(0hL0 P8 TP0X0T$8 40 \ppht>DAh> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ES:ث:$::0%*{000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"SNp -LP 谬> p-`L@P  pn(0hL0 P8 TP0X0T$8 40 \pphS갬>DA> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ESخ::<:̮:0%d000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L;P > p-`L@P-  tm(0lL0 P8 TP00X0T$8 40 \pph>DA> 0-(0PL@  0ES̰::0::0%i800R0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S p p- 0`@LPZm 0?.C""Rm(0L0 P8 TP00X0T$8 40 \ \0 `0  ph4ph-mT0$8 4`"A"A>"A0 3$ A5S ?>S @ -T@ 0LP 0, 004Õ0_ p,0S,0`0,0430p , 430` , Q' <#0B RSQ4300 ,00000000004300 , 00600 0060000000  @  \0  006000 , \0 @- 006000006000<3 SS430CPp \`,0p 006000\0  006000 00000 -TL0h @4Ô0S`\p,0h (430S`h \@,0h  -T0X Lp Z @'}Ty 430` ,: S@@430S@0 \`,70 430S@0 \`,<0 430CPh \`,0h \0 44×0p 1\430S@h \`,0h 430S@p \`,0p 430CP` \`,:` 4×0p 00\X00X0 -LM(0p R R0 R  N L0"S&  L0"S5 @430` ,Pd0h 0Sd0X0d@0X0( L0"S5 0X004Ú00 ,0q,Q,  Qb Q{ 430S@h \`,0h 430S@p \`, 88p 06S\ 430S@p \`,x -@Lk@0S 8T0 $408T$8#8 88T0 $4 08T$8#8 88T0 $408T$8#8 88T0 $4$0 08T$ 8 -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P  00P0P000T0$8 40P0PPP0P0PV0Pb6P0P 0-(0PL@  0ESп::4:Ŀ:0%&w000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"SJp -LP (> p-`L@P  i 0?>C2@0( L 0P80TP 0h0X T$8 40 \pphI(>DA> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300  00000000$8 0T8T08$ 40S:::::::::::::::::::::::::006600000000000 0000000000 000 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300  00000000T0$8 88 T0$40@8T$ 8?< S00000 S00 000660000 S00 000  S00000 00 -@LP0X (  `0>T$8 8@0TS<<$8 88T0 $4$8T <8$8T <8\0 <C30; 0-0PL@ 0T$88 R0蜮> -@L8T0$ 88T0 $4;8$8T#8 8T$80 88T0 $4;8$8T#8 8T$8 0 88T0 $4<88#8T$ 8 0-0PL@ 0T$88 R0脮> 0-0PL@ 0T$88 R0L> 0-0PL@ 0T$88 R04> 0-0PL@ 0T$88 R0> 0-0PL@ 0T$88 R0ĭ> -@L8TD0$ 88T0 $48 0-@L8T $98P"00U 8 T0$4P 0: -$0p L@@00C*S,h:X::::::::::::::::::::::::::::::::::::::::::"P6X0 'T0 P3    @0S 3  8@$PT0 8`40 D0SS]P PT05P#"XX0  d5X Qo!%{X0  $8 08$8 0T8T 0$8 8$@8PT0 8`40 $P8@T0 8`40 X3P3<$QQ ,4Q \3@ `38#8S $8T 08`3$88T#8 88T$ 083ZQT3K?3E*3=37$8 ;T8 0T@$8 83#T$8 28;T$8 83T$8 08Q*00 R0SJ #G$8T h28T@$8 08<$8 8$P8@T0 8`400 X3YT$81 8$P8@T0 8`40 $8T x18$8T :88T$ D18T$80 8$P8@T0 8`400  0T$8 8!$P8@T0 8`40 $8Tt0 8$P8@T0 8`40 #A#AW WWW  Pp -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P 000 00P0P00 P0P8T0$4T0@8$ 4@ 0P0PVV0P0P OP0P -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P 000 00P0PT0$8 4< S>  S,  S>  S 0PVP0P S&  S=  S6 @0S0  P66P0P0S8T0$ 4  00\0P0PVP0P0PVP0PP0P0PVP0P0PVP0P0PVP0P0PVP0P -(0LPp` R R1 R)  00R. @0S5 S S5  L0"S1 8T0 $48;T$ 8L0 S=  L0"S, X00R0S D0SS0% P 00Su(:8:8:4:8:8:P:8:8:8:8:8:8:8:8:8:H:8:8:8:8:@:0 8T0$4T0@8$ 4~d0h 0Sd0xdt|0$6S8 0T8$8 0T8 0T@$8 800S S SO$8 0T80T  0$8 83 @ -LP > -$0P L0@p`國PY0  W   :c(0L0 8 0?>C2@0 T` D 0 X0|2P0xX0 0h0h0X00X0P T$8 40 \YL0"+5X0 P L-+05MPX3\L  0m5=PX L# 05L#,05L&*0y5L0&!,q5XL00@ h5L00-`5T0$8 4`P P3#(x0(Rp0P0y h0Rd0P0t \0P0qL 50:50J#A>DA>#AW> W>> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S t::\:P: L0"S0%A00 L0"S 0 L0"S{p8T0 $48;T$ 80 -LP > p-`L@P  ta(0lL0 P8 TP00X0T$8 40 \pphp>DA> -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S |::d:X: L0"S0%00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L]P > p-PL@`O  `(0L0 P8 T`0 X0h  T$840X  \\0 pphL' 0j3L' 0b3>DA> -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 `T0$8 4 000 {`8 T0$48@ T0$4 000000000000000660000D k7(A(A(AP>(A -|1`LQPp@(0 0GS `::x:P: L0"S0%  &`L0!S  L0"S0% 8 T0$4T0@8$` 4@d0h 0Sd0P0d@pD k`>(A7 p-L`P@_0 R$(0L0 P8 TP0 0h X0( R pph_ T0$84  \pph _(AD kD> Ap>(A -0 3B5L  ,0P ? A -D0LSp8T$ 08$8T :8T$84 8$@8PT0 8`4; 8T0 $4:8$T#: 8$8T 08$8T 08$8T 38T$8: 8$@8PT0 8`4; $@8PT0 8`4; 8T0 $4:#:$8T: 8$8T 38$8T 28$8T =8T$8w0 88T0 $4:#:$8T : 8$8T `28$8T H28$8T 028T$8< 88T0 $4:#:$8T : 8$8T 18$8T 18$8T =8T$80 88T0 $4:#:$8T: 8$8T 18$8T 08$8T 08T$8< 8$@8PT0 8`4; $P8@T0 8`4; $8T 08(h e A` -L@4h 0-D0LSP@X0T 8 T0$4@ 0$T8 ;8: -@LP0\ X0,B# 0;8T $88T <$88$   L0"S 8T0 $48;T$ 8 L0"S 0% P0T$8 400S-:P:P::P:P::P:P:P:P:P:P:P:P:P:X:0% D0SMT08$ 4 d0h 0Sd0@d@@ 6S) 0S, MS 0$8T 8<$8T 80T$8 8^`U0 +0S, @T08$l 4B -LP 茱> p-`L@P  \(0$L008P0 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0  EP0pT0$8 4`ꌱ>DA> - pLT08$48?N T$4$0 0卄P$} 0I+S,0:::0:::::::::::::::::::::::::::::::::::::::::, o\ZZ q8@$PT0 8`4: $P8@T0 8`40 ZZ =$P8@T0 8`4: 8@$PT0 8`40 $@8PT0 8`4: $P8@T0 8`4< b$P8@T0 8`4: 8@$PT0 8`4: )A)A -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300  00000T0 $84 R00@000 R00000 R00000 X2[00 660000T0 8$40 0S  <00<)A -L h -RLpP`$ R5 R ] 00R , W00R0S L0"S5  L0"S 8T0 $48;T$ 8 L0"S 0% s 0S@:(: ::(:(::(:(:(:(:(:(:(:(:(:0:Vp@6S$8 0T8$8 0T80T@$8 800S 0$8T 8 p-`L@P  JZ(0L0 P8 TP0 0X0h T$8 40 \\0 pph T0$8 4`꼱>DA> 0- LP|@ (0\ 0| ,0\00 -PLp `0  P4 P @ 00?T0S @ 00?T0S 0S $X@ R 00 -LM`p 0K@PP R  =S  R 4W 00 R000K 0-LM 0KP@P   K0R-4.\ 0S0 S 0S 8 <S S 80S  8 000q - 0LS@ 80#,R R#80S #8 00 P0 0@ q -L M,Kp 00KP`P( Z)0  12[((18,0 0 @T 0 P@,  X p(K -L M,Kp 00KP`P( Y)2[((8,0 0 @T 0 P@, 0   X p(K -LM` 0K PpP V   R @ 0 0TVDA@K 0 ' -L MP`pVC <0 81 R9P@< 0@(TP<0  <@0 0 < 0<@< 0< K $0K&P `VK<X t<$ L0  0 <$  P0<@$  T0<$ H0<$  T0q -L MP`pVD`VA <0 @P<0 P(U@<0  <0 <0< < K $0KP0 R <X< `VK<0$  L 0 <0$  T 0H0<0$  P<0$  Tq -LM0` P  YD (3>*@ ,0K]P@XYN (K0K4K8K,0 pP0Q ,0S$ *80 P 4 0IDP P,0@ 04 0>DP,0@ YSP 4 0(DP 04 W0 ,0 0400 @0  xJx00@$&&Q020a00#40 540 %0 P Q 4 Rm 1 *0*Q020a00#40 540 %0 P Q 4 RE$ x1 *0*Q020a00#40 540 %0 P Q 4 RPV QT 4 RQ 0CPM 04 V$ 0B04 V0 ,00 @0 ,0P 04 `V H00CP 04 ,sV0 *AL*A)A$*A p-LP3`P PP @T0P0p -LM K?K,K <0KP ,0 h |0 0|0 Q$ PK0@PS P <  < @P pQ\ eP0@S0P0`P0VP0< (3:V[ *   -Y`P  0@ 0 0PY`ʠ\V KT T0;4@#` 00 ;l: -LM\0, S`<@E\0S?0X  P 80Sp 0("(R R  !ZP  pYpP U0X  ,0 P00SP  -\PL0pS` @0 \@ P0S k p-L0P@`TP`000 4 080 < 0@0 D 0H0 L $0T0( X ,0`00 d 0(\40 h08LlV 8R ,NP$0 PphF0@;L;;q -LBMp0`QP 0  NK48̠0  xsT, (loT 0RK(, NK<cT84̠ 0YTv-@Dox?t*Ah(@(> Q0-L@P Q Q@ 00h//@E0 0-0LP@|P  0q( (QP00 p-@LP`  p p -LM@ P`,0  1 0  0   p 00  W% ,0S$ 0,0  0  p 0 W -RL M@PpA?QX@  %,   `<  0  8 0 X04 00 P<QF,T  z @0 Q (K9TX] 00@8@P` H D HpK pPw`0@0K 0 S SM S0S00 R 80 0b00 R 0 000 @ 4 0  0  40 0p80 0b0'SZS40 rQ *A*A -L M@00@2K R-LP@`ca _  / 0  p 0 < 00c0 3 Q000S  Q0 00   0   0p0 JS*A@- @ @ @@ -L M@00@vK -L MP0`@ 4K0K 0QpP00S,a P  40R !Q30 R@P p(K 000 0S 0 0@ 00 Z3 00 0@  R4  4 0S 14 5,0K00 0Pp\@ R,00 0S00 0 R400Pp 00 0@p,0 S!0Q ᆀ.4>< 0P8#=Q0S P`X?L 8Q#Ƞ    Q 0R S0RSظ> -LM0!Ƞ8 p 0 <0 !l*ȠP4 ,  , "0Sn 0VP0S P0S@XT ,Q$ ,0 <!Q y<00! `(KoQP@T 0S 0W0S 0S @40 <!P8, 0Q0R0S <  yy y0S( T \ < ` P y<0 `00(KoP Ƞ,Ƞ4 <l l0PP<T `pP<0< `0pP>@+A+A?+A+A*A+A\+A4+A p-X0LP\` 0 T@0 TpQn B -P0L @R 0 T0 $QnB p-LM`@PT x0SKp0K"0 0P80  P P cQnn BB8#8 S- H 00S P\^ 0\b? -0L8 $0CU0S, 0" $0@`P! Tp$0! `L@0 P à@ 0" T0 8 T0P@! T`$<<0! 0P@; T`$<<0; 0 0P@ T`$00  -L@MP`48T0 p 0XP@ 0 0  00  00 00 00 3101 0P; X8 @0K8KP@KHK0  @XPZ7 <0D4  0 0,K$P9 XOQ 000YlZ  40<L (K@4K 2ᇓ  00 !20@ 5   1(Z   $0   $ 0@, R @0  0010 %0",0 @0  0@ PI@( 0PI@ BB -`Là p" P x| $0 #x 00| Tx@! |0\ 0i[ -遒ၣp LM@P`   0P, f(\0000    0 $0 ,  00100(P@P"!B0,5 0P(P 00 P% B 010(\  $0  B 0 @ 5, d0%0!D0,(K, 0OH ,B- e -2@001"L M`5PSp (K,0K(080K 0,pP  0TpH=00 0 8K,  04pP=008 0 pP  0pG 0pG% 0pP  0ppG 0   pP  0pGhBBBBXB -pL`@P30  0 t0S#PUO aP3003 -LMp,0 Pt@`ph0l hl0 0X 0  0  P#0 0X 0  P,0  0 0(K$@WG 0  $KGvBB -8 LR`p+p@PPLR@"ڰ5Sx0! |$8  3N.P8 p $G8 PLR@B -80LS@-Pp80PSp$x0 |$0S`3.P 8Fx0 |T80PSpB - 1L@0@ ,8#8@ p\0` ,0` \80 PU@`$PU@` 3B@ @-P80 0F80PB -0pL0@ ,80 PU@`$PU@` 3B@ @-P80 0]F80PB -8 LR`4@P5S)#200%10Rp 0 0QQ+ 0Q( <Q% 0Q" 9Q :Q x0! |$8 PLR@F-P8  4F8    hMhbiMuB -x0|`L ,8pQ&@PPLQ@ڰ5!S;2 3 -P8 $0E8PLQ@B -80LS@-Pp80PSp$x0 |$0S`3,P 8Ex0 |T80PSpB -`u Lhl8 R$@ PPLR@ڰ5pS5 3,P8  $dE8 PLR@ B -P `lLh~W plhy8 R$@P 3j,P8 8 PLR@ ڰ5SU UPLR@ p-LM`0 P$p0 4@0$0 0 P $xhE 0$ 00 P $<xhD,0( 0  ,0xh3BB4 k -LM1 P$$!`p0ba p  aH1@!  0 P $ oD04 <0N>00 P'4@@0  !  T 00   P@T10 $ L ( 304$,o~D$oyDo? B k0BTB p-4LSP`p @(0@TTp -pA Lhl|8 R@ PPLR@ڰ5SX5#20010`P8 PLR@ W+P P Z8 -8 LRp@PPLR@ڰ5S5S #20010`P8 PLR@"+P P X8 -L@qPh+ -d2 @LTH` D2p\4 <\0@ ,0PS@Y;,Y;X;@X;,X;0 iC iC0S@   Z0S> 000`@VT330033p xC0#P PqC inC iiCfC  0T 0 $  $ 0 $ 0` $@P$BBBB0@BB p-1PL$+` 0\ $+ 1\ $+ <\` 0$+,0S\;[;Z;[;[;0 phB phB 21CA@c@$0 T 0 (  ( 0 ( 0 P (@`UT330033ph phBpP$BBB -t0 L@P. XpX`$ H0\W $ <\hKP#20 0p-L!0 00P0@!Q%`02PP p% kBp$r?LB#200 1t p-Q`L`@ń` 2PP 05p%DBpDBPB|B -0`L0PSp  0\h@0l hPl0 h  p-0L P0`S 0 ,Pph@0l h0l P -B"100a`10LxP\"T,100`10x "100a10|0pS$a;a;_;$`;`;0 iA iA0S@   a0S> 000@%XT330033w A0#P PxA iuA ipAmA  0T 0 $  $ 0 $ 0 $@o?P$BBBB0@BB - 0L@`0 PP0pr@D@ 0SP :0S:  Dh  @ 00  0080 p -LMP` [2p 0 >00 @L 80 ( $ 0@ P @$K00 @@y0t0 S0 4 !A> 000\ 0 506 l1l!<X0d 8 0(K$P9 0( ( @p(  `@1,Pp* W  @80S P@ʯ80PLS@P #20010p5S X\]@PY@W @T@R@PBB0@0;Г;(_;hV;B BB4B0@( -L`P@p3& Wh儀l 000 # '8Q 00B90908 809 80h40 lpWOi# 9080Q #:088 # -L@`p1# 000  083 08P 00B8090908 \^ x!0| Th| 908PU Ѷ# -P@h0Ll@ p# 000 %8P 00B8090908 \^ x!0| Ti; 908`V Ѷ#038 0:0S0:0 -LMPph0l@ 4 h0lH h0lD , h0lT 0 8 8`#' 000 rO8@080T8@00C9090T080@ 0,0 0  0Xoh00lT h@,0lD h 0lH h@ 0l@ 80S 4x!0| T(Ko 03   90 ,0.8 08@, 0  T  @8 0 00<  :0080 80 80 8@yn?n? -LMP`h0@ lph0P l@h0WT X l, ,0 - 000  :0 S#5!2!50 008 020, 0, 88\080900 808 0CR900G^h0l@ h@P 0lhWT X  0l, R ,x!0 |T(Ko 90800 Y 0  Ѷ -LM`ph0P lhlX h0Pl\ h` l@:0h!2# @00@ Pc @% 000  :8! d00 0 0 083 0. 0d8Q 00B90809008  P@TόY x!0  |Th0lX h@l00` (Ko] 9080Q,0 0dж#ѿ 0d,n?n? -L$MH 0 R h0l@ 4B40h< D l!02018 L0 L 0H4 D0 , 0@ #+ H000 aF003 0S 8P3P#0<02 < h0l@PH @ (6H @ 0,Z㏏0 , 4 RLH0 RU h<0l@ h@l80D (K 03 0S 9424"002<0< 4  0*4 0 RV :1!1 D  0<1Ì8 < 8 4 04 x4!0 |TH0 RLh@ <0lh@l80T h0lO 010 BL 8 < ;80 0<04 "Œ< U:0 0 <  28,0 < 8 9404 0<04 "Œ< ~n?n?n?n?n?n?n? -L M< h0l@ h0`lD h0PlH <h0l@T H H0<  < 01D T" !0 0  @P04@ , 8P 00 @` 0D 801P %₡140@0 4  F5003`VOh0l@ h@80lD 0`!Q h40lH h00lT ,0S Hx 0|T (Ko 90 , 08 , *8 30S:0 %90@ 08 0 ,*ƌ8 , :\h0, l<0  020:0 n?n? p-L`@P3P UOphL'303~ -LHMP V?$7 0K$P s;(K 00 (H 0&Q 6Q d0CQ   D 06,p6QJ0CQS:  0D   L6,pp0S- @x|,K  0 @@PPt&; 0p 000 0@ @@P;5%00\ 0 405 0p%60X <05P8 [0CP <0CP  l 5\0H ,008080$SH 4$L0P D 4 < @ 8 @ <2001T 0p 0L0 00%5@ 䐊 z*P @04X 40@0 2\0  `10a8000T0/0 PX\ P0@TplU  U !00 @ PP tD@ :U4 01040\ X0!c83 01@a<000T0&.0 PL000T0/0 PP vL\)x04@CQ1P%0CP*z>CP01` \080!1` d0D@ 98pD@ 98pD@ 98p0P 0P0` \00P 0PBt55L;=K;BB7;Xx;3|C;t8;89;8B kB BB`B0@0@s= \;Z;`BBBp5 - L@`pP 3  0UP/^ x!0| Th& 0:0S0:0… -Lp0t#QQD d3QA `@P* Z 0:e03 (3  (Ƃ83#00P0U05 h  !` lPUOV x!0| Tmx0| $hl@P ;: Q-2 dQ1 :0S. 03Vʠ 0e91 0 0(Ƃ W1  v"R:0SQ0v2 Q :0Sv"וR0 v2DžQ41 ( 020x0| T 0    9x ! |\O0 K  00S0v2Sv"R:0S0:0Dž00S0:0Sv"ׅ0R:0 8M0Mn?n?n?n?rn?n? -LMPZ `lh@ 00CS$; ; ; ;;U8(Ko !ܡ0 , @p3 pWOX  x!0| T||!|0 , 0DSGTK \!\1\0 ,0  h0  !@ l3  03 0bY3:# 01  h!@ l 8 R90S0B909 0, 1 800 1:Q0:0ą P0PP00 , 0  00 , B0 kD kP k k k k k k k k k k -LMh0T lP,"00 e` p0 @ 001.0#A#0 0^8 0 ^2 03:@!001P0S8֕I 0`!Z 0 hlpWoh0lT Y  x!0 | To#9 80P808SP0@00909 0R8 @@hl/Bx0P :0S0:0ȅv2S0v2ȅh@l0K ,0 d00,K l@8ro?o? -LMB0 hh0lD 0 24 , @pP3Z_p4 R 004x! 0|T(Koh0l h 8 l000! #*80 \8000C9090,80!h@  1l h8  0l#  4 04 :L08 # #4  0*984  \$o? o?o? -Lp`@ 3 F81!0P h  !D l0 0  !E hlXOY:Zh@lPA 0 # 00A #x0@P|pA@ T`$0 8 R 9h0h 0 2P9B0S9 x!0  |TLo?Qo?Yo?Vo? -LMP`20`,0 @ip0 3 0,,\ ꠏ;;;x;x; 6pWO h!@ 0l0 R  0x!0 |T(Ko ,980 S8 80RQ8,, 0 00 81 *0#8 0 9:S0C0090903H hl 02 :0S0:0ą, 0LSꀐ;;l;X; P5,0:0D :04 :$0  Bto?oo?ho?bo?\o? -LMp`P@,` hlW 3@@p 8 80D!1h! l0`VO,0S  x!0| To 980 S8 80RS0C00909,  0&, 103 h Q l^: , 0, 0080! 1 :\0:0ąo?o?|o? -LM010p,0 `RP@3  0v90 90S`80 4 21 PU@h0lL 0u290,0v`P  Q10Y  x!0 | To?o? p-L@P `3  0 ` 0 `PR @0 100b 10t UphN o? -LM 4 8 hl ! 8Pp`9 000    @0 < J : 03R  :0S0@ 0 100T0Cp T:00":0,",Ÿ 0 ~8 0Ō<@8 pPUo !  0l8P 4 x!0| T(Ko < @9 AX1@ @ X@D@00  p E0 ,4  ?8 08 <@8 A@0 @ \@D@, 0  p &,  ,4 "` B   0:0  :0S0@u0@s00   0@0:0eKr?Dr?>r?4r? -L`P@p# 820 000PQ$9 1 00hSlWV T  0pWOX  x!0| ToCW[ X 9 0S0A9003 h!s l:\(60S007 00!s 0hl l!s h~ 0!l0s h8hly mP0:0:\070 `r?kr?er? -LM`Ph0H lh0lP 0"0c2#p@U3  \2 n@ d, + 08q 00 C9080\ #qq,  02\ 00B9080908 Ѭ1a 0 # 00!@DtZ  x! 0|Th0lH h@l 0P   03 6 b"q0Q! Q& Q : 008:0Sv2S0v2Ņv2S0:0ŕ:` 008 :D 008:, 008rr?r?r?{r?nr?ur? -L M`p0h0l00 0H ,0 hPlP 0<Ÿ0c2àh@ l@ 4 @Pe0 08 00 I 0,1#QP^ 9080\ 0>\ 00B9080908 X1a 0 #< 00!PEuOY  x! 0|Th0lH h@l 0P (K  03400(::Q0:0ą` 0`20804 13803 tr?r?r?B -L MPph0@ lh0@lD h0lH `8 h0  lT H H41 (KH 4 2 !H 0`0<` l 4 0 , ,000Q q0Q p3Q`3Q T3Q L3Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q: RxR::<R0 D0v"2QQ:0S0<D  00 j h :X"80@D 188 @ 4, 04 , 3b4P,0`S  8.,`⏏, I 8wH9a<  < ,0Q4\:h0l@ h@<0lD h80lH h@l 0T (KoS0<:< : 0@ D 0, 0Q3@ 9 `4x!0 |T0:0D 0 t@ 9 H 9b<00<0 {%&$vJ$K$$r? 0-@LP3 0 3 h0 0@ 0 R 400h  @ r  -LMp @x2hl$ P  $ 0A P 0 0U // K/'/t0 S01A0\000506 1!`<0X0d 4`8` 0$K$P7 0$ ( @P$  p@01,Pp U! /0 R 80SP80PS AP 3B@@A@@{D/P \`,7  0\B4B0@0@B0;;hW;hV;B BB S2 a 0-L @P 0 pQ ha0p00 p-LM@`S1 x0400@waPP$7/T U 5 001 `p05 0 5S(K0010@,0K0K @ 5S P U0 0Q x 0%(5-%0-DBPBIxQ;B|B -PL9@``p -0 <00 tp8[80S@ _80@SB -LMp`0 @P T 0t0,2 0P K 0PPPPt' 0  Q#* 0x|@P @ Pp3t0P0 H0H H0D0P L0D`K0,(,tP,4B|C;@;/;BBB -LMP`9, t0 S0 C0CS8;;;;@;@;;0601X0<x1 R080080`P80PlS`( iP #20010pA0K  ,0K@}Ŗ \  0" d5S B80PlS` $( 0 0@Pd `:9d (K0S060060B0@0;(u;J; -LM0`XH< PP+ xPA 8P> 8P 9P :P h0lP 4 0PP P' X8P$ P8P 9P :P 4  4 (8PP 8P 7P 7P 9P :P 40 8   8 -(< 000 7R 0RR700t0S 00l'A>000\ @4@5,7,'QQ  0& 7Q# 9Q :Q 6QPPQpp06Q <Q \R6Q00SW6 6@060T&T6QQ H6Q <Q 86Q 9Q :Q4&0&0X  <08 6RR 0CR 880%5QQO 5QL <QI 5QF 9QC :Q@ 80Sp`Ph lt5h@ d5l80pSP0$5QQ0(5x| \x0| $x00| Tx0| $x00| T80SPp8 P 00$,4QQ 4Q <Q 4Q 9Q :Q 4QQ:74 ᇣ 0010<80 5S| 0#QQ# d3Q <Q T3Q <Q D3Q 9Q :Q PC0K<8 ,0K@ ,3,#L0P B C0K<8 ,0K@5Sx 0"2QQ% 2Qa <Q^ 2Q$ 9Q! :Q AP 0`"QQ:74 < 804 O0!1QQ9 1Q6 1Q3 1Q0 9Q- :Q* F80p\SPH0l!h1QQ \1Q <Q L1Q 9Q :Q hl40P (K 80p\SP 80<80p\SP0CRIF0CQ07' 4)%Z&80p\SPʰ060s0CQt080Q07xthMhbiMibuB3M0;0M8M`;; sE s N; 7;B;M;B -LM8 "80S"4p4  00S S S S S 4 0BSL & <&t0 S0 (#(3\ $#000X <04504  SRn6, R}08 8080`P- xP! 0 2C0010 |Ÿ , K00K5SF @@A0 @@1!J80PlS`S!P hl8P %%8P 80PlS` R5 R7 R5 R3 R1 0BS40RS l@hP[ 0 0[ (K8 0BS060ǕR40S00606080SR h%40ASh@lPQ 0Q h@lPU }0U hPl@Z rZ 0{0 0K 8 ,0KjB0@0; ;O;BTB -LM`< 4 %%<t0 S0 40S0004 00R;00H#H3\ H0h@lP8#040X <85S +00S 3h@lPP 00P 'h@lPC 0C h@lPM 0M h0l h 8 0l h0l  840S]80SGPp %$80p\SP: ?P 0S #20010<0  B5S 4 P1RLA0K@<,0K  @C5S P-5S  0 <80p\SP(K 4 0R000C60K40S006060Dh@lPK 00K 8  40h 8 80l 5SB0;E;;BhV;P; -LMP90$ #t0 S0 \!\1\ X!000840<56X (18R:0004 S80S4`p80plS`+ P #20010 0 5S @0K  ,0K@Ŗ\  0h80plS`(KXB0;0;hV; -LMp# t0 S10 !00\ 0hlT h@lPA 00A x!h040X <85 l Dῠ8 l@ h@@0lh@ 80S4P`80`\SP+ P #20010 0 5S x@0K  ,0K@ŕ\  080`\SP(KB @6;<;U; -LM< plJ hf<08 9040 P4`>@T 0S 00600##<t0 S0  3#00\ 0S3000 40< 850S0;0;0;;;;h@lP@3X0P 0P 'hPl@R 0R 84$80STP` 80%"80`\SPD4 aP V VB ᆣ 0010<40 d5S 4B,0K0K<4 @i5S! P V80800080 80 hlJ 805S X80`\SP(K< 40 80h@lPP1X0I 00I h@lP1X0R 00R zhPl@W 0W 0 Q00 060%F"U0 606@ @hNP0000  006060 nd5;@B0;;BhV;;UtB5; -L M`@ 8P$2p,Q00 Q00 "$K%4PS!tPVPPi t0 S10 !000401\  5 X0 B0P<80 P娥@PI X1X!  L!* @!<( K,0K0 1!0 l5S "P5S 09!! ,K(0K~hl 0L!D!tPBB0;x;DBhB\BBBhV;BBBB -LMp [0l2l" 00 P 00 @( H0 0 Tj 0 $ @ P00i>! 19!0 S:ӌ0Ո00t0 S00 40 d!A> 000\ 0 506 D1D!X0080d <8 P"80S"4`80`\SP! P #20010@,0K0K  @5S X80`\SP(K 00@  00@ ( ;PB0@0;Г;(_;hV;B -`Lp@ , t0 S0  1 B00 16 \00<00 4 5X08hl| 00hl h@lP 00 80S@P80PS e5LS@ 380PS B0@0;; -8 L"80S"4p`@P P 0@ PPW Jt0 S0  !00 |!Q7 t1QF 0CQd1\06 0<0T1 X04 85y80S@P80PS w5LS@ 3Y80PSlhq 0hI0 0006 \0T0 006 T h0\0X0 00P06 \0hls 0+hl{ 0&BHI0;;2; -L M@ 8 p"80S"40@< <0 40$#Q :4Q= 4Q: 4Q7 @0 $(  h0@ h0 P <S  @(0S P4%P @4P 0P \2R:0R60RP0CRH0CRV:00000#20010840 @5S A,0K0K84 @E5S8 40 d1Rz 1R |1Rs0CRp*90CR060lP"5S X5St1R M:=B 0CSI0R 0CRAi0CR 0CR99:h00 l@ |0R 0R'T0R X0R =B 0CSB0;$P(o&$.0<;B&$hV;v'$qʄ -LMp9  t0XㅀS00A0 \000406 0 `<80X0 580`S xP 3B@@A@@PP(0K,K  Pt80`S$KB0@0;;;hV; -LM8 80`#4@ 0 (4R 8t0S0 0 t@@ 08<00 4@5@ 8PpPß00K8, K5S"8p\PPu P 02C40 0010,0K0K8 5S 08 5S 0010 PB h0l h@0l  ht"P0l@@ T 0%<0058 00, 4 RY 00 5S 0 1!  8p\PPt0S5 P3p PUOZ!80pS'ڇ2#0010@ P3   P0  050 80pS(K0 30300 5S5 0@d0 t@Tt0S 0 @0+ \00 Bc?BhV;|BBB B BXBhB0; Q-LP QC QpB @@`h 0`lXV@ 3Q* 3Q' 3Q$ 3Q! 3Q 3Q 3Q x3Q p3Q h3Q `3Q X3Q P3Q H3Qs <Ph@p@`h0 l`XV@0"Q0 2Q< 2Q 2QF 2Qh0 lhl\ h0l` h0l hl@ wh0l hl hl hl hl hXh0lT Ph l0h@l0\ hl` 0yhl0 h@l 0jhl0 hl0 hl 0Zhl0 ]hl@ 0`TGhlT 0?;;;;;d;h;T;;(;4;;; ;DBP -0LS ZlB -LM`h0@ l |2"209R@7 P"0@T u29 S0!u2%0K&0K900}"0x&[Pp @Pp3F@T_W  x!0 |Thl0@ mp!0 u8\1\!0%KQ&K4 &@K8@80S5t"R%K&0KtƕS0!t2%0K&0K809t0 0&KQ%K %@KtB3d4f3 0t0 0Qp0p 0Qt2&K%0K8%[ 00$ K0S 'rr?r?r?r? Q0-L@PP Q 0:@ D0-H: M0 p-@L03P`S_ _ GGHQ L: 080T*4p -LM p0P P^ P0D .Q@p3< 0-LQ@h4 04PST4TS 4TS @4D$T0H4L$P4T$ 0-LM@\# Q (PU $0 B  $  8 00 008 -`"LÐ0PHPdE@" 2,p\^P` "0 \3"RB.+0\3^!0 \3P!0C.\2@S1*3d0C`!S00#A.\3P$!D5-\2S-0C$S%D5S45 Q00+\S0S03 ,#4p \3\ H5\2(8$8888 ` ` 8 p(8,8 p-3L`,0\#L5P1"B/\Q L5S3 z?\].0QE\"F/2,P\Q0@0$"E/\3"R. +0\|3#6I@R5@QC SDH @  SDH @  SDH @t#|1R @Q3QC 0AS#0,\3P$!.0\3P 5J/\p3 ,#4 \3*,#<*\Q3@  0\34 P5\X (((((((,(2S 0 02@ 0@02 0 0  0 202 -3L@ ,#1 \ -3L 0\ -2LS 3 0\3 0\ -Pp(0` L@L8 8  (#8880L  0-0L(@PL  800 - L<(L0  - L(@0L0   Rp@-P`00  0AS R 0ASN0@0 @ 0@0`00 p0`00p -LM3S1 3 ,(3),F0V,LfPv,03,,TFXVLP3,,\f`vTX3d,,dFhV\`30,,lfpvdh3+,tFxVlp3+,|fvtx3+,FV|3`+,fv3,+,FV3*,fv3*,FV3*,fv3\*,FV3(*,fv3),FV3),fv3),FV3X),fv3$),FW3(,gw3(, GW3(,gw 3T(,G W3 (,$g(w 3',,G0W$(3',4g8w,03', 40ZS(Kx3^t30^b=>  T0D8#H @* K5S: 101[Q % 00a 0"[00b05`e0 00W 0 0@0@e0   tP  0 3t30^ 00ee(\ 08 00 5%PB -LME`T/ ]> R&p0pS  5(PU $05$5;005].0 @SET 055S05P ;055 -LMEPT8 0 R/p @Q (0Sڔŕ(`V  $0  Bŕ $P :00Q %00@0p RʐET ɭ055S05 -LMdĐ@p  p 0` PP  <00 0(K 000p p *,PP  0 0 0 04PP  0 0  0dĘ0  P00PP`  ( 0 8BBB@B -L M]N0P@ xP `K0d$S%@p`]> @Rŕ 00 0 `Pp  H (\ `  $0  B `xBB -D0@ L@ /Pi B -L MPP%@|?0d$S%Ep0 Rڔŕ?0 0 ? 0 `Pp @ p6  KH0 `0C ŅŅTŅ(@ T  t5d B -LM%r1G@`PU  H 70 ;:P5705; 00t#0CR9Ŗ 0P-(\  $0   (\ 0 00 P ? ,0@(\ 0 0 0 505 V9I7<B p-]>0%LRP`@`]>0%ER`@S@P p p-]nL@>PP p0U0C5U5Spx plB -LM30CSO K~ Kz![  1[ ; S 1[; S ($ S1[; S@@@ p-LM85@S2S x3S 1  @%R R:  R0@%@5_`K  81[S  11[S  *![  10 1K@%3 S@%  #P P1[< 1Kx_`K  1[: 1K3S@%"P P1[< 1K@% p-@L `M41!1tÔ!x!8t1LA!0`].1d0 0@]5P01(1$!m30CS- 0#D 0? 0&: 052S 0- 00( 0 # ;Gph2`S\0 0+@.@ 0 S<S<L@R 0C/000 /  0 4#U3`P V T xP4 x#x9%xBBB -L Mhp P  (KE ͇J  0mKN @ `PzP   Q/ !20S) S'Z h4 0 इ͇KNK^ 0@P   P@ P0IP  X0ASh4  | E·K  0EN] P #P h4,K$PP D` cXt, (0@,  0p1,P I T D B i= 2S ah4K 00K*P 0 hė 0 03h 0\3L 0\=B0BpLBhBBM<B0@0@@ 0-h4PL ĕ;> ,hD0 h4, \0 /P "R4#803 0BS020 B 0-8 =(8LP @QT/<0h p-LQP0`h4 0@DYUNp p-3LP ,0` 85S 00CSP1 R000085S& 0S 00phpSN @S.  0S 0$!B30b03O0@0@50 0CS8%0@0@x0x 0S8"0BRSR3-,#6-\<: p-LM@Poh#0 085Sx  30CS00dS& S0 S#0 R 0S x2&S 00x  K1[ 0<0x@hF:< 0-L@kP#9 0h -LM쁟2 S@( Y 3,,8P 2S-< P8P#0,\2S ( 0RN$K3,,#0,\;;>  "RPʯK ʯK` p` :Vp" 0E 3,,;> P #0,\  b@Dor? -3L`^! ,58 X# U+ p U' |%20 0!X PP("x P0–@h\d  \P Up6 FQ0 @6 FmE88 0-LP~@0h -L`MlDlT 0`R 2 S %21C0 `  0l Ŗ Pt 505zl0#(00CQi(6US  Q| tl`@ x p |%,0@Ŗ50  h3 A R @0 0pP PPlx (0 Sx m(^ ,\pK0 0 Ph 2 R( pdP 2 dP R |5Ŗ 5("80|2 APUh pP @0W 0d0p0 |055%05l$70t0 2 S t(K`(\ d $0  B 0RT570t 5`(\M d $0 B E(6SUCl0D( 00b8#800` 0l00(\ l $0  B 0 400%p2 S`(\ d $0  B 0 R 3–@|\t 0 \  8 00j8#80t`@p <88 -LM5P=@S` 85S 2 S `(\ d $0 B p@0  BQr0C2 S `(\ d $0  B W 3^ 5 \P0@DQ 0S*DP 0p5 10R!!  10C15;588 -3L` ,2pSP 8@06 @6068@ 2S2XqP 3P J/5\LPRS\ {@6068@ F\  0>X ( -@Lp2 0CSO  Q J"Rl4 0Ól4Rm4, ].<04/ @ +P%<ÄDHLńĄIPM"0BS^4X<4X0 0P? +2, ].<0$0K c 9 2[ " 2"t3?0 0P P82t3:t355KP #Z g2SS  1 S/ S8$,  PM=~P4 _ 5ZE.,03HjP9 3S8 0(60,43 , 8PY 7C=B0CS 0080CR C80CR Q00 , / 0 1 0  ,%R R R  0 \0R 0R00!\00S 0000R 0R00@PDP{ 0-0@LTP+?JG, 9:0+\0 ,0 -0L@ ,(0SeP4, ;0 0 P%Y! A`0 FP2[00I8#8`0VP@ \ *0K  Qu(K 0-`0LS@" 0S% 3P\PU 0 , 0 \0 ,2 003P 6PU 0( ,0P[ p-h0SLP!hd0SphP0D ,@ 0 \ph\[ 0-40LS@ 00 , 0 \2^0 ,d ۵PU 0 p-LPhPp0,, @0,,  0@ T T @`0o/!"+,@T d0R V0  0 0R0a0P0 IAMT -LM @0BS`)@K*@K0BS (K0S 0 ,UF 0-0P qdZ ) [P* KedNYX*0[=#=*0K* [P X$ 00PAp0\) K0d)0K, ) [Pd 0#4*0K 0000 Y'@* K%*0[0 *0KP 0 0 00 P00 '0!,P0PU 0 ,@w0U_< S  7 \@Ǵl0@T 0 ,40T  :0,0\< p-L`P@꡴P0T U00 4 ,0@ @pp蠆, 0-0LP ,80@S S 0S @0 \0hB0 @ 0\]0@0 \0@0 \0 ,A0@0 \0 ,/ 0-0LP ,80S& S 00@0 \0 ,  0 \0 ,0h0@0 \0 , 0 \0 ,ֳ0@0 \0 ,ij 0 -0L00 @ \0 ,h詳 -0L00 @ \0 ,h葳 -LM0!@ ,X 0 pKP0'` 8#X0 ,0`0P$0 X -LM0PH >r4B,8 0R0 0  R0 0  D0B `K 00 0 0 0  \0 ,-e@ 0 0 0  \ 0-L@P08#XH0U #r 0U00 -h0!XSL@hd0Si}i p0,0 TײpW gP<  0 \\[ 0-LPP 00 , 0BSR8@TB T4 0 @0 \0 ,0@㎲0 ,30#@0T # 2RS  @0 \J0 0 \e00@ 0\ 0 \0 -L(\P@!h"x V:@0w03 fW0SPP H0S 80SI SM S- @H0S]P W@  0,0 X  1 0\T@P  W #$!W0W 0m'P 4SVQ #g!$bW `, 4`4V0*@p -LM0PSD1:8#x 0CSp7@`"K! 0FP`/"[V"40 @0S #00S 0 , 00#0 0 0L1S0psH p-LM`KP 0@Px1[80 0 P0![00x 0-LM0@ ,0P0CS*hC20000 00 40, 00040,0Q00,0 00,0 (Qp-L@"hP40S6 S!x0 :380 \@0T) 0 ,@ 0S p x ppdȬD 0)pp -LM`pPp@0SS0 ,0L@0 \0 ,嗬 0 \0 ,ㆬ0 S S 0CS񟗤0<0PU `(*1P 0-LM KP@P1[A=A S 80$ , 1[ 00$ \8 p-LM0@SP x`K 0QP1[UP 0 S S ,P x|A,P x ?P1[M=I SP1K 3P1[3;# S1K 0 0PS` 0-LM 0@ S 8PK 1[  P1[3;# S01Kᯨ$$ P +8@ a -LM0 K@P1[; 1K0` -LM P|@P t!t@P n@P`pK @P @P1[0S b0F8#h\ N@PT F@PL,>@PD 6@P 0@P` @P @P(1[&0F8#h@BP 0-LM@ KHPnP T1[1[001K1K1[; 1K8` 0-LM0P),0 ),0 p),0 T),0 8),0 ),0 ),0 (,0 (,0 (,0 (,0 t(,0 X(,0 <(,0  (,0 (,0 0CS0',0 ',0 ',0 ',0 h',0 L',0 0',0 ',0 &,0 &,0 &,0 &,0 &,0 l&,0 P&,0 4&,0 &,0 %,0 %,0 0CS0%,0 %,0 SK00p%,0 L%,0 0%,0 %,0 $,0 $,0 SS0$,0 $,0 t$,0 S0A,,0 ,$, 0 0CS0S0$,0 #,0 #,0 #,0 #,0 l#,0 L#, ^08#,0 #,0 ",0 ",0 ",0 ", 0",0 h",0 L",0 0",0 ",0 !, M@K          x l ` T H <'@@@@@ @(@0@8@@@H@L@P@T@X@t@x@|@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A@@@@@@\@`@d@h@l@p@PaQaRaSaTaUaWaXaYaZa[a\a]a^a -LM0@S`P 6PP0,, 0( , 0.,p KePP1[x V !K @@01K 1[01KP1[;1K$![P@01K ` p-LM0@SS  `x0,P K(`P1[+  PPk1[9 S\  S\ 0 \x -LM K@P; 0SE   KP31[ 0K1K1[![@01K1[01K1[ <1K <K1K(0SD<<(<<1[;1K![kP 0S  ![b1[;;1K1[;1KK -LM0@Sp` S?000 PU$ 0S@ S 0Sq 0S0 ,?0@d0 00000 PU0S "K vP2[P  lP0dS S2[@00\0Sk 0 P2KJP0A., ?0 0A.\$ K;PU2[2[;;2K2K"[\00S*K@ `P22[99 2Kv`P*X3,n`P",t"[f`P002 KP3[=3Sh<<<0A8 B#p -0 1K    , | pp h \? P N[/s q!y012 0-LM@PPP  R K7P P8026 P͞ 00CS0S S P1[9 1KP㵞 PPoP(' p-LM`PV@ x 0BS@T7 R R 0S @P0 x0y@XTl K@PT [i@ 0St00CS+\@P+V@P Rt 0BSR!I E!A =!9 5!1 -h!) %L!! 0! !        ot 0BSo @P\ @PV R`t0t0S SY-RA@PB F1`#$%'5439`1DP` p-LM1@S xP x0 0BS{ 0S 0BSR)0BS KP00CS 0.\0S S KP![x40 1KPPK P0 S S| 1[ $R00:K1K R:1K:1K![aP0S X0P`S0XS0C0< S   P![ 0  00VT0 V V;1K![ 7x0,, <4<,\ pR R. 0BSO0.,0S SZ 0CSL 0.\0S S  P0.,V1[ :1K  KRP1 KJP)![10 1KP![10 1KPK7 K.P ?![d10 1KP![<10 1KP P![00 1KP  P![00 1KP:  KP1[0 1K~ KP1[0:;1K![3:1K![/: -L M0`0CSdd-@P  KH$ K@P2[?0 $2K@P0 ,0SP @0; \Q QQ QQ Q Q Q01Q 0SS= S; SS_ S] S[ S SS1S0& Kj@P2[#; 2K@P P@P 0,\ a= \*@P@P@T @PzP"pK 0@P o*@P k"["10@1ś08#X U^Q00CS&PK @PPp :R P2[;2K2[ |R 0K2K R@02K R`02K0"[@S0K2KP2[;2K"[~@P% 0St0S+p 9R'  @P 0S2[02K2[t pRK9p R90; 90< 2KQ@P 0S S e@Pl0S ( K2[0 2K7 Q>Q.2K@P 0(@ ,P& K@P"[ȟQQ ;2<<K2K2K0AS2[2[:L@0ÓL=Ã2K2K 0 \ 0SS S SS SM *K N@P"[70 2K@P"[@Pߚ0SI BKP(pK 0@P o*@P<k2[6Ț0E8#X 0SSS  @PW @PQ @PK2[P 2[墚 @P 80E@P83#X 0SSM SK S U@P#0"[S00K2K2K2[0 U2Ki@P*K @P"[50 2KW@P2[92Ks &0K@P2[\%9#S A@P,%;@PA S[1SXL@P& K@P2[#; 2K @PE 1S 0S>$p@P&PK q@P"[d40 2K@P0 , 5 \ R@PP2[0 2K@P ?@P"[30 2K@Pw /@Pq2[0 `2K@PhSmH@`2[0 2K@PT @PN2[ ;2K*K @PB"[20 2K@P8&PKU @P02[0 U2K@P' @P!2[!Q "K Q 0`02K2K"[0S0K2K"[`@Py@P>t0S  R@P L@P 0 @P2[\ 0  K9@P @P2[p0 2K)@P @P0p R2[2[;;2K2K"[@P00CS<0S90S6@P1S^K: A A A40R? -LM0PSD1@:8#HP`>( R Q ( 9 Q7Q|  p0S6  R]`00CS]0.<\ 00CSD(0@0P(,Z/0\0P,0.\ K$1S ( Q0x0x00AS] R 0BSQ[Q0 00ASm0&@Kx0x00Sx0 P2[pp$ KP2[p 0 Lt0pR<<$<$<$<<$<$  x`0 ,P! P 04 , 04 \w|2Q8 02QB {1>CQ 0 0p0|", 0P"\0`0J0 , 0 \K1Q >P0CQy0 0?1Qz 90CQoz 0 04 0 01 0LS0 0,0 0)0 0& J <1Q (1Q 1Q  &  "0K}Pr 2[02 \7A9>CS90Q 0Q2F0Q d0Q+ So ( `!h!@_;`' 0 T0 AP A ATT APT@M A A AB -LM0PS 40S 00CSa0 0\0,0\ 0+\0 @, AV0 , p R R 0BSR RS 3 \P R^ RPT RS)0A S  Q Rs Q Q Q 0 0\0 , R 0BS0@&, 8&\ 0BS@R @"50Sn 0l@  0\0  3\02 s ͔0 , : \0 ,}㵔0A S  Q R 0$, :$\ Q Q{0,, <4<,\Qg0@$44\^ >2 1S  3 \g* 3 \![00 1\lO 0BS0,, ` 0 ,\0,,@ }/`V 0 R0*0\0"0\ 0[,, 5  8[,\<  P) 00C S @ 0AS0 , @T +P Γ0 , : \0 ,6w10 6\L1 S;7#$0KO0 ,1[ 0 \ jP0qS0T , &'0p XP_eeee NaT[ -L M pR$ 0BS5RR PU1Sw 0ES'U<U 0ES 0ES`@PU0=2 [3 D !8]T (X$Vh BB#8S@p= @B0@0@ p-QLM`P͐ :lBpt2 ` l•p 0Xxh޳8 "< S "80S"40S 0-L@ƼPP Q 8 0Xt"R0l2ptR0 p-@L㑌0`=2PP  \l”pt"8 0phӋы0 嶰pL B`7 -LMp'N_`@ P  0 wP $Kl2p ,l–Tp 1\儈0lBh2Ppt2 P l–p 1\/ 0P(K$PX;( (0@(  0`(1,P" y43PH8+  PP& l–pt"8 0NWT |RxPl2t"p<3D 0=2,-| BB%$@B0@0@ @=8 "< S "80S"40 S48 8#8S  0!S80:0CSCm -l2@Lp , `/'4`, 7  0Sp ǔ  4PꞌX0U 7  PZX '4` B 0-L@/PP Q 7 0Wt"R0l2ptR0 Q0-LP@ 0h -pML'N_`@ P  0 P0C~@P (KW 0h2l2p $l–x p0X4@3("(RQ A?R 0,K$P ^l2t"p J, (@,  @2,P B `  P:'=&=&=&=&=&=&=&=&=&=&=&=&=&=&=&='='=&=&=&=&=&=&=&=&=&=&=&=&=&=&=x'=1!(R 0R!{P 7 P ǖ0 P 0`24P~3P2Q  zd1"R|20|2@P'  ,7 0|0`20`20!Sg800`Sc7 H ǖ2 H U 0G ᩉ0| 厮&pT `\E3 H ` BBU$8S@Ch"=L B B1"=j`7B0@0@ @ -|0L@Q 0C 0T0 P=PB=0 <=4= 0-@L0P  0hL4= -QLM Q  (0} K0 H)=4= -LM4p8!#8S`K !1  1圁  0 {@B͆ B0] P@@|P < K 0$K$P0$ (P 0@$  ` ,0P 40!0 (R R 0Rx P0 l0Rd 40 XT HDk4=|8= B<=@ Bkk B0@0@ 3uv? -(0L@0  VV - 0L0 V80⿟ -QLM QV  ,0峦 K8@ 㴞,= -L@ 0  0V V -LM1p 吁` 01 0 .zPB͆BVL  $@0P @PP{P (: K 0$K$P00$ (0@$  0`0,0P  0 0 0, 8 0  s0x p0ڜ\TT D@VV B# V@(,=`Uh,=tz B B0@0@48< #8S 0 \t!8C=======>= >=>=$>=` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `>=>=>=>=` B`p Bp` B`p RpP% $0000% $00000& $0000 k0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rn nN  0O   ! -- -i > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|zwi_do_hostdecryptwi_do_hostencryptwi_attach@?T?h????Ћ???? ,? L? d? d? d?d?x?x?x?????????Č?Č?Č?Č?x?x? x?!،?"،?#،?$،?%?&?'?wihap_assoc_reqwihap_ioctl 7nVV V@T Txĕ?0̕?8ؕ?t?4?4?$?D?H?$ ?$,?48?D?tP?0\?8h?@8t?K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-rt2661_rx_intrrt2661_tx_datart2661_tx_mgt@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!,-./0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 Frt2860_set_keyrt2860_txrt2860_rx_intr:: u <<4400$,,0,,H((`((l((,?  04P H ,Fs"D#4 ?LGdthtt@tx@l@tp@@?XD + $3A,B8EF IQ7RbSjTV[\gij5@p  A ! {X,              $ f`& g`( `, `. `0 `4 `6 `8 `< `> `@ `d f h l n p t v x | ~                    bwi_encapbwi_rxeofbwi_mac_fw_alloc7 dKZ-B"5*#    a.@:4@x}CCCCCCDDDFFFGGG G%G CCCCCDDF G G eS./`xZYXzRC./`xZYX zC0&* ZYXzRC   MLKJJIHGGFEEDCBBA@?>=<;:987654210/-,+)(&%#! MMMLLLKKJJIIIHHGGFFEDDCCBAA@??>=<;:98765421/-+(%!  )ZYXCQR bwi_rf_workaround)ZYX +RCz i )) i ) I i i I) i) I I)i)i(h(h(h(h(h(h(hHH( h !H!!!("h""#H###H$$$H%%&h&&('''G((G))'**G++,g-G.g/G2&5F6&788F99f::f;;E<<===E>>>E??@E@@@EAAA%BeBBCECCC$DdDDEDEEEFDFFF$GdGGG$HdHHH$IdIII$JdJJJ#KcKKK#LcLLL#McMMM#NcNNN#OcOOPCPPPQCQQQ"RbRRRBSSSTbTTUBUUUBVVV"WWWAXXYaYY!ZZ[[[a\]] ^^_`a<1??????????*?7?D?P?]?i?v@@@@@@@@@@@@ @@&@2@?@K@X@e@q@~?????????????!?.?:?GT@<wlbQ@;53-/**'%!!%'**/-35;@Qblwzuqlgc^YTPKFB==========================BFKPTY^cglquz˓dfX&ئ͟8ʴ)ǎi+jlbsCv ViDz#((?-җ1h5u85;5=f>?@?r>e 5=5;/u8h5#1E(?- -(1#4T8;i= >C??b?l"?+=;85&Z2X.dϚ)m$bwi_phy_init_11b_rev2"## # n bwi_mac_testohci_root_ctrl_startehci_root_ctrl_startsr_checksumsr_raid_inquirysr_map_rootsr_meta_opt_loadsr_meta_native_probesr_ioctl_installbootsr_meta_native_attachsr_rebuild_initsr_hotsparesr_meta_validatesr_meta_native_bootprobesr_meta_probesr_ioctl_createraidsr_boot_assemblysr_raid_read_capsr_rebuild_threadsr_crypto_read_key_disksr_crypto_create_key_disksr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_alloc_resourcessr_crypto_change_maskkeysr_crypto_ioctlbioioctlhotplugclosehotplugreadhotplug_device_detachhotplug_device_attachdb_fncalldb_commanddb_print_cmddb_examine 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|db_show_regsdb_printsymdb_write_cmdextract_entropyarc4_initrandomread n;AvXaM ְdx &&&l&&&&&`&&%(&coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_fileCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2012 OpenBSD. All rights reserved. http://www.OpenBSD.org j&j&j&i&i&j&j&|j&j&,j&Pj&lj&\&L& $$?T@?????coredump_tradcoredumpsysctl_diskinitkern_sysctlsysctl_tc_choicesysctl_tc_hardwareconfig_detachdisk_mapfindblkmajordk_mountrootsetrootdisk_attach_callbackextent_print1extent_freedb_show_all_poolskprintflogprittwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@cache_lookupsys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mount  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupU *D*l**(*4*(*L**(p*msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctln; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PP$@0@<@H@X@d@p@|@@@@@@@@@@@@@@@@@l1A @ieee80211_newstateh}A@TB3A0 @G(A9$@!@08B0d @40$@`(@RD2AUL,@p0@T4@|8@ h@5 ?X<@R@@D@`.A7H@6B7?7L@ P@LUA @72T@A7X@6\@7`@d@6 1@0,h@@l@Xp@!Tt@x@6\|@5h@t?7x?d Bp@l(-@R`@7|4@7@A@H@C@J@K@@@@@I@@E@E@@@@5p?l?7?7@8@ B@0'@@!@@.@@7B$@7*@"BO@\\?`BJ@h?7v@l?7X+Az@4YA@@pB7@B @7@6@@DAE@6@6 @0 @G$$@:(@7HAZ,@E\A:^`yAV0@w4@8@7<@@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ij@@TH@UP@S\@Rh@p@Fx@I@V@E@@G@@B@@X@@D@@ @7@@@5@@2@6@@8 @0(@0@98@@@4H@P@X@ `@3h@hp@@x@@@@"@ @!@@:@@1@@H@@@J@K@A@@C @ @@@@X@`@f$@g,@`4@a<@bD@cL@dT@e\@ih@jp@x@x@revarprequestarprequestin_arpinputin_delmultiin_addmultiin_ifinitin_controlin_lifaddr_ioctlicmp_mtudisc_timeouticmp_reflect}E#(Dip_savecontrolin_iawithaddrin_ouraddroKgpqrstuvwxyzip_setmoptionsip_outputtcp_inputtcp_set_iss_tsmtcp6_mtudisc_callbacktcp_ctlinputtcp_respondtcp_respondtcp_respondtcp_timer_rexmt.H..4.tcp_identudp6_ctlinputudp_inputPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptof_ioctlswcr_combinedswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Finalaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@000 0000p040{0|04|00 ufs_makeinodeufs_mkdirufs_linkufs_renameext2fs_readdirext2fs_direnter`h10_1 00]1\1tX1W1V1ln1(V1011/@11 111/@̧11/@Р1@1/@10111/@Ȝ1P111D1/@t110@uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insertTjİjXj0j0j0jXjHpuvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3\sys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_ifloop_requestin6_update_ifain6_controlin6_lifaddr_ioctl0123456789abcdefin6_ifdetachin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputip6_nexthdrip6_savecontrolip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputnd6_lookupnd6_ioctlnd6_rtrequestnd6_freend6_na_outputnd6_ns_outputnd6_na_inputnd6_ns_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkdefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_usrreqrip6_inputudp6_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs4t5o5o5 o5@j5 @j5@j5 @j5 @j5 @j5j@ j@`z@,j@8j@Hj@Tj@hj@xj@`z@   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`55g(55g(n@DAn@DA n@DA$n@h@ B B (n@ B,n@0n@ 8n@A(t@@F> A0t@@F>`A8t@@F>ADt@@F>`ALt@@F>`AXt@@F>`AXt@@F>PTdt@@F>Apt@@F> A|t@@F>Dt@F>Dt@F>it@G> it@@G> it@G> $it@G>0$it@G> ,it@G>0,it@G> .it@H>0.it@H>!it@@H> !it@@H>)it@@H> )it@@H>-it@@H>Aiu@H> -it@@H>Aiu@H>Aiu@H>Ai(u@H>`A8u@@F>`ADu@@F>A Tu@@F>A du@@F>?A tu@@F>?u@u@u@u@u@u@u@u@u@u@u@u@u@v@v@v@v@ v@(v@(v@0v@@v@Pv@`v@pv@v@v@v@v@v@v@v@v@w@w@w@w@ w@(w@0w@8w@@w@Hw@Pw@Xw@`w@hw@pw@xw@w@w@w@w@w@(w@0w@8w@@w@Hw@Pw@Xw@`w@hw@pw@xw@w@w@w@w@ w@(w@0w@8w@w@w@w@`w@hw@pw@xw@w@w@w@w@w@w@w@x@ x@x@Pw@Xw@`w@hw@pw@xw@$x@8x@w@Lx@`x@tx@x@x@@w@Hw@Pw@Xw@`w@hw@pw@xw@w@x@w@x@x@(w@0w@8w@@w@Hw@Pw@Xw@`w@hw@pw@xw@w@w@w@w@ w@(w@0w@8w@@w@Hw@Pw@Xw@`w@hw@pw@xw@w@w@w@w@ w@(w@0w@8w@@w@Hw@Pw@Xw@`w@hw@pw@xw@w@x@w@w@w@x@0w@8w@@w@Hw@Pw@Xw@`w@hw@pw@xw@w@x@w@w@x@x@x@x@@w@Hw@Pw@Xw@`w@hw@pw@xw@x@w@w@w@ w@(w@0w@8w@@w@Hw@Pw@Xw@`w@hw@pw@xw@(50{@5D{@(5X{@5l{@`5{@{@`5{@{@`5{@|@`5(|@L|@`5`|@|@`5|@|@@````` ```dumpsysԅ@@@@ @@,@<@L@X@h@x@@@@4A@؆@@@$@L@d@|@@@@@؊@8@L@h@@@̈@@@@8@L@d@@ĉ@@4@`@@@@ @ P@ @ ̋@ @@@x@@Ќ@@8@d@@č@@$@`@@@Ў@@@@@t@ @ @ @ Џ@ @ @ @ @ D@ d@ @ @ @ $@ T@ t@ @ @ ؑ@ @ $@ P@ h@ @ @ Ȓ@ @ @ 8@ d@ |@ @ ̓@ @ @ 8@X@t@@@@@@<@t@@@̕@@@0@L@d@@ @ @ @ @ $@@@l@@@ȗ@@@D@h@@@@@@@<@h@@@@@@4@X@@@ܚ@@$@P@@@ܛ@@ @@l@@Ԝ@@@4@\@@@ȝ@ܝ@@@<@X@@x@@@؞@@@ 4@ T@ @ @ ȟ@ @ @ 4@ d@ @ @ Ԡ@ @!(@!L@!d@!@"@$ء@$@$@$@$@$$@$@@$T@$t@%@&@&@&0@&@&@&@&(@&D@&l@& @& @& ԣ@& @& $@&H@&p@&@&Ȥ@&@'<@'@'0@'X@'t@'@'@'ĥ@(@($@(H@(h@)@)Ȧ@)ܦ@)@)@)0@)\@)|@*@*@*@*ħ@*ܧ@*@* @*,@*`@* t@* @* @* Ш@* @* @*4@*l@*@*ܩ@+@,<@,T@,p@,@,@,@,@,@,4@, T@, |@, @, @-@.@/$@/L@/x@0@0@0@0 @0,@0T@0@0@0@0 @0 @00@0H@0d@0@1@1@1̮@2@2 @3<@4P@5d@5@5@5@5@6@7(@8<@8X@8|@8@9@:԰@:@: @:,@:L@;@;@;б@;@;,@;<@;H@;d@;@; @; @; в@; @; @;0@;L@;d@;@;@;@;г@;@;@;4@;H@;X@;x@=@>@>@>@>@>8@?d@?@?@?ȵ@?@?@?@?D@?`@? |@? @? @? @? ض@?@?@?(@?8@?\@?t@?@@@A̷@B@C@D(@Dq@@E`@F|@G@G@Gȸ@G@G @GT@Gp@G@H@I@J@K@K,@KX@Kl@K|@K@K@K@L̺@N@P@P(@PD@Qh@Qx@R@S@Sػ@S@S@S<@S`@S|@S@S@T̼@U@U @U @UD@U\@U@U@UȽ@UԽ@U @U 4@U P@Wt@X@Y@ZȾ@Z@Z@Z4@[T@[d@[|@[@\@\Ŀ@\ܿ@]@] @]L@]@]@]@]$@]X@]@]@]@],@]\@]@]@]@]$@] `@]!@]"@]#@]$@@]%x@]&@]'@](@])L@]*@]+@],@]0$@]1`@]2@]3@]4 @]5D@]6|@]7@]8@]9 @]:X@];@]<@]@@]A8@]Bl@]C@]D@]E@]F8@]Gl@]H@]I@]J@]K$@]LP@]P@]Q@]R@]S(@]T\@]U@]V@]W@]X$@]YT@]Z@][@]\@]` @]aX@]b@]c@]d@]e,@]f`@]g@]h@]i@]j,@]k`@]l@]@^@^@^8@^`@^@^@^@^@^@^ D@^ l@^A@^B@^C@^E@^G@`8@aH@a`@ax@b@c@c@d@d@e(@f8@f\@f@f@g@g@g$@g<@g`@g@g@g@g@g @g @g D@hd@i@i@i@j@k@k @k(@lD@m`@n@o@o@o@oT@o@o@q@r @r8@r`@r@r@r@r@r0@s\@s@s@sp@s@s@s@s@s@s<@tH@tX@tp@t@t@t@t@t(@tL@t t@t @t @t @t @t$@tH@tp@t!@t0@t@@ta@tb@tcH@tdp@tn@to@tq@ty@scsibus_printlink`@h@x@@@`z@@@`z@@@@@@`z@@@`z@ @@`z@@@`z@@$@`z@`z@,@`z@4@@@`z@T@\@`z@d@l@`z@t@|@@@@`z@ @@`z@@@@@@@@@@@ @ @(@`z@4@<@`z@L@T@`z@\@`@`z@l@t@`z@@t@`z@@@`z@@@`z@@@`z@@@`z@@@`z@@@`z@@@`z@$@ `z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@H@`z@`z@sd_read_cap_16sdgetdisklabel`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@`z@j7j 7 >7=7:7:7:7:7 4=(4=04=X7=P4=x4=4=7=@5=h5=5=D8=84=@4=H4=7=4=4=5=8=5=5=6=8=8=8=8=8=8=T6=x6=9=9=6=,9=89=|@@ @ @@wddonewdattachwddumpABCDEFGHIJKLMNOPQRSTUVWXYZusbioctlp,7777usbd_set_config_indexusbd_devinfo|@@@@@@@@@@@@@@$@4@<@H@P@\@X f(  pt""(4I@@@@1` #U3UCU4QF              @@@@@@@@@@@@@@@  @  @ Q@  @  @ @ P@ Q@ u@d@d@@@@|@@@ @ @@@]@@@@>@$@c@c@eaQ@X@W@0@ w@Q2@U@4@F s%^^uhub_attachD\>898D5868ucomopen>8DM8L8>8ugen_do_writeugen_do_readLT8r8(\8,T8ugen_set_configuhidev_set_report_asynct8$88<8uhid_do_ioctluhid_do_readd888t8=n>R:q> q>]q>r>s>I"u>u>Ju>RXv>7v> jw> w> w> w>Kw>px>@#zx>px>px>px>px>px> px>px>H@px> Nx> _\y>z>~{>\}> }> }> }>E}> ~>m~>Kv>A >[>D>0b> >҂>j>>?؄>nV> 2>JF>چ>abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.ehLiMjNkOlPmQnRoSpTqUrVsWtuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    88x888P88ģ8P8885dd5(I*LCDEOMPJQNRK888,8@8888|888888888(  v      W 1 Q `  t8@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   8  L+ L 8L2 D   O  {h8o  A umass_scsi_probedd88x88fGg ---0000 0@0P010`0p0aLfLLLLiF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF 9 |08(8\88axe_setmulti B  w *w +w W UP  <1b0 0{&"79n= wF@W wn a- 89\98D9$9%9$9@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0x59;959*92V{%1" `"'`~%ZP `|N9jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_setmultil94m9l9L`9hF F hF fF `ȁ99L9p9999\9url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@999 9uftdi_openPl9$999`VV !y`V'V%V&V3V4VPVIVVVVVVVVVV}  H(02135HPPQ nY ol\k] ih^_mZ[Xj 2``` ``x     tq?=:>9;<8pq8     JKLIؼټy`ؿۿٿڿHIJprsq"`r``xȽPW8P3 & & & & & & & & & &     < < < l F F ! ========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=================================================================================================================================0 B9 !PPPPPPPPPPPPPPPPPPPPPP PPPP PP PPPP PP PPPPPPPPPPPPPPPPPPPPPPPP: :  !RR !R !R !R !R R "R !"R "R ""R "R #"R $R !$R 1$R A$R $R "$R 2$R B$R $R #$R 3$R C$R (R !(R 1(R A(R Q(R a(R q(R (R (R "(R 2(R B(R R(R b(R r(R (R (R #(R 3(R C(R S(R c(R s(R (B@  >d l999p9G W WnPnPA   !^y 4Xhp9{#{{{{ rS#S&@'ah 33.U 1(Ex$ #h9P9990    `9D999   &  l! eX9T999D9h9L9x9 B  Q  umsm_umass_changemodeX|9\999=beeK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < .A`>.Aز>.AD>.A>@ȳ>.A>.A>d?>.A T>.A >@ ̵>.A ,>.A >.A>.A4>w?p> /A>/A-A)g /A:g0/A%h@/A2hP/A6h`/Arhx/A3i/Ari/Aq/Aq/Aq/A q/A0q/A4q0A5q0A6q00A#rD0AT0A\0Ad0A'0A0A0A30A50AE0AUP0AWP0AWQ0AWR0AY0APY 1AQY 1ARY41A`H1A`\1AU`p1AV`1A`e1Abe1AceBde1Aee1AFv1Apw1A1A1A 2A 2A02AD2A X2APl2AQ2AU2AV2AX2AZ2A2A2A3A 3A03AD3AX3A`3Al3A|3A3A3A3A 3A 3A3A3A3A3A3A3A 3A 3A==3A==4A==4A==4A==(4A==44A==@4A== L4A== X4A==d4A==x4A==4A4A4A4A4A4A5A5A 5A05AP@5AEL5AH05A\5Ap5AQ 5ABX5A5A5A5A5A 5A5A5A 5A05A@6AP 6A6A(6A06A3@ 86A3@`@6A3@pH6A%5P6AE`6AIp6AQ|6Aa6A6A6A6A!6A#6A16A36A56AA6AC7Ac 7As7Au$7A!07A1<7ADH7AGT7A`7Al7A 3x7AR7AR7A)R7A7R7A9R7ACR7AFR7AGR7AIR7AKR8ALR8AMR 8AaR,8AcR88ARD8ARP8AR\8ARh8AQTt8AUT8AWT8AaT8Aq8A 8A 8A8A8A8A8Ax8Ax!8A`89AxP9AxU 9AY,9AY<9Au`L9Ax`X9Axad9Axpp9Axq|9Axr9Axs9Axt9Ax9Ax9Ax9Ax9Ax9Ax9Ax9Ai:Ax:A:A,:A<:AL:A\:Al:A|:AP:AQ:A_:A:A:A:A:A:AP;A ;A;A$;Ad0;Ae8;AdD;AT;Ad;At;A;A;A;At;A;A;A;A;A;AA"(>A"<>A"P>A"`>A"`>A"`>A"`>A"`>A"p>A">A">A">A">A">A">A">A" >A" >A" >A" >A" >A">A" ?A" ?A" ?A" 4?A" H?A"@ \?A" p?A" |?A" ?A" ?A" ?A" ?A" ?A" ?A" ?A"0?A"C?A"C?A"C?A"p?A"p@A" p@A" p@A"p(@A"p0@A"t<@A"tD@A"tL@A"tX@A"t`@A" th@A" tp@A" t|@A"t@A"t@A"t@A"t@A"t@A"@t@A"At@A"Ct@A"Et@A"Ft@A"Ht@A"ItAA"PtAA"QtAA"Tt(AA"UtTDAk?`DAk@pDAkAxDAkBDAkCDAkEDAkFDAkGDAkHDAkIDAkKDAkLDAkODAkPDAkQDAkRDAkSDAkTDAkUDAkVDAkWEAkX EAkYEAkfEAkg,EAkh,EAki(GAT>4GAp>DGA6ATGA7AdGADAtGAEAGAFAGAGAGAHAGAIAGAJAGAKAGAPAGAQA HARA HASAHATA$HAUA,HAVA$HAXA8HAdA@HApATHAqAhHArA|HAsAHA7BHABBHACBHA6CHA7CHAACHABCHAECHAGCIAHCIAICIALC IAMC,IASC8IATCDIAXCPIAaC\IAbChIAcCtIAeCIAgCIAhCIAiCIAlCIAmCIAnCIApCIAqCIArCIAsCIAtCIAuCIAvCJAwCJAxCJAyC(JAzC(JA{C4JACDJACPJAC\JAClJACxJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJACJA7DKATEKABG(KADG4KAIG4KALG4KAMG4KANG4KAOG4KAPG4KAQG4KARGBsA$ ,sA$0,{AW4{AD{ApH{AP{A;A`{Al{Ax{A{A${A{A{A{A.{A:{Aj{AOI" |AP$|A`8|AL|AX|Ad|Ap|Aʌ|A !|A "|A&P|A'P|A(P|AI|AS|A(|A5|A}A9}A@}AA}AB(}AC}AD}AE4}AF(}A@}A\}A\}A@}Al}Al}A}A}A}A}A}A}A}A}A}A}A}A }A }A }A~A~A"~A&~AP$~AR8~ATL~AV8~AZ8~Ab\~Af\~Ajp~A ~A ~A&A'A)~A*~A,~A0~A2~A5~A@~AA~ApArA8A:(A<8A@LA\AlAAAAAAAAAAAA` Ab Ad AA$AB8ALA dA |A AAA؀AAA A AA8A8APAlAAA8A&A'ЁA(ЁA)A0A1A2A3A4A5A6A7A8A9A: A;A<A=A>A@,AC8AHLAI`AJpAKALAMAPAQARASATAUAVAWAXAYA^A_ȂA`AdAeAfAgAhAiAjAkAu Av8AwPAxlAyAzA{A|A}̃A~AAAAA(A4A@AAAAAAPAhAAAAAĄA܄AAA A$AAAAAAAAAAAAЍAЍAЍAЍAЍAЍAЍAЍA A"A&A-A:A;A=$AD0AF8AI@AJHAUPAW\AXhAYtA]A^A$A$A$A$A$̎A$܎A$A $A!$ A"$A#$$A%$4A&$DA($TA@$hAB$tAC$AD$tAE$AF$AH$AI$ďAJ$̏AK$܏AL$AN$AP$ AR$AS$$AY$4A]$4A$@A$LA$\A$LA$pA$A$LA$A$A$A$ĐA$АA$A$A$A$A$ A$A$A$,A$8A$A$HA$XA$hA$xA$hA$A$A$hA$A$A$hA$БA%A%A0%A1%A2%A3% A4% A5% A6% A@%,AA%8AC%PAD%PAE%PAF%PAG%PAH%PAL%\AP%hAQ%tAR%AS%AT%A`%Aa%Ab%Ap%̒Aq%ؒAr%As%Av%Ax%Ay%A{%(A%4A%@A%LA%\A%hA%tA%A%A%A%A%A%ȓA%ԓA%A%A%A%A% A% A%,A%8A% A%HA%A%XA%dA%pA%|A%A%A%A%A%A%A%A%A%A%A%A%ȔA%ȔA%ȔA%ؔA&A&A&A&A&A&A&A&A&A &A &A &A&A&8A&PA&\A&\A&\A&hA&hA&hA&hA&hA&hA&hA&hA &xA!&A"&A#&A$&A%&A&&A'&A@&ȕAA&ԕAQ&AR&AS&AX&AY&AZ&A[&A\&A`& Ab& Ad& Af& Ah&0Aj&DAl&Am&TAn&dAo&tAp&A&A&A&A&A&A&A&A&A&A&ȖA&ȖA&ȖA&ȖA&ؖA&A&A& A&Ap'(Aq'4Ar'@At'PAu'\Av'@Ax'hAy'tAz'A|'A}'A'LA'A'A'A'A'A'ȗA'ؗA'A'A'A'A'A',A'(AO(A0(A1(A2(A3(A4(A5(A6(A:(A?(șAA(șAC(șAE(șAG(șAI(șAK(ԙAO(AP(A)A)A)A)(A)8A)DA )TA!)TA")`A#)`A&)TA()TA))`A*)lA-)TA.)TA0)xA2)A4)A5)A6)A7)A8)A9)A:)A<)A>)A@)AB)AD)AF)AH)AJ)AL)Ap)̚Aq)ܚAr)As)At)Au)Av) Aw)A)(A)4A)@A)@A)LA)XA)dA)pA)pA)A)A)A)A)A)A)A)A)ЛA)ЛA)ܛA)A)A)A)A)A)A)A)(A)8A)DA)PA)\A)\A)hA)hA)tA)A)A)A)A)A)A)A)A)МA)ܜA)A)A)A)A)A)A)A),A):8A@:LAB:LAD:LAF:LAH:LAJ:LAQ:\AU:lA`:Ab:Ad:Ae:Af:Ag:Ah:Ai:Aj:Al:An:Ap:ĢAr:ĢAt:ĢAv:ĢAx:ĢAz:ĢA|:ԢA;A;A;A;A;A;A ;A ;A ;$A;0A;;A?;AB;4}AD;4}AF;4}AH;4}AJ;4}AL;4}AN;4}AP;4}AV;AW;Ad;̣Ae;̣Af;أAg;APA?P,A@PADPAHPAR̦ARܦAeAeAeAeAeAeAeAeAeAeAe Ae AeAeAeAeAe,Ap8ApDA pPA0p\AqdAqlAqAqAqA qA!qA"qA#qԧA$qA%qAqAqAqAqAqAq$Aq4AqDAqTAq`AqlAqxAqAqAqAvAxAAAԨA AAAAAAAAA A(A8A8A8ADADAPA\ADADAhAĄtAńAʄA˄AAAԩAAAAAAA A A A A AAA(A4A4A4A4A(ADAPA\AhAtAA A!A"ЪAAAAAAAAAAR AT4A0HA1HA2HA8}A9}A:}A;}APTAQdARHASHATHAUxAVшAWјAXѨAAȫAԫA~A`r8A`s8A`w8A`8A`8,AAP8AQ8ARDASTAT`AU`AVpAWpAY|AZA[A\A]A^A`ĿAdпAeAfAgAhAjAkAl$Am$An4A~HATAdAxAAAAAAAAAAAA$A@AL?TALAFALhALpALfxALALALALALALALALALALAL AL0AL DAL!TAL"dAL#tAL(AL@ALAALBALDALFALGALHALIALJALK8ALL\ALPALQALRALSALTALUALVALWALXAL`AL AYA0A/ DA/ LA//dAyAy`AypAy AyAyAyAyLsAyAyAyAyA# A# A#A# A#4A# DA#XA# hA# |A# A#PA#`A#A#A#A# A#@A#%A#`A# A#A#P$A#P4A#DA#PA#``ApAAAAAAA 2A 2A 2A 2A 2$A G4AA?AfAgAhAiAjAkAmAn(Ao4A@ALAXAdApA|AAAAA`AaAAAAAAAA A (A0A8A@AHAPAXA`ApA A@ApAAAAA AA A,A18A1@A2HABTA`AJ0APhAP@pAP@ APeAPAPZZAPfAJAE!AE$ASXA A!B@B]B]$B]4B]4B] 4B] HB]4B]`B]xB]B]BsBsBsBsBs Bs Bs BsBs > > >  >> ! >> >;2;";0;.;v;p;q;4;q;ʄ;$;!$;J$;K$;$;$;$;$;$;$;$4;$4;%;%4;%4;&;o&;S&4;Q&4;R&4;';'4;'4;'4;'4;'4;'4; (4;!(4;"(4;$(4;%(4;((4;)(4;*(4;P(; )4;!)4;&)4;()4;-)4;.)4;:4;:4; :4;&:4;&4; ;4;!;4;&;4;(;4;-;4;.;4;4;4;4; 4;(P4;(; t;t;At;it; ; xd;@@;C0;F0;H0;I0;;1;5;@;1b;qT;qT;d1T;T;$ST;T; T;T;I1;I2;;7S;rS;I3;d;U;;;;;;;)R(;,;,;,;,;,;3M;8M;0 ;0M;hM;hb;iM;ib;u;uR;ur;3x;3x;q3x;u3x;v3x;w3x;s3x;r3x;=x;5x;=x;5x;w5x;q5x;u=x;t5x;p5x;s=x;h;h;h;h; h;;;;;;@8;A8;B8;J8;K8; ;e ; ; ; ;S ;5 ;e ;n ; ;H ;` ;l ;Y ;;;;T;U;6;>;f;g;~;;;;;\;];^;_;P;Q;R;S; ; ; ; ; ; ; ; ; ;;;ICd;iCd;vCd;Cd;Cd;nC;yC;zC;a#\;c#\;e#\;f#\;h#\;P;c?E"f?$g? g?Dh?9Ph? h?h?h?Hj?fj? Zh?j?-m?0m?{m?m?w! ]G4" eB"   w! ]G4"    XD31P@0qw!! rq! 2r!qq! 0          JtT4$&(`& 0&0 0 `"0 0    @DHL  @DHL  BB B(B2""  222CC @ @WD2?2?  6higYCW em_iffxv|w   &'(yz{u^_`}~&   !"#$LJKMIL)@PDPHPqqqq (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx   #&) !%),036:=#(,159=ADHKOR(-38=BFKOSW[^beh<BHMRW\`dhloruwySY_dimqtwz|hmrvy|rrrr;Y2w2(w2Xw2'w28w2Hw2hwb0000b555C C!CC$CCCCC%Ctargetlunsizewidthxintchanneldriveconsolemuxconfigurationinterfacevendorproductreleaseportnoreportidphydevfunctionwsmuxcryptobiohotplugloopbpfilter%s:%d: %s %s(%s:%d:%d): %s %s(%s:%d:%d): using BIOS timings using PIO mode %d, DMA mode %d, Ultra-DMA mode %ddrive at %s channel %d drive %datapi type: %s c_bcount: %d c_skip: %d missing untimeout%s channel %d: reset failed for drive 0 drive 1%s: transfer error, downgrading to Ultra-DMA mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to PIO mode %d wdccmdwdcsplwdctagged DT %s: target %d now using %s%s%d bit async 80.040.020.013.310.06.675.03.33?? MHz %d REQ/ACK offset xfers %s: bad offset in siop_sdp (%d) %s: ppr negotiation for target %d: no DT option %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: rejecting invalid PPR negotiation from target %d %s: rejecting invalid wide negotiation from target %d (%d) %s: switching to differential mode %s: switching to single-ended mode %s: switching to LVD mode %s: invalid SCSI mode 0x%x %s: timeout waiting for DIFFSENSE to stabilise clear fifo failed %s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d siop: can't find my sync parameterssiop: resel switch full%s: can't malloc memory for target %d %s: can't alloc lunsw for target %d %s: can't alloc siop_lun for target %d lun %d %s: untagged command already running for target %d lun %d (status %d) %s: can't allocate memory for command descriptors head %s: can't allocate memory for command descriptors %s: unable to allocate cbd xfer DMA memory %s: unable to allocate cbd sense DMA memory %s: unable to create data DMA map for cbd: error %d siop_start: bad status%s: request sense failed %s: unable to load data DMA map (for SENSE): %d %s: scsi bus reset cmd %p (tag %d) added to reset list cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d timeout on SCSI command 0x%x INTRF single step dsp 0x%08x dsa 0x08%x %s: DMA IRQ: illegal instruction bus fault parity DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid %s: scsi gross error %s: unexpected phase mismatch %d %s: phase mismatch without command parity error %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! error, DSP=0x%x %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x unhandled message 0x%x %s: extended message too big (%d) MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()reselect failed %s: done without command, DSA=0x%lx unknown irqcode %x != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: unable to load data DMA map: %d siop%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_ioctl: i shouldn't get other ioctls! wihap_deauth_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s %s: power management is disabled, cannot do WOL %s: no auxiliary power, cannot do WOL from D3 (power-off) state %s: can't map mbuf (error %d) %s: tried to map busy TX descriptor %s: unknown imtype %d%s: tried to map busy RX descriptor %s: reset never completed! %s: PHY write failed %s: bad phy register %x %s: PHY read failed %s: unknown bus speed, assume 33MHz : unknown ASIC (0x%04x): %s (0x%04x), %s, address %s %s: can't allocate tx listseg, error = %d %s: can't map tx list, error = %d %s: can't create tx list map, error = %d %s: can't load tx list, error = %d %s: can't create DMA map for TX %s: can't allocate rx listnseg, error = %d %s: can't map rx list, error = %d %s: can't create rx list map, error = %d %s: can't load rx list, error = %d %s: can't create DMA map for RX %s: no PHY found! %s: watchdog timeout RTL8100RTL8100E 1RTL8100E 2RTL8101RTL8101ERTL8102ERTL8401ERTL8402RTL8411RTL8102ELRTL8102EL 1RTL8103ERTL8110SRTL8139C+RTL8168 1RTL8168 2RTL8168 3RTL8168C/8111CRTL8168CP/8111CPRTL8168F/8111FRTL8105ERTL8168D/8111DRTL8168DP/8111DPRTL8168E/8111ERTL8168E/8111E-VLRTL8169RTL8169/8110SBRTL8169SBLRTL8169/8110SCdRTL8169/8110SCeRTL8169S%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interruptcomcninit: mapping failed%s: %d silo overflow%s, %d ibuf overflow%s comprmRT5222unknownRT2522RT2523RT2524RT2525RT2525eRT2526%s: could not write to RF %s: could not read from BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not enable device %s: could not allocate protection frame %s: sending mgt frame failed 0x%08x %s: sending data frame failed 0x%08x %s: could not load old rx mbuf%s: could not allocate beacon %s: could not create desc DMA map %s: could not allocate DMA memory %s: can't map desc DMA memory %s: could not load desc DMA map %s: could not allocate soft data %s: could not create DMA map %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not load rx buf DMA map%s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: could not allocate Tx ring %s: could not allocate ATIM ring %s: could not allocate Prio ring %s: could not allocate Beacon ring %s: could not allocate Rx ring ralRT2529 (MIMO XR)RT5225RT5325 (MIMO XR)RT2527ral-rt2661ral-rt2561ral-rt2561s%s: error %d, could not read firmware %s %s: could not allocate beacon frame %s: timeout waiting for MCU to initialize %s: could not load 8051 microcode %s: timeout waiting for NIC to initialize %s: MAC/BBP RT%X, RF %s %s: could not allocate Tx ring %d %s: could not allocate Mgt ring RT3053RT2820RT2850RT2720RT2750RT3020RT2020RT3021RT3022RT3052RT3320%s: timeout waiting for DMA engine %s: could not read RF register %s: could not read from BBP through MCU %s: could not write to BBP through MCU %s: timeout waiting for BBP to wake up %s: can't map DMA memory %s: could not load DMA map %s: radio is disabled by hardware switch %s: timeout waiting for MAC %s: could not allocate Rx mbuf ral-rt2860%s: error %d, could not read firmware file %s %s: MAC/BBP RT%X (rev 0x%04X), RF %s (MIMO %dT%dR) %s: could not allocate Tx pool %s: reset rx ring timedout %s: can't allocate DMA mem %s: can't map DMA mem %s: can't load DMA mem %s: can't select regwin %d %s: invalid max txpower in sprom %s: no tssi2dbm table for 11a PHY %s: bwi_rf_calc_txpower failed %s: only BCM2060 rev 1 RF is supported for 11A PHY %s: only BCM2050/BCM2053 RF is supported for supported for 11B PHY %s: only BCM2050 RF is supported for 11G PHY %s: unsupported PHY mode %s: %s is not implemented yet %s: unsupported 11A PHY, rev %u %s: unsupported 11B PHY, rev %u %s: unsupported 11G PHY, rev %u %s: unsupported PHY type %d %s: too many MACs %s: %dth MAC already attached %s: MAC rev %u is not supported %s: can't select regwin 0 %s: no BBP id for device id 0x%04x %s: no number of win for BBP id 0x%04x %s: bus regwin already exists %s: no MAC was found %s: no bus regwin was found %s: MACs bus space mismatch! %s: config PS failed %s: can't stop MAC %s: invalid IV image, ofs %s: invalid ofs (0x%04x) for %dth iv %s: invalid IV image, val32 %s: invalid IV image, val16 %s: invalid IV image, size left %d %s: load IV failed %s: load ExtIV failed %s: firmware (fw & pcm) loading timed out %s: firmware version 4 is not supported yet %s: invalid firmware (%s): invalid size %u %s: invalid firmware (%s): size mismatch, fw %u, real %u %s: invalid firmware (%s): type mismatch, fw '%c', target '%c' %s: invalid firmware (%s): wrong generation, fw %d, target %d %s: base tssi measure failed %s: TEST1 failed %s: TEST2 failed %s: %s failed, MAC status 0x%08x %s: %s failed, intr status %08x COMunknown regwin type 0x%04x%s: %s disable clock timeout %s: %s wait BUSY unset timeout unsupported rate %dimpossible lna gain %dunsupported lpdunknown PHY mode %u%s: zero tx id %s: wait for TX ring(%d) stable timed out %s: reset TX ring (%d) timed out %s: can't create %dth tbd, %dth DMA map %s: can't create spare RX buf DMA map %s: can't create %dth RX buf DMA map unsupport modulation type %u%s: invalid rate %u or fallback rate%s: prepend TX header failed %s: can't load TX buffer (1) %d %s: can't defrag TX buffer %s: can't load TX buffer (2) %d unsupported modtype %u%s: zero length data, hdr_extra %d %s: can't allocate %dth RX buffer %s: can't create txstats ring DMA mem %s: can't allocate txstats ring DMA mem %s: can't map txstats ring DMA mem %s: can't load txstats ring DMA mem %s: can't allocate txstats DMA mem %s: can't map txstats DMA mem %s: can't load txstats DMA mem %s: %dth TX ring DMA create failed %s: %dth TX ring DMA alloc failed %s: RX ring DMA create failed %s: RX ring DMA alloc failed %s: TX stats DMA alloc failed unknown LED event %d%s: %s invalid channel! %s: can't set channel to %u bwi-airforceucode%d.fw%s: error %d, could not read firmware %s! pcm%d.fw%s: no suitable IV for MAC rev %d b0g0initvals%d.fwb0g0bsinitvals%d.fw%s: no suitable ExtIV for MAC rev %d %s: PHY calibrate failed %s: can't initialize %dth TX ring %s: can't initialize RX ring %s: can't initialize TX stats ring %s: invalid MAC address: %s unknown phymode %d%s: can't drain TX status %s: intr fatal TX/RX (%d) error 0x%08x intr PHY TX error %s: EO_ATIM %s: intr noise bwiuhci_alloc_std_chain: maxp=0 uhci_device_setintr: 0 interval uhci_device_isoc_close: %p not found uhci_allocmuhci_abort_xfer: not in process contextuhciabUHCI root hubuhci_device_isoc_enter: xfer=%p in frame list startstop%s: cannot %s %s: controller did not reset %s: interrupt while not operating ignored %s: host system error %s: host controller process error %s: host controller halted uhciohci_setintr: 0 interval ohci_device_isoc_abort: early return ohci_rem_ed: ED not foundohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohciab%s: isoc TD alloc failed OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x %s: reset timeout %s: SMM does not respond, will reset ,, legacy support version %d.%d%s %s: unsupported OHCI revision ohciehci isoc xfer being freed, but with no itd chainehci: isoc xfer suddenly has 0 bInterval, invalidehci_check_itd_intr: not valid itd ehciiawehciabehci_check_qh_intr: not valid sqtd ehci_open: bad device speed %d%s: Error opening low/full speed isoc endpoint. A low/full speed device is attached to a USB2 hub, and transaction translations are not yet supported. Reattach the device to the root hub instead. ehci: opening pipe with invalid bInterval ehci: zero length endpoint open request ehci: isoc descriptor requested that spans the entire frametable, too many frames ehci: unexpectedly ran out of isoc itds, isoc_startStarting ehci isoc xfer with polling. Bad idea? EHCI root hub%s: port reset timeout ehcidiehci_abort_xfer: not in process contextehciaw%s: config timeout ehcidb%s: run timeout ehciinvalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d unknown optional metadata type%s: unable to start background operation %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed sr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: sr_scsi_cmd got active wu%s: sr_wu_put got active wuvolume %s not found%s has unsupported sector size (%d)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %llu bytes required%s partition too large, wasting %llu bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline workqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwdfailed to allocate boot volume%s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: rebuild exhausted wu_r%s: rebuild exhausted wu_w%s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraid%s: i/o error on block %lld target: %d b_error: %d %s: invalid target on wu: %p%s: wu: %p not on pending queue sr_raid0_rw%s: %s: too many ccbs queued RAID 0 requires two or more chunksRAID 0%s: sr_raid1_recreate_wucould not requeue io%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently fail write on block %lld %s: is offline, can't read %s: sr_raid1_rwinvalid volume stateRAID 1 requires two or more chunksRAID 1%.2x %s: %s: invalid volume state transition %d -> %dio error: disk %x sr_raidp_rw%s: can't get wu_rDisk %llx offline, regenerating buffer %s: %s: %s: invalid chunk state transition %d -> %dRAID 4RAID 5%s: sr_crypto_rw2%s: sr_crypto_finish_iosr_crypto_wu_get: out of wus%s: i/o error on block %lld sr_crypto_intr: no wucannot open key disk %s%s partition not of type RAID (%d) %s is not a key diskKEYDISKunable to allocate work unitsunable to allocate CCBsincorrect key or passphraseCRYPTO requires exactly one chunkCRYPTOold_state = %d, %d = %d, invalid new_statesr_raid6_rwDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s RAID 6sr_concat_rwCONCAT requires two or more chunksCONCATRAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too long%s: insufficient message buffers %s: %s htplevhotplug: event lost, queue full Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocuvmexpvnodewatchescrashdumphaltrebootpoweroffmachineprintexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. /mnt/etc/firmware/%sRRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] CD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s@%dOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d lockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myselflockmgr: unknown locktype request %dNo KMEMSTATS compiled in %d,malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapphysiomawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMSIGPAUSEPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCISPWAITSSTEPSUGIDEXECSUSPSINGLENOZOMBIEINEXECSYSTRACECONTINUEDSINGLEEXITSINGLEUNWINDTHREADSUSPSIGSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%llu, sys=%llu, intr=%llu chgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlezombiedeadonprocplimitplcpu_switchto returnedidle%dfork idlestunrsensor_task_unregister: unexpected state %dsensordevpausesuspendsigwaitusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.coreissignal sigaplhashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %ld.%09ld to %ld.%09ld dummynanosleepdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds ?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqsmashed stack in %ssetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-10s %18s %18s Allocator%-10s %18p %18p inf %*u %*lu %*d %*s %*lu pool_put of NULLpool_do_put: %s: page header missingpool_get: PR_ZERO when ctor setpool_do_get: %s: page emptypool_init: too much uptimephpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o0x%x%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already%3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot %3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindquittimezoneverbosepollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d mbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_AUTH_AHM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.prio: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tailbiowaitbufplbiodone alreadyneedbufferbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dot vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASEDNOTMAPPED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p, %pall vnodes: %p, %p,brelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNNPFSNTFSUDFsyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%ld) detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegressif_attach_common: malloctoo many interfacesifaddritempl%s: can't handle af%d looutput: no header mbuflo%difmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrn_init: radix functions require max_keylen be set rn_initrn_init 2Mask for route not entered rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLNon-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodenot in ap mode, mode %u%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! -%s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss activepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bturboaearazbgbhbnbrbybzcacncocrczdodzegf2fifofrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntrtttwuaukuyvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%u rtableid %u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) revarparptfreearpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlIPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeplipqplip_initaeshmac-sha1deflate%d.%d.%d.%drip_attachrip_detachrip_usrreqsynpltcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbpltcpqepltcp_inittcp_usrrequdp_usrreqipip_input: should never reach herelibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrydevcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs2_balloc: block too bigffs2_balloc: unwind failedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1pldino2plupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_readdir: lost in spaceufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p inserting entry %p which collides with %p%s: duplicate insertion: state %p interting %p, colliding with %puvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestfituaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrkamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx km_allocvakmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no pageuvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) any[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free mapuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in inituvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_initsize 0 uvm_pagereallocpagersegpgdaemonpagedaemon: deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapmount: no device swapmount: no device 2 /dev/%s%d%cblkdev0x%xswapctl: miniroot copy failedswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_ifawithscope: output interface is not specified in6_savemkludge: no kludge spaceCouldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctl%s: didn't unlink in6ifaddr from list in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerOpenBSD-currentip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versiondb_fetch_reg: botch address 0x%08lx not a valid page address %p is invalid branch_taken: botchFaulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpu, rrx, %s r%d, %s #%d#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM OMAP3[45]30ARM OMAP3530ARM OMAP3630/DM3730CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufcan't init serial console @%lxunknown option `%c' cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: out of memoryinitarm: Failed to align the kernel page directoryWARNING: powerdown failed! The operating system has halted. Please press any key to reboot. rebooting... boot device: lookup '%s' failed. boot device: %s cdDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial.~ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lldMB, %lu bytes/sector, %lld sectors, thin%s: WARNING: unable to establish shutdown hook softintr_establish: unknown soft IPL %d"%s" at %s addr 0x%xiiclm75alm75lm77eeprommax1617xeontemplm93lm81lm87adm9240adt7470adt7476adt7475adt7462adt7466adt7467adm1033adm1034adm1030adm1031adm1025adm1024adm1023adm1028adm1022thmc5047m192sch5027emc6w201asc7611asc7621ne1619ds1780adt7460adm1027lm85adt7516lm63lm86lm89lm89-1lm90gl523smadt7461adm1021adm1032g781g781-1max6690max6646max6657max6642tmp401sa56004xw83791sdw83627dhgw83792dw83781dw83627hfw83782das99127fw83783sw83791dw83l784rw83l785rw83l785ts-lf75375asb100gl518smadm1026se97max6604mcp9805mcp98242mcp98243adt7408stts2002cat34ts02ts3000b3lis331dlit8712lm96000emc6d100sch5017it8712f-amtp008w83795gw83793gstts424e02%s: addr 0x%x %02x=%02x words %02x=%04x: %s%s: ricohrtc_clock_write: failed to write rtc %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_reg_write: failed to write reg%d : RICOH RS5C372[AB] Real-time Clock ricohrtc: F75375 rev %d.%dVcc, unable to register update task unable to read reg %d fintek: PCA9532 LED controller pcaledi80321_mem_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_io_bs_alloc(): not implementedpciiopaauiopiiciopmuiopwdogi80321_intr_establish: IRQ %d out of rangei80321intcresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! clockstattcr1: I2C controller %s: unable to subregion registers, error = %d iopiiclkattempting reset %s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersiopxs%03d:%02d:%d %04x:%04x WARNING: unknown PCI device header. mem %02xh %s 0x%08x 0x%08x NGOK [%s] Resource conflict. No available resources. fixup failed pci_addr_fixup: fixup failed. (new address=%#lx) new address 0x%08lx PCI I/O memory spacePCI I/O port space[%s]----------------------- device vendor product register space address size -------------------------------------------- System BIOS Setting--------------------------[%3d devices bogus] PCIBIOS fixup stageirq %diq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) board id failed Thecus Nx100I/O Data HDL-GCertance CP3100 addr 0x%08lx intr %dobio_bs_free(): not implementedobio_bs_alloc(): not implemented: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d com_obio%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramsST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete wddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error type%s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwsevent_read%s: can't attach mux (error=%d) wskbd at %s%s: event queue overflow wskdetwskbd_detach: %s didn't detach mux %dcannot load keymap: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusb_desc_iter_next: bad descriptor usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbpalockusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubucom at %s portno %d%s: lost %d chars %s: read start failed , %sucomlkucomugenwbugenwiugenriugenrb%s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d uhidevwiuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd: %d button%s, Z dir, W dir, Z and W dir %s: mouse has no X report %s: X report 0x%04x not supported %s: mouse has no Y report %s: Y report 0x%04x not supported ums%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s: failed to set configuration, err=%s : failed to get interface, err=%s %s: device is neither visor nor palm %s: init failed, %s GenericDebuggerHotSyncRemote File System%s: no proper endpoints for port %d (%d,%d) uvisor%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: abort rx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axe%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: Invalid notification length! (%d) %s: abort notify pipe failed: %s %s: close notify pipe failed: %s no %s: data interface %d, has %sCM over data, has %sbreak %s: no endpoint descriptor for %d %s: Could not find data bulk in %s: Could not find data bulk out %s: could not set data multiplex mode %s: status change notification available umodem%s: failed to set configuration, err=%s uftdi%s: failed to get configuration descriptor %s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: failed to get second interface, err=%s %s: reset failed, %s uplcom %s: failed to set configuration, err=%s umct%s: uvscom_intr: abnormal status: %s %s: uvscom_set_line_coding: %s %s: uvscom_set_line: %s %s: uvscom_shutdown: %s %s: uvscom_readstat: %s %s: cannot open interrupt pipe (addr %d) uvsopuvscom%s: this device is using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: intr buffer 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x %s:notify serial state, len=%d, data=0x%02x %s: ubsa_request: %s %s: failed to set configuration: %s %s: failed to get interface: %s ubsa%s: unhandled set request: reg=%x onoff=%x %s: no proper endpoints found (%d,%d) uipaqumsm%s: this device is not using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: umass only mode. need to reattach %s: truinstall mode. need to reattach %s: no endpoint descriptor found for %d wiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usb%s: could not get card cfg! unknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-ext%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not read BBP %s: could not read EEPROM: %s %s: could not allocate tx xfer %s: could not allocate tx buffer %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not transmit beacon %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphy: internal PHY dcphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbgebnxbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5461 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5464 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT/SX PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT/SX PHYBCM54XX 10/100/1000baseT PHYBCM5481 10/100/1000baseT PHYBCM5482 10/100/1000baseT PHYBCM5722 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706 10/100/1000baseT/SX PHYBCM5708C 10/100/1000baseT PHYBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM57765 10/100/1000baseT PHYBCM57780 10/100/1000baseT PHYBCM5906 10/100baseTX PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S PHYnfe%s: unknown CICADA PHY model %x %s: unknown PHY speed %x ciphyCS8201 10/100/1000TX PHYCS8204 10/100/1000TX PHYVSC8211 10/100/1000 PHYCS8244 10/100/1000TX PHYVSC8601 10/100/1000 PHYmem address conflict 0x%x/0x%x io address conflict 0x%x/0x%x bridge io address conflict 0x%x/0x%x bridge mem address conflict 0x%x/0x%x dev %d function %dpci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_io_find: bad request%svendor 0x%04x product 0x%04xunknown vendor "%s", unknown product 0x%04xunknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xclass %s subclass %s, rev 0x%02x) rev 0x%02xmiscellaneousfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationsinputdockserial buswirelessI2Osatellite commDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx MiscOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711EZ1 CardBusOZ711SP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo4Voodoo5GLINT 300SXGLINT 500TXGLINT DeltaPermediaGLINT MXPermedia 2GLINT GammaPermedia 2vPermedia 3Wildcat III 6210Wildcat 5110Wildcat IV 72105000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249 PCI-PCIM524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AC1003AMD64 0Fh HyperTransportAMD64 0Fh Address MapAMD64 0Fh DRAM CfgAMD64 0Fh Misc CfgAMD64 10h HyperTransportAMD64 10h Address MapAMD64 10h DRAM CfgAMD64 10h Misc CfgAMD64 10h Link CfgAMD64 11h HyperTransportAMD64 11h Address MapAMD64 11h DRAM CfgAMD64 11h Misc CfgAMD64 11h Link CfgAMD64 14h HostAMD64 14h PCIEAMD64 14h Link CfgAMD64 14h Address MapAMD64 14h DRAM CfgAMD64 14h Misc CfgAMD64 14h CPU PowerAMD64 12h HostAMD64 12h PCIEAMD64 14h NB PowerAMD64 14h Reserved79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 PCICS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCIHudson-2 PCIE751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97Hudson-2 SATAHudson-2 SD Host ControllerHudson-2 USBHudson-2 USB2Hudson-2 SMBusHudson-2 IDEHudson-2 HD AudioHudson-2 LPCHudson-2 PCIHudson-2 xHCIRS780 HostRS880 HostRS780 PCIEMegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3 PCI-PCIU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1200ARC-1200 rev BARC-1202ARC-1210ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681ARC-1880AX88140A/88141ASM1042 xHCIASM1083/1085 PCIE-PCIRadeon HD 6310 HD AudioRadeon HD 6500D HD AudioRadeon M241PRadeon X300 M24FireGL M24 GLRadeon X600FireGL V3200Radeon X600 SecRadeon IGP 320Radeon IGP 340Radeon 9500 ProRadeon AE 9700 ProRadeon AF 9600TXFireGL AGZ1Radeon AH 9800 SERadeon AI 9800Radeon AJ 9800FireGL AK X2Radeon 9600 ProRadeon 9600Radeon 9550FireGLRadeon 9650Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon IGPRadeon 8500Radeon BC R200Radeon IGP 320MMobility M6SB200 AC97SB200 PCISB200 USB2SB200 USBSB200 IDESB200 ISASB200 ModemSB200 SMBusMach64 CTMach64 CXSB300 AC97SB300 PCISB300 SMBusSB300 USB2SB300 USBSB300 IDESB300 ISASB300 ModemSB300 SATASB400 AC97SB400 PCISB400 SMBusSB400 USB2SB400 USBSB400 IDESB400 ISASB400 ModemSB400 SATASB450 HD AudioSB600 SATASB600 AC97SBx00 HD AudioSB600 PCISBx00 SMBusSB600 USB2SB600 USBSB600 IDESB600 ISASB600 ModemSBx00 SATASB700 USB2SB700 USBSB700 IDESB700 ISASB800 PCIERadeon Mobility IGPMach64 ETRage ProMach64Rage XLRadeon 9000Radeon 9000 SecRadeon X800Radeon X800 ProRadeon X800SERadeon X800XTFireGL X3-256Radeon Mobility M18Radeon X800 SERadeon X800 XTRadeon AIW X800 VERadeon X800 Pro SecRadeon X850 XTRadeon X850 SERadeon X850 ProRadeon X850 XT PERage128Mobility M3Mobility 1Rage P/MRadeon Mobility M7FireGL Mobility 7800 M7Radeon Mobility M6Radeon Mobility M9Rage 128 MobilityRadeon 9500/9700Radeon 9600 TXFireGL X1Radeon 9800 ProRAdeon 9800Radeon 9800 XTFireGL X2Radeon Mobility M10Radeon Mobility 9550Radeon 9500/9700 SecFireGL X1 SecRadeon 9800 Pro SecRage 128 ProRage FuryRage 128Rage 128 PXAIW RadeonRadeon 9100Radeon 7500Radeon VEES1000Rage MagnumRadeon Mobility M300 M22Radeon Mobility X600 M24CFireGL M44 GL 5464Radeon X800 XT PERadeon X800 XTPRadeon X800 XLFireGL V7100FireGL V5100Radeon X800 SecMobility FireGL V5000 M26Radeon Mobility X700 XL M26Radeon Mobility X700 M26Radeon X550XTXRadeon X550XTX SecRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon IGP 9100Radeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRD580 HostRadeon XPRESS 200Radeon XPRESS 200MRX780 HostRD780 HT-PCIERadeon 9200 PRORadeon 9200Radeon 9200 SE SecFireMV 2200RD790 PCIESR5690 HostRD890 HostSR5670 HostSR5650 HostSR5690 PCIERS400 HostRC410 HostRX480 PCIERS480 PCIERadeon X300Radeon X600 (RV370)Radeon X550FireGL V3100FireMV 2200 5B65Radeon X300 SecRadeon X550 SecFireGL V3100 SecFireMV 2200 SecRadeon Mobility 9200Radeon 9200 SERadeon X800 XT M28FireGL V5100 M28Radeon Mobility X800 M28Radeon X850FireGL R480Radeon X850XTRadeon X800 GTO SecRadeon X850 XT SecFireGL V5000FireGL X700 XTFireGL X700 ProFireGL X700 SERadeon X700 PCIERadeon X700 SE PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRadeon HD 6670Radeon HD 5800Radeon HD 5700Radeon HD 5670Radeon Mobility HD 5470Radeon Mobility HD 5430Radeon HD 5450RS100 PCIRS200 PCIRadeon X1800Radeon X1800 XTRadeon Mobility X1800FireGL Mobility V7200FireGL V7200FireGL V5300FireGL Mobility V7100FireGL V7300FireGL V7350Radeon X1600RV505Radeon X1300/X1550Radeon X1550M54-GLRadeon Mobility X1400RADEON X1550 64-bitRadeon Mobility X1300 M52-64Radeon Mobility X1300Radeon X1300FireGL V3300FireGL V3350Radeon X1600 SecRadeon X1300/X1550 SecRadeon X1300 ProRadeon X1450Radeon Mobility X2300Radeon Mobility X1350Radeon Mobility X1450FireMV 2250Radeon X1550 64-bitRadeon X1300 Pro SecRadeon X1300 SecRadeon X1650Radeon X1600 ProFireGL V5200Radeon Mobility X1600Radeon X1650 ProRadeon X1300 XTFireGL V3400Mobility FireGL V5250Radeon X1700Radeon X1700 XTRadeon Mobility X1700Radeon X1600 Pro SecRadeon X1650 Pro SecRadeon X2300HDRadeon Mobility X2300HDRadeon X1950Radeon X1900AMD Stream ProcessorRadeon X1950 ProRV560Radeon Mobility X1900Radeon X1950 GTRV570FireGL V7400Rv560Radeon RX1650 XTRadeon X1950 Pro SecRadeon RX1650 XT SecRadeon 9000/9100 IGPRadeon RS350IGPRS690 HostRS740 HostRS690 PCIERS690M PCIERS690 HD AudioRadeon X1250Radeon X1250 IGPRadeon 2100Radeon HD 4870Radeon HD 4850Mobility Radeon HD 4870Radeon HD 4890Radeon HD 4670Radeon HD 4650Radeon HD 2400 XTRadeon HD 2400 ProMobility Radeon HD 2400Radeon HD 3870Radeon HD 3850Radeon HD 4550Radeon HD 4350Mobility Radeon HD 4500Mobility Radeon HD 2600Radeon HD 2600 Pro AGPRadeon HD 2600 XTRadeon HD 2600 ProMobility Radeon HD 3650Mobility Radeon HD 3670Radeon HD 3650 AGPRadeon HD 3650Radeon HD 3470Mobility Radeon HD 3400Radeon HD 3450Radeon HD 3450 AGPRS780 HD AudioRadeon HD 3200Radeon HD 3100Radeon HD 3300Radeon HD 3000Radeon HD 6620GRadeon HD 6520GRadeon HD 6480GRadeon HD 6530DRadeon HD 4200 HD AudioRadeon HD 4200Mobility Radeon HD 4200Radeon HD 4290Radeon HD 4250Radeon HD 6310Radeon HD 6250Radeon HD 6320Radeon HD 2600 HD AudioRS690M HD AudioRadeon HD 3870 HD AudioRadeon HD 3600 HD AudioRadeon HD 34xx HD AudioRadeon HD 48xx HD AudioRadeon HD 4000 HD AudioRadeon HD 5800 AudioRadeon HD 5700 AudioRadeon HD 5600 AudioRadeon HD 5470 AudioRadeon HD 6670 AudioRadeon HD 6400 AudioRS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST2000AR5210AR5311AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR9160AR9280AR9281AR9285AR2427AR9227AR9287AR9300AR9485AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefAT76C506IDE-2015PLL1EL1L2CL1CL1DL2FL1FL2Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000Dual SerialQuad SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNRT2890F5D6001F5D6020V3F5D7010F5D6000VME 617VME 270655015601BCM43224BCM5752BCM5752MBCM5709BCM5709SBCM5716BCM5716SBCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM57710BCM57711BCM57711EBCM5705BCM5705KBCM5717BCM5718BCM5719BCM5721BCM5722BCM5723BCM5705MBCM5705M AltBCM5720BCM57712BCM57712EBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5754MBCM5755MBCM5756BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5751MBCM5751FBCM5787FBCM5761EBCM5761BCM57762BCM5764BCM57766BCM5761SBCM5761SEBCM57760BCM57788BCM57780BCM5787MBCM57790BCM5782BCM5784BCM5785GBCM5786BCM5787BCM5788BCM5789BCM5785FBCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM57761BCM57781BCM57791BCM57786BCM57765BCM57785BCM57795BCM57782BCM5702 AltBCM5703 AltBCM5781BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5903FBCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4315BCM4318BCM4319BCM4306BCM4309BCM43XGBCM4321BCM4322BCM43225BCM43227BCM4401BCM4401B0BCM431358015802580558205821582258235825586058615862BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINITROX XLNITROX LiteNITROX PXCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearVIC PCIEVIC ManagementVIC EthernetVIC FCoEAAR-1210SAAAR-1220SAAAR-1225SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IRCX2388582C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTRTL8192ERTL8190PC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Live (Dell)SoundBlaster Audigy LSSoundBlaster Audigy 2SoundBlaster X-Fi XtremePCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port21050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)Memory Channel Cluster Controller21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCI21554 PCI-PCISWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Virtual UARTDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCI550TX530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDGE-528TDGE-530T C1DGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDNRT2860155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLPFCLP6000LPe121LPe1250LP952LP982LP101LP1050LP111LP1150LPe111LPe1150LPe1000LPe1000-SPLPe1002-SPLPe12000LPe12000-SPLPe12002-SPLP7000LP8000LP9000LP9802LP10000LPX10000LP10000-SLP11000-SLPe11000-SLPe12000-SLP11000LP11000-SPLP11002-SPLPe11000LPe11000-SPLPe11002-SPEndace Dag3.6DEndace Dag4.23GEFlash memoryMemory StickSD ControllerCB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pXR17C152XR17C154XR17C158ATM PCA-200ATM PCA-200e801 SoundMPC8349EMPC8349MPC8347E TBGAMPC8347 TBGAMPC8347E PBGAMPC8347 PBGAMPC8343EMPC8343FL1000 xHCIFL1009 xHCIPW008GE5PW008GE4PRIMEPOWER250/450 LANioDrive v1.2ioDriveioXtremeioXtreme ProTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02Pulsar G7370 ADSLPR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopToolsNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iSmart Array P700mSmart Array P212Smart Array P410Smart Array P410iSmart Array P411Smart Array P812Smart Array P712mSmart Array P711miLO3 SerialiLO3 SlaveiLO3 ManagementiLO3 WatchdogSmart Array P222Smart Array P420Smart Array P421Smart Array P822Smart Array P420iSmart Array P220iSmart Array P721m77516500781179517814/7851/785480658165815479567955/7954HB6 PCI-PCIHB4 PCI-PCIMSVCC01 Video CaptureSH7751 PCISH7751R PCIMCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIMiami/PCIOlympici82557B 10/100RSAFireGL2133 PCIX-PCIX4810 BSP4810 SCCCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM (NICStAR)89HPES12N3A89HPES24N3A89HPES24T689HPES4T489HPES24T3G2WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950VirtualBox Graphics AdapterVirtualBox Guest ServiceIPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA21145Core HostCore PCIEHD Graphics3400 PCIECentrino Advanced-N 6205WiFi Link 1000Centrino Advanced-N 6250WiFi Link 1030Centrino Advanced-N 6030Core 2G HostCore 2G PCIEHD Graphics 2000Xeon E3-1200 HostHD Graphics P3000HD Graphics 3000Xeon E3-1200v2 HostHD Graphics 2500Core 3G HostHD Graphics 4000HD Graphics P400080303 IOP80312 I/O Companion6700PXH PCIE-PCIX6702PXH PCIE-PCIXIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIXDH89XXCC SGMIIDH89XXCC SerDesDH89XXCC backplaneDH89XXCC SFP82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NXGDT RAIDWiFi Link 6150WiFi Link 130WiFi Link 100i960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 2100PRO/10GbE (82597EX)ICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 MPRO/1000 PT (82571EB)PRO/1000 PF (82571EB)PRO/1000 PB (82571EB)82801FB LAN82801FBM LAN82801GB LANPRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000GT (82541GI)PRO/1000 PT (82572EI)PRO/1000 PF (82572EI)PRO/1000 PB (82572EI)PRO/1000MT (82573E)82573E IDE82573E KCS82573E SerialPRO/1000 PT (80003ES2)PRO/1000 PF (80003ES2)PRO/1000MT QP (82546GB)PRO/1000MT (82573L)PRO/10GbE CX4 (82597EX)PRO/1000 AT (82571EB)PRO/1000 AF (82571EB)PRO/1000 QP (82571EB)PRO/1000 PT (82575EB)PRO/1000 PF (82575EB)PRO/1000 PL (82573L)PRO/1000 PM (82573V)PRO/1000 PM (82573E)10GbE (82598)ICH9 IGP AMTICH9 IGP MICH9 IFEICH9 IFE GICH9 IFE GTICH8 IFE GTICH8 IFE G10GbE SR Dual (82598AF)10GbE SR (82598AF)10GbE (82598AT)PRO/1000 (82576)ICH9 IGP M VICH10 R BM LMICH10 R BM LFICH10 R BM VPRO/1000 MT (82574L)PRO/1000 QP (82571PT)PRO/1000 QP (82575GB)10GbE Dual (82598AT)10GbE SFP+ (82598EB)10GbE CX4 (82598EB)ICH10 D BM LMICH10 D BM LF10GbE SR Dual (82598)ICH9 BMPRO/1000 FP (82576)PRO/1000 QP (82576)82577LM82577LC10GbE CX4 Dual (82598EB)10GbE VF (82599)82578DM82578DC10GbE DA Dual (82598)10GbE LR (82598EB)ICH9 IGP M AMT82574L10GbE KX4 (82599)10GbE Backplane (82599)10GbE CX4 (82599)10GbE SFP+ (82599)10GbE XAUI (82599)8255282815 Host82815 AGP82815 Video82806AA APIC82559ER82092AA IDESAA711682452KX/GXEE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437MX82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot PlugICH8 82567V-382579LM82579V10GbE SFP EM (82599)10GbE BX (82598)PRO/1000 (82576NS)PRO/1000 (82583V)82576 SerDes QPI340-T4 (82580)82580 Fiber82580 SerDes82580 SFPI340-T2 (82580)10GbE KR (82599)82576NS SerDes82599 T3I350I350 FiberI350 SerDesI350 SGMII82580 QFX540TSFP+ FCOE (82599)FCOE (82599)80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPI/OAT7 Series xHCIPRO/10GbE SR (82597EX)PRO/10GbE LR (82597EX)6 Series SATA6 Series AHCI6 Series RAID6 Series PCIE6 Series HD Audio6 Series SMBus6 Series Thermal6 Series DMI-PCI6 Series USB6 Series MEI6 Series KTZ68 LPCP67 LPCUM67 LPCHM65 LPCH67 LPCHM67 LPCQ65 LPCQS67 LPCQ67 LPCQM67 LPCB65 LPCC202 LPCC204 LPCC206 LPCH61 LPCC600 SATAC600 AHCIC600 RAIDC600 PCIEC600 HD AudioC600 SMBusC600 ThermalC600 USBC600 LANC600 MEIC600 Virtual PCIEC600 LPC7 Series SATA7 Series AHCI7 Series RAID7 Series PCIE7 Series HD Audio7 Series SMBus7 Series USB7 Series MEI7 Series KTZ77 LPCZ75 LPCB75 LPCH77 LPCQM77 LPCHM77 LPCUM77 LPCHM76 LPCHM75 LPCHM70 LPC82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA Hub-to-PCI82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 Host82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCIE7500 HostE7500 Error ReportingE7500 PCIE7501 HostE7505 HostE7505 Error ReportingE7505 AGPE7505 PCI82845G Host82845G AGP82845G Video82865G Host82865G AGP82865G Video82865G CSA82865G Overflow82875P Host82875P AGP82875P CSA82915G Host82915G PCIE82915G Video82925X Host82925X PCIEE7221 HostE7221 PCIEE7221 Video82915GM Host82915GM PCIE82915GM Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000 PCIE x85000 PCIE x16E8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI6321ESB RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945G Host82945G PCIE82945G Video82955X Host82955X PCIEE7230 HostE7230 PCIE82975X PCIE82975X Host82945GM Host82945GM PCIE82945GM Video82945GME Host82945GME Video82801GH LPC82801GB LPC82801GBM LPCNM10 LPC82801GHM LPC82801GB SATA82801GR AHCI82801GR RAID82801GBM SATA82801GBM AHCI82801GHM RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HEM LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI82801H RAID82801HBM SATA82801HBM AHCI82081HBM RAID82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801H Thermal82801HBM IDE82801IH LPC82801IO LPC82801IR LPC82801IEM LPC82801IB LPC82801IBM LPC82801I SATA82801I AHCI82801I RAID82801I SMBus82801I Thermal82801I USB82801I HD Audio82801I PCIEICH9 IGP C82946GZ Host82946GZ PCIE82946GZ Video82946GZ HECI82946GZ PT IDER82946GZ KT82G35 Host82G35 PCIE82G35 Video82G35 HECI82Q965 Host82Q965 PCIE82Q965 Video82Q965 HECI82Q965 PT IDER82Q965 KT82G965 Host82G965 PCIE82G965 Video82G965 HECI82G965 PT IDER82G965 KT82Q35 Host82Q35 PCIE82Q35 Video82Q35 HECI82Q35 PT IDER82Q35 KT82G33 Host82G33 PCIE82G33 Video82G33 HECI82G33 PT IDER82G33 KT82Q33 Host82Q33 PCIE82Q33 Video82Q33 HECI82Q33 PT IDER82Q33 KT82X38 Host82X38 PCIE82X38 HECI82X38 PT IDER82X38 KT3200/3210 Host3200/3210 PCIE3210 PCIEGM965 HostGM965 PCIEGM965 VideoGM965 KTGM965 PT IDERGME965 HostGME965 PCIEGME965 VideoGME965 HECIGME965 PT IDERGME965 KTGM45 HostGM45 PCIEGM45 VideoGM45 HECIGM45 PT IDERGM45 KTQ45 HostQ45 PCIEQ45 VideoQ45 HECIQ45 PT IDERQ45 KTG45 HostG45 PCIEG45 VideoG41 HostG41 VideoRCU32 I2O RAID3124 SATA31244 SATA82855PM Host82855PM AGP82855PM Power5500 HostX58 Host5520 HostX58 PCIE5520/X58 QuickPath5520 QuickPathX58 GPIOX58 RASX58 QuickPathX58 QuickDataX58 IOxAPICX58 MiscX58 ThrottleX58 TXT6321ESB IOxAPIC6321ESB PCIE-PCIX82830M Host82830M AGP82830M Video82855GM Host82855GME AGP82855GM Video82855GM Memory82855GM Config82854 Host82854 VideoE7520 HostE7520 Error ReportingE7320 HostE7320 Error ReportingE7520 DMAE7520 PCIEE7520 ConfigE7525 Host3100 Host3100 Error Reporting3100 EDMA3100 PCIE7300 Host7300 PCIEI/OAT CNB7300 FSB/Boot/Interrupt7300 Snoop Filter7300 Misc7300 FBD82801JD SATA82801JD AHCI82801JD RAID82801JDO LPC82801JIR LPC82801JIB LPC82801JD LPC82801JI SATA82801JI AHCI82801JI RAID82801JI SMBus82801JI USB82801JI HD Audio82801JI PCIE82801JDO VECI82801JD Virtual SATA82801JD SMBus82801JD Thermal82801JD USB82801JD HD Audio82801JD PCIE82801JD LANP55 LPCPM55 LPCH55 LPCQM57 LPCH57 LPCHM55 LPCQ57 LPCHM57 LPCQS57 LPC3400 LPC3420 LPC3450 LPC3400 SATA3400 AHCI3400 RAID3400 SMBus3400 Thermal3400 USB3400 HD AudioQS57 HD Audio3400 MEI3400 PT IDER3400 KTE5 HostE5 PCIEE5 DMAE5 Address MapE5 Error ReportingE5 I/O APIC5400 Host5400A Host5400B Host5400 PCIEI/OAT SNB5400 FSB/Boot/Interrupt5400 Coherency Engine5400 IOAPIC5400 RASE600 HostPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965Centrino Ultimate-N 6300Centrino Advanced-N 6200WiFi Link 5100WiFi Link 5300WiFi Link 5350WiFi Link 5150Turbo MemoryEP80579 HostEP80579 MemoryEP80579 EDMAEP80579 PCIEEP80579 SATAEP80579 AHCIEP80579 ASUEP80579 ReservedEP80579 LPCEP80579 SMBusEP80579 USBEP80579 PCI-PCIEP80579 CANbusEP80579 SerialEP80579 1588EP80579 LEBEP80579 GCUEP80579 LANi960 RD PCI-PCIPRO 100 Server5100 Host5100 PCIE5100 FSB5100 Reserved5100 DDRI/OAT SCNB82371SB ISA82371SB IDE82371SB USB82437VX82439TX82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power82810 Host82810 Video82810-DC100 Host82810-DC100 Video82810E Host82810E Video82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGPUS15W HostUS15L/UL11L HostUS15W VideoUS15L/UL11L VideoSCH PCIESCH USBSCH USB ClientSCH LPCSCH IDESCH HD AudioSCH SD/MMCE600 PCIEE600 VideoE600 ConfigE600 LPC82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXBEG20T PCIEEG20T Packet HubEG20T EthernetEG20T GPIOEG20T USBEG20T USB ClientEG20T SDIOEG20T AHCIEG20T DMAEG20T SerialEG20T SPIEG20T I2CEG20T CANEG20T 158882802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDPineview DMIPineview VideoS21152BB PCI-PCI21154AE/BE PCI-PCICore DMICore QPI LinkCore QPI RoutingCore ManagementCore ScratchCore ControlCore MiscPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8213FIT8330GIT8888F ISAIT8892E PCIE-PCIJMC250JMC260JMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDExDKTIHSSIDS3SSIDS1HSSIcAppian LiteParallelDual ParallelS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394FW643 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88E8040Yukon 88E8040TYukon 88EC033Yukon 88E8042Yukon 88E8048Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon 88E8072Yukon 88E8075Yukon 88E8057Yukon 88E8059Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6111 SATA88SE6120 SATA88SE6121 SATA88SE6122 SATA88SE6140 SATA88SE6141 SATA88SE6145 SATA88SX7042 SATA88SE9120 SATA88SE9123 SATA88SE9125 SATA88SE9172 SATAMGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200e (ServerEngines)MGA G400/G450 AGPMGA G200eWMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA G200eRMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDPCI32PCI509PCI511PEX511GPS170PCIConnectX ENKSZ8841 10/100KSZ8842 dual-port 10/100 switchRT3090MN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelSerial MCS9865MPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULCP-104JUC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000CH352NCP130NCP130 Rev A2PCI-GPIBNET2282 USBNXB-10GXxR (NX2031)NXB-10GCX4 (NX2031)NXB-4GCU (NX2035)IMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtNX3031DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620TNm9805Nm9820Nm9835Nm9845Nm9865Nm9901Nm9922CMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRCMI8788 HD AudioNSP2KNetVin 5000Universe VMETsi381 PCIE-PCIFalcon PFalcon SEF100253c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066EMegaRAID SAS2208SAS1064ASAS1066SAS1078SAS2116SAS2308SAS2004SAS2008MegaRAID SAS2008SAS2108MegaRAID SAS2108 CRYPTO GEN2MegaRAID SAS2108 GEN2SAS1078DESAS220853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXPI7C9X130 PCIE-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04 PCI-PCInForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAGeForce 7800 GTXGeForce 7800 GTAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3 PCI-PCICK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTGeForce 5300 PCXQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7200 GSGeForce 7300 GoGeForce 7400 GoGeForce 7300 GSnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce Go 6150GeForce Go 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51 PCI-PCIMCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7900 GT/GTOGeForce Go 7950 GTXQuadro FX 3500GeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 MemoryMCP55 USBMCP55 IDEMCP55 PCI-PCIMCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTGeForce 7600 GoC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430GeForce 6100 nForce 405GeForce 7025 nForce 630aMCP61 ISAMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 MemoryMCP61 SMBusMCP61 IDEMCP61 USBMCP61MCP61 SMUGeForce 8600 GTGeForce 8600M GTQuadro FX 570MGeForce 8500 GTGeForce 8400 GSGeForce 8400M GSGeForce 8400M GMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAGeForce GTX 285GeForce 7000MGeForce 7050 PVMCP67 MemoryMCP67 SMBusMCP67 Co-processorMCP67 ISAMCP67 LANMCP67 SATAMCP67 AHCIMCP67 RAIDMCP67 HD AudioMCP67 USBMCP67 IDEMCP67 PCIMCP67 PCIEMCP77 MemoryMCP77 PCIEMCP73 USBMCP73 IDEMCP73 PCIEnForce 200GeForce 9800 GTXGeForce 8800 GTGeForce 9800 GTGeForce 9600 GTGeForce 9300 GEGeForce 9300M GSQuadro NVS 150mQuadro NVS 160mMCP77 SMBusMCP77 Co-processorMCP77 IDEMCP77 PCIMCP77 ISAMCP77 LANMCP77 HD AudioMCP77 USBMCP73 HostMCP73 MemoryMCP73 ISAMCP73 SMBusMCP73 LANGeForce 7100GeForce 7050MCP73 SATAMCP73 AHCIMCP73 RAIDMCP73 HD AudioGeForce 8200m GGeForce 9100GeForce 8200nForce 780a SLIGeForce 9400GeForce 9400mGeForce 9300ION VGAGeForce 320MGeForce 210MCP79 HostMCP79 MemoryMCP79 PCIEMCP79 SMBusMCP79 Co-processorMCP79 USBMCP79 ISAMCP79 LANMCP79 SATAMCP79 AHCIMCP79 RAIDMCP79 HD AudioMCP77 SATAMCP77 AHCIMCP77 RAIDGF108 HD AudioGF116 HD AudioMCP89 HostMCP89 MemoryMCP89 PCIEMCP89 SMBusMCP89 Co-processorMCP89 LANMCP89 LPCMCP89 SATAMCP89 AHCIMCP89 RAIDMCP89 HD AudioMCP89 USBGeForce 425MGeForce GTX 550 TiOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA (F32)010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950OXmPCI954OXmPCI954 DisabledExsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56Virtio NetworkVirtio StorageVirtio MemoryVirtio ConsoleCMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS Host (GC-LE)CNB20-HE HostCNB20-HE Host (GC-LE)CMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAHT-1100HT-1100 SATAVerite 1000Verite V2x00SH7757 PCIE-PCISH7757 PCIE SwitchT1/E1/J1Dual T1/E1/J1Quad T1/E1/J1ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVSAA7231 TVPS5000PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESPCI PC WDES1849I/O 1076I/O 1077PCI 6520PEX 8112PEX 8114PEX 8517PEX 8518PEX 8524PEX 8525PEX 8532PEX 8533PEX 8547PEX 8548PEX 8612PEX 8613PEX 8614PEX 8616PEX 8624PEX 8632PEX 8648I/O 9016I/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC42819PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP2422ISP2432ISP2512ISP2522ISP2532ISP4010 iSCSI TOEISP4022 iSCSI TOEISP4032 iSCSI TOEISP4010 iSCSI HBAISP4022 iSCSI HBAISP4032 iSCSI HBAISP5422ISP5432ISP6312ISP6322ISP8432PWDOG185008580RT2460ART2560RT2561SRT2561RT2661RT2760RT2790RT3062RT3091RT3092RT3562RT3592RT3593RT5390R1010 IDER1011 IDER6021 HostR6031 ISAR6040 EthernetR6060 USBR6061 USBRTS5209 Card Reader80298139D81298101E81388169SC816881698192SE818081858188CERTL8192CE8187SE5C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C843 MMC5C852 xD5U230 Memory Stick5U822 SD/MMC5U823 SD/MMC5U832 Firewire5U852 SD/MMCRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavage MX/128SuperSavage MX/64SuperSavage MX/64CSuperSavage IX/128 SDRSuperSavage IX/128 DDRSuperSavage IX/64 SDRSuperSavage IX/64 DDRSuperSavage IX/C SDRSuperSavage IX/C DDRTwisterTwister-KProSavage DDRProSavage DDR-KSonicVibesSafeXcelMagicLAN SWL-2210PA10xNeo-4Neo-8SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9821SK-9843SK-9ExxSK-9E21MBladeEngine2 10GbEBladeEngine3 10GbEIOC3Rad1TigonIOC4ImageSync 1STG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PROSC9230186C201 AGP86C202 AGP648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA183 SATA1901915597/5598 VGA6215300/305/630 VGA315 Pro VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI662 PCI671 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA968 ISA1182 SATA1183 SATA1184 RAID1185 AHCI540 VGA530 VGA551155125513 EIDE5518 EIDE5571 PCI558155825591 PCI55965597/5598 Host6204650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio7300 VGA966 HD Audio83C170 (EPIC/100)83C175 (EPIC/100)FDC 37C665FDC 37C922Voyager GXLynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotRS780 PCI-PCIEasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KCrypto 6KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniNeptuneSBBCST201ST1023ST202140XX4018A50XXNE-344S2P4SSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigEB2C2 Sky2PCTN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 Secure DataPCI7XX1 Smart CardPCI6515 CardBusPCI6515 CardBus (Smart Card mode)PCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 Secure DataPCIXX12 Smart CardPCI1620 MiscXIO2000A PCIE-PCIXIO3130 PCIE-PCIE upstreamXIO3130 PCIE-PCIE downstreamXIO2221 PCIE-PCIXIO2221 FireWireACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2032 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBus5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OLongRun NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPCyberBlade XP2HPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostPT894 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostVX800 HostP4M900 HostVT8371 HostVT6415 IDEVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAChrome9 HC3 IGPPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64 PCI-PCIVT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700 PCI-PCIVX700 HostVT6655PM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVX800 DRAMChrome9 HC IGPVT8237S ISAVT8237A PCI-PCIPM800 PMCK8T890 IOAPICPT894 IOAPICCX700 IDEP4M890 IOAPICK8M890 IOAPICVT3351 IOAPICVX800 IOAPICP4M900 IOAPICVT8237S SATAVT8251 AHCIP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVX800 ISAVT8371 PCI-PCIVX855 ISAVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVX900 IDEVX800 SD/MMCVX800 SDIOK8T890 PCI-PCIP4M890 PCI-PCIP4M900 PCI-PCIVT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363 PCI-PCIVT8235 AGPK8HTB AGPVT8377 AGPVX800 PCI-PCIVX800 PCIEVX855 IDEVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICVirtual Machine Communication InterfaceVirtual EHCIVirtual PCI-PCIVirtual PCIE-PCIEVirtual Machine InterfaceP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCICF32APlatform DeviceVolari Z7Volari Z9s/Z9mVolari V3XTX3201-3X3201-3 (21143)CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205Martin-MariettaHauppaugeTTTechDynalinkCoregaRhino EquipmentCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseFoxconnNumber 9UMCITTPicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTekInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysFujitsuMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonAtmelVortexEfficent NetworksIDTFORE SystemsPhilipsCiscoZiatechCycloneEquinoxAllianceSchneider & KochDigiMutechXircomRenditionServerWorksAlteraRicohD-LinkCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFXATMLC-CubeAVMStallionASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTechAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1HifnExar3wareTechsan ElectronicsAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioEdimaxTamarackWorkbitAskeyAvermediaMSIAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantDeltaMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixMellanoxAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomNetSecZyDASSamsungAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionRDCINPROCOMMLanergyRalinkXGI TechnologySilanRenesasSangomaSolarflareOptionFreescaleAttansic TechnologyAgeiaJMicronPhisonServerEnginesASPEED TechnologyAWTFusion-ioQumranetASMediaEtronFresco LogicTekramTehuti NetworksHint3D LabsAddtronNetXenNanjing QinHeng ElectronicsIndustrial Computer SourceNetVinGemtekTurtle BeachMosChipXenSourcec't MagazinDecision ComputerQuancom InformationssystemeIntelInnoTekSigmatelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDcy82c693_writecy82c693_readcy82c693_initcy82c693_init: bus_space_map failed (%d): broken match/attach! : unable to map device registers : couldn't map interrupt : couldn't establish interrupt: invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: can't subregion offset %lu size %luchannel 0channel 1configuredwirednative-PCIcompatibility, %s %s to %s%s: %s disabled (no drives) %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s:%d: bogus intr %s:%d: bogus intr (reg 0x%x) %s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs %s: port %d: device connected, but communication not established %s: port %d: PHY offline %s: port %d: device present, speed: 1.5Gb/s, speed: 3.0Gb/s%s: port %d: unknown SStatus: 0x%08x %s %s channel: cannot allocate channel queue%s: %s cannot allocate channel queue: unable to map BA5 register space : DMA%s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt: couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: cannot allocate channel queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers %s: no known timing values unknown SiS IDE type %d %s:%d:%d: multi-word DMA disabled due to chip revision %s: no compatibility interrupt for use by %s %s: unable to subregion %s ctl regs %s %s: cannot allocate channel queue%s: %s %s to %s mode %s: %s ignored (disabled) : no DMA, unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers), (unsupported maptype 0x%x)%s: unexpected PCI function %d : 5597/5598: unexpected PCI function %d , (unable to map ctl registers): cannot allocate channel queue , %s %s to native-PCI compatibility %s: bus-master DMA support present: ATA133: ATA33: ATA66: ATA100 (unsupported), (partial support)not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) %s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s: restore for unknown chip map %x unmap not yet implemented for this chipsetpciide540620630630S633635645645DX651652655658661733735741745746748750760962963964966968port 0port 1port 2port 3: can't map mem or i/o space em_rxeof: NULL mbuf in slot %d (nrx %d, filled %d)%s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: Unable to create TX DMA map %s: em_get_buf: slot %d already has an mbuf %s: unable to fill any rx descriptors %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed: mmba is not mem space : cannot find mem space : cannot find i/o space : flash is not mem space %s: Unknown MAC Type %s: Unable to initialize the hardware %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type %s: watchdog timeout -- resetting %s: Media change is blocked due to SOL/IDER session. %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: EEPROM read error while reading mac address %s: Invalid mac address %s: PHY reset is blocked due to SOL/IDER session. %s: No GCU found, defered attachment failed Could not write PHY the HV address register Could not read data value from HV data register %s: phy read timeout: phy %d, reg %d %s: unable to read phy %d reg %d gcu0%s: init failed, error=%d : can't map i/o space : can't map mem space %s: timed out waiting for BIOS %s: pre-2.0 USB rev : can't map interrupt : can't establish interruptpciide_machdep_compat_intr_disestablish calledpciide_machdep_compat_intr_establish calledqd'(3  jB́Bj>HjBB\jHjB܁Bj>pjԍBB%j>jB܁B8k>jB܁Blk>kԍBB7><kԍBB7ć>PkԍBB7؇>dkB܁B>kB܁B>kB܁B>kB܁Bܐ>kB܁Bt> kB܁Bؑ> kB܁B>4kB܁BH>PkB܁B\>dkB܁BЖ>kB܁B>kB܁B>kB܁B@>4kB܁Bh>hkB܁B>kB܁Bȡ>kB܁B >kB܁Bإ>BB܁B>\kB܁B>8kB܁BLk`kԍBB9tkkԍBB9kkԍBB9kkԍBB9kkԍBB9k(kԍBB9<kPkԍBB9dkxkԍBB9kkԍBB9kkԍBB9kkԍBB9 k kԍBB9, k@ kԍBB9T kh kԍBB9| k kԍBB9 k kԍBB9 k kԍBB9 k kԍBB9 k0 kԍBB9H k\ kԍBB9p k kԍBB9 k kԍBB9 k kԍBB k\BBBCP kx kBBC(kȏBBBC<kPkBBCdkBBBCxkBBBCk0BBBCk BBBCkԐBBBCw?w?w?w?w?w?$|9$8$T9$l_$_$@n$|o$8$p:$`]$\$n$to$8$4J$^$]$8n$xo$8$:$[$V$C$9$8$<$ @ @ @   ){$$$?t$${$$$8$$$$(WEVrdroot2.5M@`Ͳf!WEV  08`,P<  ,P3` /mnt  ,P`@@<@T 08`,P<  ,P3`[~ [~,P`@@<@TU ,Ph b,PwvA ,P,PL,PLhԥFA,PYm,PYm,P ÁaSdA,P vL ,P vL ,P* bA\,Pkq-,P8,Pϳpx s#VM,P,Pf ,Pf cAa*,Pf ,Pl9#,Pl9#i.H,Pl9#,P &,P@D0nc,P &,P),P@D0 EtR,P\*,PX/,PX/`hpxKe_te."HZ0ŭ?V%FWeTT9ji)&|<߱(%HCY:skp&S~"Kpz#ը C׸`/Q]'~,:X(Y|qh 7Lo"1R xcC~7װ !4ŋX=2e:fXm|ayQӆ%\t}-PP3v.iUjQC!&&QɳDB<Ά,y031}~hy {م~N5)o5uўxXjߡɼz۟Q&Tdrk c´ĹY9P6 Kp0;0k+ ǢC8/q!8YCo@R3`(i#+Gu&SHEEcKSndE9<|7->y18T+r*Vf޶%j4Q^`Xy ]MudeKbGyGu` .@.. ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT while :; do read REPLY?'(I)nstall, (U)pgrade or (S)hell? ' case $REPLY in i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . .. bin dev@ etc mntmnt2h:բsbinh: tmpB usrvarinstbin.profileL install.mdupgrade install  install.sub md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up ELFa(d4"4 ("t"t$t$t$tGG;;88-444OpenBSD -LP@0! MP@ -0L@ 0pS`0& 0 /R0 R S000  P P00<Q  A P 00  00PH 08 h0-L` 0 R   1S0B@Ct1P @D0t0$0<0< 0 R-L @ R贸$  0S00h<8 -x@x @0LS ``00T0H 0S 800S$0h!488  p-L @0P `P dp5P d:@POU8  (4&PP `H4t -PLU`p 0S /t0PPQ @Q P P0 i4tĖH Pp-L@P`D ph0,0d -Li` -"L<MȂ0r"`8K01vP@H =P  P0Sl i`Ÿ X08@ NN P4  0` $8 000P  10S000 B &1 0S0 SWi10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0DF$0S 0S  08F$0S 0Sl 1i(K, (d2x ؙH(Xt -LM K `'p@Pqx1 p'l 0SM bR KR MR(mR wR kR!$+%$+*$&U'T$0@P 0 !$/UT0 0 @P 0xS S *Sd1#pUT D0"@ 04h 0 ~h@P @lĚ -L0 $, -L0 $d 0-LMK Pp@1 k 0S7 bR KR MR mR wR kR$%*T0@0 !P00 @0xS S *S T <0"@c 0,h0 h@8 @lĚ -0L00(d -0L00(, -L0lv -L P00 -Lx0 -Lp 00d,0 R0 ,d -L g@Tv -L g@Tv -L g@Vv -L g@Vv 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0,d -L1P``8q8L  uPP  / 0S jP00OU0@0V 0000 00 0U0 0 0 0S0|0 0  `4ge0 f` R*Rb20 00d @$ D 0-LMPKkP \bj0: S D4 K@JP0: S S000K0@m @ -DL8P40  NPD40S0o DP4000 T0$ |4NP 0d `4H$N0000S|TD $ 4 0S 0@0Pc0S 00P 00Pi\hS $0   $0 <0; S 0 @c$ #"i0$c`V gf tKJ"0spw R 0Sj*0  Q E1 mP X "0  di\80 0R(+0 0 0 0  P0 0 0 0000000 0 00 00` 0 B000 0081А(q@00Cs01 1R0R#0R 00 l R R *p bQ 00 00$00S:,6lvdd(8 Ԗ@H -LsMb,K➄$ (0 b,0P a,  B=9, =( ,(0  1@(P 0 0pwwOKP PP0p!dpdPP'0L@ 5 H R 818R^OKd0 !0D@ 5@ ` R 0REOK$KQ0d /(@w5$,0(02@0H d0 0F`K $Kq0dP P/(`V5 $LKnO$K.AЛ? 4 -LhJ -LU@`R@ -LMpa0@ 0P$ 0$"gQpLq  G@Pp: 0,0 00 K3KHP7 h P$p0 K03K,p Hp   5s0P@PX`$0 p S  0S@P$0S 0S(Kdm@ -8QL09P0 @c$ #"0Pp8q 0 30`p @0( ᒫP0 `V`@ Pl 0S0C0TPdP 0  Z <M g0,lvp(@ -LB 0〸0H -MLM\"0`p( ,4 4"p, R0@!S!괞hhhhhhhhhhhhhhhhhhhhhhhhh|hhh4!pt1 aARB^KPEPE@灝PH ,4004 4 J>K 0C8t 4 D , pP2!0-S) cРBKAL L P0 0$RpB.K0 B Bxpppp~0Hc0<$f $fh(t؝ -LM@pP4 嬛PP 0S nS6 =O`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSPꌖ00,K ,0@S00?p @ `c0 p00p0"S 0( c$P 0 0cZpD<T -LM`PP( @(K,pK 0 g(0@S *'$K2f -0L '$tH -LMP@`0pJO U@ 0S T  0((H p-LP@J`P P@ep lP@厛@@ -2L`M2\Ÿ\[\ @ll2` `pT@ K 0` p<ꀟY@dH -0L MPpP`+0 R ; $0  00 R坔W @PP $0UNK K$KXD<@ 00 @@@(ȟ p-`PL& 0S# nS$ 0 @@,kP(0PP@`00@,WPp4k`0oS0 ` cpvP 0-t0L0PS Q @Q  P,0 r300 R00pv -萟0LS0 R) ZPp`0@S 0  |P |0@\. ./p Wn A d0 Ro耓pv -LMp Ku`P @PUN PP -LtM`P#~p/ P0@$S$ꤰx\L<(#~p3#Q 3 R(K P A0pS h'P( PPKp ᱦPo0: S S` 4(BCxcPf`2 Rf (`0 d |PE pPWi q(`@P/PXUN Xd1 RX  w31 RW1b1 ^|1 Z|1 t1SD1 OT1 D1H 1 D( ( | ہ(0AjPP (`ā0 Rb 0 R^ 幁ZE  w3>(` `^5b p}<.b눠pv(@` -BLM0 j 0`PP\%H2R  0`P $K\%2R004  000\%1RN = 0@8P3o , ( F,,@K0d @P,@ (P @P<@md@d_ .,@K00;`Vp0@0S@0 @, 0C@$0(@,0 @\@`@0e0PZ )0Z )| (d  80&`p<(@dlh;_@TP0  R0 0, 0C@$0(@/,0 TTJ( -tMLK 0@CP#81RL0S `f`0R30 @0@c+p(+0E`}+` @b@cP @P   0@Q  0@$0(@0 ,0 \0`0D0PZ W)Z S)| LSJ, -PLP@@LP  2`P @P |PlpP \PDP < 0J$ELPT(X -L 0J±븡H -LM@`CV$ P$pKVhᒕ P 0S -SD01!@!=1P0@0@V@Z@ p-LMPP` 0S@v!xq-@n-@@!'P ( 0 @`'b!x k`D 0-\ P0LS@ 0S  0S 0S00xv p-`PL& 0S# nS$ 0 @@,P$0PP@`00@,Pp4\0oS0 ` `tvP 0-t0L0PS Q @Q  1P,0 r300 R00tv -0PLMP` aPp$ ` @$K,  8`p`3ᷔ$@0&T00S Z -LM` KpP 0PWP> U @NPP@ -L0Mp| 0, 呔 0DSH  `T 7 R P R   0S`7V p00@T0TWS\P\1L' H700W@ TUPPL7Q`' VF\! 6`V&;\!@ 6`V&0\! l6`Vd&\%\! `<6V88T&0S`!`! R 6`V$0& 0Sd!d! R 5`V0%0Sh!h! R 5`V|0%0Sl!l! R D5`V<d0h%ړ0Sp!p! R 5`V$0,%ʓ0St!t!R 4`V0$库0Sx1x1S TD`V$媓0S `V1$l埓!囓!|t嗓!pd哓h4Vd, 0R(K0SJ 3`V($}\!@aP% `V q)0D#3` `3V\0c04SS l0F@KLKL0 0.0KTP pPP `Po0Si!R] 2`V,ß(0 #P30S!Q t2`Vl0"&1 D2`V<<"1 2`V"1 1`Vx"1n `1VX"ePKLKR`1PPVxA@+(0"PRXP!`W^!1R!uP!1 0`V!Œ1 0`Vl!庒1# `0VL!寒8NP0S D1 `@0V<!4囒J@啒hLxv`LLĢ̢Ԣܢ( 4@`JdSd|Xt`pxԆ\HrL4 -LMMß |KpG`pG , P@坓P #T@U `P^ Qe@!PP K@A@A <0 f: 3q A R :S@ :@S tŸ, 0R(Kfp@i PLK@Dtb@DE0h"d$@0S 8 ᗒ0S0So ۭP?`K]PYMKZ PK  PP1 R IK A0譑 KA A 㟑P<:#41 R0SQP@MC~:}P 1] {tOK*]Pj"e phd[T`\hJ,w 4ԣ lȣ0<k -AMLM6 `Pp, &wpJ A0@6S6`<-P^p%wp5 `bA0V84 Vm VZ @ A`P PDrP $mPP PP (0YP@4 sPnpi4 RDP`t4 \HPW4pR84 RM pIPDp?3 ;963 R `84@ 0@@Z00S y^P; Z`3 RZBKHHᢑP (\PI P@0 0  P !P 0DP|0 0 04 2 0@^PP B.K B BxȒP@4P p_ zBK@@5`Pa Z@PP7 @P P P 84 W`+P⨑n+P`hftqP@T@h@XPx DZ@PP84@PP84 bW_W@PP0D{괊0S Z84 MW P@ PUN 0|P 0㌫pZh(`$t4tv(X:|pܤPL`k -L. 0 aĦH -GMLp1M ha d!@0P$4 @!up oP: !up 0bSQ`A~K pG0pG4 僐P- $$004 4 =K 0C0C cP(P -P P| 0$\VA.KP0 B BD ,Yh,,L(`(( -LM@pP4 ǎPP 0S nS6 =j`P00QD @ Q? )P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP꧉00,K ,0@S00?p @ `6V0 p00ꋉ0"S 0('V$P 0 0VZpD<T -LM`PP( @(K,pK 0 g(0@S E$KMY -@0L R  (0( > 0 Hp -Lp00p3 P@@0PP``0 tp kP` sPP aP`  tpt0 RU ` Px 808v ,.xJ$tX -Ltl@-0 S R@4 00 ӑR^ ^R-0S \ Q-0L Q* QU MU -LMp@`ឈ $KxPᗈ0S 0S $0 UR#U 0)U -0L .o$tH -MLMp0,0 /tpI B0@3S3$xH$tP8\> >~> > .sp. 0b0CS/[>KQ0C 0C )p g>K0C 0C6 XP<ϟ@T |6: S(  S UwlK`F `F@ pW@ԭP  rP @TDP wTx= =%=^T= p=l= d= R$=.L=H=I=t.0=,@<P.<> =7<,2<.<<)< << < P< << <  < t V5  U,@ 7P0@X S P P 0Q Q  ]|^ \ P Q U e/wP 00BR SP 00BR SQRG  00B SQA `RCpRAqa@B 9 R.R600U0pup3S Q &R&  5S 5S]K 5p t8@T2 RS D7Q 6q0#0P` &Q@ 0= &lThw( hT$(,048<@DHTH+H+P\,4/@8@edA0̮T dSJTȰа$hh L8@`\gfffXHw(ԫATTPxDp ȭ@pЬ|( SV&0P6 S F %&T)`P 6!&a 0 . `& @P 0 2" p0! 0 ^ 1 6S12S \ 2^0B0 & R 0@, & l& 6 `@P p! 0o0@@T@!^1: Q0 &R0:S P3  3Q2S*& R,C 6S<3B@6 L!!X  r6ttR 00 T@A5S%%R005  P0Lc5 0S 05 Q5 5 % & 6 Q,Q8@QLT%5 Qh5S%TDPQ j$@T , 0RP(K O O K@ @n5 K@5 GypP9 % R%6"&  P660X*l0 ^PPS00SB %`5R> P;X9:@X2 &0ST#3*&xp  6PX&  \ 6S X*cQP50U&00Q* ^ 000S 0@6 # 06U0 $!4060!40 4 05 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0` (00ST 08 4  (088 [NKR@Dd@D%6|(n 40S66 { &]p 6P &GX 8Q  ( 520#$ 0 0 P0C"$ "40 && t9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T +&U0& U 0A Ah 6U p[NK@D@D68+P :Q00 5 % \6 S(+u 5S,+m 5S0+e %?RR5 c02?  5 % G Q(<Ps 5P n @ S%X<T E I @ .6S zPPM&M<Q &Rp5F0%M%P<R 66  Qk T  Uy,%jM8gM D0bM P^M\[Md0WMpTMxQMT 0IM EM CP&0;M&P4MA 6}0#0P`6 S ^ʠ 68M5oLMP \ Md]PlM -LM00PKpa@ 00p `1P2 `00PU4 @uT <T  0BS0^T0(@ 0 0 K?P@ -P0(P0 0( P 0`|1Pto$K VP@$0 R 00(@< _o$Zo`h<p P-L LL(D -LM( :[P( (( Q5 (K墄`P0 0S- =I@PS 00$pK PcU% iU, lU3 oU: 1Q@ Q 0S5P0$ 0 Q (Q K(  P($00P($00P($0 0P($00~Pt i($0$0TP@ \($0(0b{갲\`hxp\ 0-LM 0 P`'X0Q @0D0  Q@ 8hꐺĺ$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $", 0 0 $ -LM0@S 0 K0"0 /0 00 K0" /0 0`t - L.P}Not ܺ - L.PoNnt  -LM K00".P]Nt -L8hMx0$G p-L MP@`0KP 0S00Kp 1N p-L MP@`0KP 0S00Kp N -0LS@ h?M 0 << 0 -@LR50 0 -@Ly0 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P 8/@P  0SK0 Q0m@$m;  (x<8 p-L0 `RP @ R &P0 00 0 0 0 p01Q @ Q  P0 000 00 p0Q @ Q P0$ 00$0 0$0 pp0Q @ Q P0 000 00 pp贲(̵0 0-,PL0@S d000@0lp -0L0CSQ 0M - LP^0? 0  P@ ^00 ,00$0 `deh: p-x`L@PTd0 \ԁpHP@́8Ɂp$Á0plpl@ -LMxR p, `0 P 0LS 0 堁P~@~T   唁@Q ጁ@T] @a R_ ;         0 Qd ~@ X z #L v D %r?QPP  hU c _U YU SU  MU @  BU   @ 9U p 3U  \ -U L    @ $U 0   ( UN0  N U   U_@  U@ U U  |Ul 0`@  < S S 89U      U  U U0S m\0 `p \$ ^ 0 R AdPd␐K 0d'0 `K0p0' W {{ pG\W K{K{, 0R(Kr0S k^0d ` R@ xY0S  `R^  H. G9,C ?@083U5  -@4)6% 8! U7 h@4 < S2t 9U3     @U/  /, 1 3 *0S3@T P`K0 0d$/ @TP0xtld0/X  R2R4@hU   L@]U ` 579 ;.@? ;~ [ zU: @:pt<dp >Xl F LhU=  =8b B ,^U<   ;V@U  S?  SuJr bX @ R @> ;  48 05  1st @w'+\$"0! 04t  4~PI~PE~PA~P=~P9Z凚h0<l%$ؽ4Dlɾپټ(A`ɼPqпܻ<Ueٽ5Emѿͻ̻=Tdxyؾ@ؼ )@aA\ȼpȾ$, -0L _$tH -#L`M#0㘣p , 0x0 0S`pAP2UH#dp a0@Slt@8`0`K1`x ` Pxt K)P4Kx )PXq|B-Px tI`0S0 t 7` l h 0SD PKx@K 00 Q/ PP>P `000C S61|K V|0`SpP 0 z 0l0 00 Ql0S$h0S x)P(, 0R((K` t c` P  0l0 xJPHgx2~p/~ch&`vHX E0 nHht@ht@(@gt4T<`(4  -0L 0P$tHt -NMLMpp0S( `@pH P2P"L2Q0T INK@D@DP4: S1@PG B^KPEPE0!@ PINK2@D2`1@D2=*2KP0S> 1 R S~PO|1P l}( 0RJ$KIKAAϋP01 R4: Sw00}}w?00 }KAAᨋP%4R%4Rh0 Rh (gw0S@a}0Wh|IFt@xl -LpMP@"P?> *Q-L QP!00(L\ %d\hPQèd0PSw84'<XP dP X@ P PdPPXPPP Qx cXdc\cTcsHcPPP T {Dx,p@ p-L M`0P0 @IP  0 R#Kp 00B0 Sa0BSW0B? K Q02\ 0A@ $0KLA0BS70Bؔh M-LM@0T`pP T0P  t 0@T00 0 @$K 0-LLP$0@S0@0020S - L@&0P -BML\< M @$ BK L, :L H D L 0'0LD$޼PG L P00LpP :HP x 00`JP<Vk ;P`KpP Pc p;@TdKBKJ0PJ _044 PSTH440LD$喼PHʟ@, 0PR(KP=V4 % 0S!T 0S `T@P44 4$  \P44 4$   @ b@$T @$ 44HX0q b@40@4 j0gHC10e bP*VY 0SV BKJHtJ 0R0X0SpG @0P 044 S H  qb44\0`P0B.K B BP 9V`P PH4 mLH$ gL4$0BSH(̑ @b@H$0@ 8ldP H\P  0D *b@@ (QPBKJ0J }044 S(  0b@@ E3PBKJ0J _044 SH, 0 T a@40@4 ;;SH$( (PBKJ 0J:044 SH$8PBKJ0J $044 SH0}PBKJ 0J044 SH$4g,PBK@J0QJ 04SHO<OPJ PE P@ P; P6 P1 pP, `P' aB0S0SH8X:XH`0B8̑V BK@J0pQJ 04S   9a@$ @$ W @0`Q 04S  d"a@R@ VH 0` 4DpP P 4@T000C S 4$ 0 a4 04S   ` 4$ H 0 H0ࠀXX XWM n@0 @pP`8 T4 \0 .0@p `8 v @@vA@HX0`4t  B9P0  kH4R O `@$ @$ ] `@@ VWT  @0 P`p<$ F T 0 0@p: `< v @@vA@H4t 0'4$Rle Z`@@ jH4R O L`@@ \H0hC1 0S >`@40@4  6`@$ @$ h@Xyyh0<XJh (0<yyH -LMPP@z>8w>TyrdA 0< edAsd 0 p-0008L`@P0S pd P PUDD Pp(p;>WEV gdedAp p-L`@PhP e/P  V  phGp : -L─ M0 `("HPpP@0,  40 0 `("8@@p00@0N 0  0 00C 0SV 0?Pj08#HP P0@@4Pa 4B0Q0, @P 0S# ,z 0S% ,!s10!R ,k1 RV, 00CS0U, 0 0(K `1,!XT 0S ,8J 0 00C3 0 01 0 0 0 00C 0P ("8 Ƞ @,HP``pP00@p@P,0`a 0p, (Ko1], (KoC]J y - LM,0 z3  Rp3 !hd 0 T 0 BCD@EPF`Gp@ A0$ P@ P`p 0 X02 R00CS00  0( , 0 8 4 G<PP@ 0 T7P 0STl#00@ӑ\3@dT#000_<3* [ 3#(3SB0S*00L"000G2 2  >B0S007|"0002"000-HB0S00&{2~Tc @HTY?@TQ1 RE G\@0DSAe/Pc`PG >0@PD0@0- 18!0*0DS* e/P,@P @@ 0z0 0 ~@Th l9 \9Ty   (  H@820P#! 0Q "-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  an  -LM@ pR 0P`PBT 0@En i?n$ -LM, (0 @0n 0p- Q 0#n`P 0pn,K 0 XXX n8S P 0< 8PS$K,<HT -p@LpP20` ````aPUC 0C`F ! R! _ 0SST 0P`@@0@0Q a H $0p`p@ p@ pQ    11({ |1yP0@`@w_K`0@a0@TḀp+r?K 0S@ $@0Po  K !_0B 0S" 0H @P2 0<S0Sk* P0x.Ke/)PO 0< 8uhLH`|<(H -L*MgKJ0J e/ ,0 0: P P P ; KAA  J PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ K{ e/Kw 1U:K@0@: J : $  ᳝P  @P | PuQUQ 0ApSȪxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx\x0xxxxxxxxxx,xxxxxx(xxxxxxxxxxܭ̭x\xxhX8x |Dxܫx0x  ^0`p: j@P 0STHK@ @H Cp 4GVPP  0yU  : Ke/PA 8P< NKKAe/ 37 RR XT@    P ǟ, 0R(KTX 47 Re , IP7ǟ e/rNNK@D e/kK e/ge/Kc x l TUR lɞ@Pl  0C `@0p`p @TP0,,@ P(0 0  0nU @@ 0 c5 R  [ WWU $0N QK0 $TE PB z> 7: 7 3ğ$00s03S0X' Ke/=P NNK@De/ Ke/ e/K ; 8 5d{S04 R L4 R 2 44m ( UP3 @|#00@@T  AP~ Ke/5IS(K0S (K (K@V0`@ N lß(Kh3开(KⳀ 廅Ką 弅KNKe/K@me/ Ki    3 R `00CS`0QX0  X0q0 |:K{*KX eB`2 RT2 Rf "&P P|"0000ӑyS PX"0000ӑnSP4"00ӑyP/ @pPYAR`A 000800C0VWSWJX 3B PPE 0SB 7 1x;  @P e/K ,0W((A%L e/;@PR 5rsA@/h 6j x2DL\p 0 HDl  rdAtnh|l H3 -X0L R H0P808 0,_BZBy  t$  -Q@PL0. P0 R 0 0 Q@P`0 p8W  0 Q|Qd `B0@ 0PV0@0Q@`pzyz d  -1LM RKxa0S l!00CSP\QT1  L1\*\&81 H@ T\q 0Z Q_ 00@TP 0L Q00 AL\ 000SAQ0 0 X0@X$ KK @ iP@4A zh|  y z  m  -?MLML$LD0\,0 P`040S- S! Q4 0 Q Q R30 QC00, 0 R(KQڐTA0p0\?KK(@D@DV ?{KL(pGLCpG(0K8 P0(K  0P?KK(@D@D?+RdPŸ?+KdP㨢00?K@ 3N@PdŸX@'  Pw ?K#N @ PTP0"7AR?+dPʡDP!(AC1V\ pǏ 0(@K 0?KK\(@D @D PP[P0L!@0 !0T01 R DWFPDQBP@+O  @0@09O  @O @@O  @pUOX @OT zhyz( m   t  y   X H   0-QL@T0 R 0 {cP0 @ 00 ncPڜ0 P ;;Sx0@@0P@L0 D%@0}O, 0$ _@zyz   y   -?MLMt0t` R   0RKHp0S?KK@D4P@D?+ cPoyhzz -r0LP@4 _*TP< P002`V%Pyڀ;;S@[h00`2 0SPPU>TA y42 Q 3P>?VU@@Tʼ!000PN0 SX N0SE N0SA N0S= TU@Hz?<1 4s?$n? 0Q 0O Q P@`@@N0S N0S N0ES0X@0yNT 0P {?@3?00zzyy l| h y   <  -t0 l0RL T@ 0 RPbN F?yyz0  p-LMP K`@&P1'0P/T  !|!@  0:RPKpT i! a!^!@@ Y!(   zp P ` t  -L$MePpx5tp5 llu d%d5PdU  %P4p 5Q ~0STP P TwPd0: S   S  S00  0p 0Z0X4X$T4L4DqM0S0C00Z0 P6llTlU #APM0#g>Um t#1P00pn P3Q  0SdL3L# 03 (K# <003 "?;00Zr H2 ARRŸ:0Z P% 2 ZN 8pxŸ?;0P`? 0L L9 T2@P`? uv ;0Z 2?+ "2 P1!1 1!0,H KeP00Z00V;;S\ @1`V 8p ?y1!``0Q 0 vL0 =L0 =LL0 =X0 X= 00 KL\ 0x =z h|  zy       zz     m @   $ -LM T0St0Sfc0S3 RCIP$K XQ0S 3 R 0 0R R3 KtC 0 S `#000 R HS0S@ <3 R(00CS00  000`V 2@ἪP[2@0} +0 0̟r00d2 Rl2 Rd `2 RxL00CS0~0  0(24 a娟0Sy BPs0: So<08@@k1 R@f1!11 R^ XAP[MX[PK$"< MP2K#<3 R 3 Rs@ᵩP ;@᫩P 妩P 30S S S l3l ;`;\#00CSL;NK@D<;8;4;0;(<Pl{Pg &,[RW %<[STS0B&SPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHUkP'10;$|;y;w;;P.P &<[Sh;#P`;\;=h P$S;! 1@0@0I;x1  (1 \?;X=;e0L8;NK@D83;NK@DbLP); q0S 500ộP000 @0@0:h  y t@ @  yyh|8` H$hz<pHz -qL R Q3!  0 XRO PAx` wP`V 0SDQ@%@1S!#100P!0!  0 P " PZ `Z `FVڌ f lQ:`0 R PH:8 `00 R  <:0|z l|`h|8 -LM衟 0, ؑ0`PpH@ 00 T0$P1= 0S, Ut1 RI d :PP @ T 00p34P9 P6U0 R5 9P0@00  ,0K8P P@0S 000(K 08PH989(9l| h|(  -bML,Mⴡ0,0 P70DP10 P,x1 R.-b}K(pG$pGTP0  0BS'{)P +P2 DPK`<0KP0( =&, 0R*(K$ P Pb]K(PE R,PE0 <P`D0K(P'P  5ihl| -ML M0,0 vP=0DP70 P2/P/5 R /P(㭐b}K*K(pGH $pGP0  0BS (P ,DPK`<0K1P 0( ]I.?&, 0R(Kb]K(PE R,PE0 <P`D0K6+PXD0SL4 RL(PU'P.DPK`<0K\K(PEPEP0Sx 3 R}( 0SʢS0S3 R LK(@D@DP0Sj h3 R ( 0S0 0S<0S S(3 :KHP P P00S SJ 0CSDPK`<0KX0S B0S 2 Rt"00CS00  0000S3 0S0 42P+ G "s8%1 R 0 0Sc)( 0S^( 0SG@PDb]K(PE,PE0 <(0S dA0S X1 R=@!00CS0>0  000X`D0K'DG 0 &8v|00 a-zDPK`<0K-|g\0 6H0 6 7w 7hl|LD, ||<HlX  -L%M$MŽK5HU@(KHd%,@  P-KL' 0Z/S /0 0 0*KL5%K(II ZKLPnKHD0: S m7, 0R (K.0[/S _7F0$78.PP-PT4 RmK(`F(`FxP% 4 (K )PPt0S3 R5 :KH5@/Q  ⰵKHP  7RP  w,, PPt0Sx H3 Rx a=( Q0 <S@j/P%P,:KL%!$PB0S2 R  MP0Su 2 R a=( Q0 <S`R0SBTT2  Q 7 P 4<S S8 0CSWP[0Sc A0S_ 1 RK!00CS0Y0  000M^-PF"d1 Ra=( Q@ډX1@1  p(KP$@P'( K K(A,A/a=( QڐXfZ0 56,E <6UK(A,AO 5hTX LD,  4<||  -L Ml 0,0 p@WP P0,P2,$00Q.㪍`;Pl(P3 , Q# .P\&P V 04  Y3 R(K,P:+WX<30 SS S b$P,K+R P, E0"5+2 R6R0S S=ڜ2 >"000 P60S \R0S P2 RO4"00CS0r0  000,KI`p-P,xPU~M,PM11 0,4 K@,K`#0S XQ0SV^4KQ..PWb=0Q!&PO`20 m4,K+@0 R 00CS00  000P`P,K! \4@0 @4 T4l|LD h|| < -bML$Mx0x@ R  g.P P L0 DPb K@$@ 0RK dDhl| -bML$M 0,0 @P T T 04, 0Rp(K0DPA0 P0SN0 XN!0Sb}K(pG$pG h1h `塗b}K(pGT1 $pG q-PX q,PDPK`<0KP AP&P0S 0(@P/*wP0S @0S ,-P+P8 D0 00(@dhl|<D||tl<$0 0?   z -T2LMR`u<0S1,4P}""0\ 0 0"Pl1!!0ȁPp P+0@PB 1 V PaB P 0O0@U <01 1 U Pa`n,` pPoP` , `, 00 0Q ,3P 0  `P0SPQ~8 @0 0@,0  z   l|8 -PQL`tt 0hpcPP@@ 0Pd0U`00<P  z 00b0s  -ĀL0S` pP@P 0@`Ph0lP/`T0 P<0`  `00z z   8 -QL`ڀp P P@@ %0Pd0U`0 0cPʥP eQ    -a=LpM00UpE``a 0 cR#?S VP/0@TP0U0 P-0 0 20(KR 0 P0TKPa=p Q 00C h2TA< 0< 2A 0 2  z -LM a a= 0T ^,  r  K iPKX0S`pP0 PU ?`p rU@P 00Kڤ\,K  PU ? U?l1 R \1 P0"2P ,\ 0S4  (KlA!0O20SK P$ a=x Q 00C 010S HAl 0d '2<0 R6A$ 0$ 2z P4\ -LM Qa  0p" ,0   KP|X0S<0 0@W0 m 0 cPL@_1UC@ ,K  00KR PKڬ1 R000  PJ0 RZ0O`VpW' ,Q 0SE  W+ڰ 00 1 R `(KT@PPV0 R  A1V @0T r1<0 }V,0 R  h4P Q-LP`.Āp 0cP 0OT @  ?PU`V S0U 0cP,0PP  z 0-D0DP LP0,@  `0 0h   z - LM q00l ?S 0P`PU`@00(KR`1 ȟ 08 80 4@ !,0( K@"4@@4@ 8K8P6 0z00KP`PU`8KP` V0 0bQ  Q 0PU`0V0ʴUP QP     -@L0S< 01 R; 5P=qaPP RPR $P PP 0@Pڠ0/0P0 l0PPPH/PP 0@zh| z   L -@2L @RPv("0S "00000aPv0 0bȟ` 0 F!#PY(% &P@T PUJlta0`!0Q0:D0 R 19P/X@P`P0 00 0 0 0S @0  NP0 pg/ <D 00 00T8  z     h|t -0@ 0RL0 0P00 0 0 R ? Rʂ;;S \</P4?;/h|         0-A!0QS0 L? Q!ʁ P$~ Q0 09P 0@ 00 ~<|.0 h?;.0 P<.0P0  l| z    <p 0-`@L0S 0HP0S 04P000. z8z= -Lp`PP0S 00SE  #0X @TfP0 @0S X P00 0$ 0 #000 b#P(@HPcP 00T $00P z$z 0-`@L0S 0HP0S 04@P000.(z3,zJnW|Q  @4S4S  P00q & -$L0 03 Py0F#0  0( PnP0N 0 Pe0V#0  0 PZ P^0 PQ n]PDXP? Po000c@`P300S S, S* S] 6b-  0@pa- p0P`@0S@b-P ``6 0q P_ T0 t(hX (0 P(h0hqql (,$8D -LTMs0 0 PP2b@ @0R2  0@`l@KS( ((A 0z Pt 0s P \2 TK( 0R~K a=0A 0 P 1 3(1 0L P1  0D P1 0< P1 04 P|1 0, P`1$ 0$ P1* 0 Pa=0 0 P`; 0 PL^P YP00S S S S  HPT0 l'|`Wx(0 H'qh0q< (,$D0 [hY0 h mQ-L P l mQ-L P t -2L pRPi nPbb0@ J 2 D 넢  > p2 8 \2 .2 H2a-0C 6 am` &! 2 > @ F 40@@1 N @ V 40@@1 ft1 ^P@n|P0@0Pn000c@07P 0: S  0@P`0@0S@P`   mPP` P`PU`0@Pmh (,H$0 KQ-L :~P | -PL`LPb-0 @ w\1 qH1 k4q e 1 _ 1 $Y0 *S0  0M0a-0C A aM@ ;<P0@0DP0: S 000 <$?>>$?$?>>0""2 R D0, K(0K,P0,( 0#0\" Pb]b-0@ PpK| |@Dp 2 * RV  R,  R1    R 0! P;01 1$K R1    R!  R`1  aL!0!00 +P5.0 0 mh0 0S 00a͠ 00  00~PJe.0SuPC\.X @0 | lzpzh  8\ 0-0L R0@T P@T 0S0S 0SU 88؁@T0 PtzH|Qd0 R00T0 RL0  D0 R80 R,0Q 0 6xz@ $pzlz p-@PL` 0SpPP @P0/S/0C0T 0SD0 00@ `PPPPphp tz|z<  -0 0R000000L R0000 R0@00|0 Rp<l0P PT0 RP(.d p`tz d @-PP:P 00S S R U2 /R/7R+ /R7R10P0C U P 0B0 SA@B0 7pB bTaBWB0 "Q0U S- L Q0000L B 0Q000B 0Q00P000BQPQL0 S0W0 ̕0̅  RL*G-MP : \ 00S S R 0 SY/QV7QpQ/Q 7Q 0AA1/Np 0\Ѝ Rp6p  RP"00NPo0A@N S@'.@a0N ɯb"T'nɯR'.0 0@ pS 0@ p pA- R`PN) \1>A P0 0` NA 0\!00 ` P0@ 0\!00000@\\N@0pXW0@ W@%2>&BP` PA:@0pXW@-@S1Q0 \ \ PT00΅ p-0LM @RPlP Q `K0 QKp?WPꈹ -0LXMp Q P@ a S^t`K 0@P0PtK4@K[ 0\ 0R Ka=@tHL( (0T@@hLPh    l -3LpMß@0 ßT S, pP`$T2 R0 CR s00ᕭ, 0R(KMp2 R `T2@K D2 R@u a ]뀐K 0@ ,P2PK0C@1Po0 @P @@ !00CSBa tA  0S'0 CR F0  0@10 CR 0,S 0S0 CR 0R X  0ᓫ 0 "88"$#4 ~a-0x8

g -= /0CQXZ] Q1pZ1@TZ pP0`VQ T=pPHPxN:!P ? P,PP%X= R  !Z `PVJ@̆P\ x< p ዉTXs@P <Pp=! P < -RZ < t < ,00 \xLAP040x+8< L< ,+00`D; x  R4 < I: ; +0*00*; *|; *l; *\; *L; *<; *$; : ; ; *000P+00@+00: *000`l: x*x: V): |9P xP=Z+@T @PPU p PPJ *^PP݅P@9 R  Z PUJ P >P pPI h]r@P |)0Sp)8 X8 t0SH0S 0S [P 0S70(K卅PkP8l8D(8 @Lg ('p 60@DStcccccccccccdcTcB  P!1 h" Q<L"0S(!x1 4"0SHii\i\ii "\!01@Q񟗲ee$f$fe@P0 P@ RP 0 1P@0SP1 bt@x|&||& t''L|`&(&&&&x&l&{0'Dp'{ '<(8'P'X{zn9 'Sl|' (zl'XD't|lp|@4X& L $   ` dph(,( 0@(z(|(@& 0h|H(('&K(d 0CK>K@( 0C(t,rA-KX|h X)HP)l)) -MLM`s0\cP$0 0S0S 0/SK0S.00 @፽ Ҹ00C00S2 ;0S2P  0P 20SSQ SO 2 R0$ 0R KK @X ᜸<B0C<0S0S BNK@D@D ; 045h++L,+X|d| , -0LTM0 0P  d@KhP [ Q,@0 R d@KO Fh<,t, -L(Mp4PYPP 0S @P  0R/S 0R B/S@T⋴cP T /003HPKP P Pv Pi 3ß3( ,PK ß8@K0 $0 , +PF8P>  "P=80Sq  P480Su  P+80Ss  P"80Sq 0  ,0 P PP"00CSa|t\T Pl!P1 KQc v@0KH0 D@ @0KH0 D@ @0KH0 D@ s@0KH0 D@ f=!!1 P 0 P P P l0 R{DHH,T\ -PPh|(-8,,, H--1^ 1!3|,|H -L`N pR @00B S R NT P:P~ .RT@ N000G SꤊXxX<XXĉX0!000!.CDRk?C `0 0!000!>C s 3 S R00C0` 1   !.B0r03R0S `0!000!>CS0`0!000!>C;S0Mp 0!000!>C10!0v>C 0C0   !.B ` 0!000!>C=S0pGҁt -PPL @T` /O#pP 00@T`  `00D S 0,TV`0B .TQL@T7@Pv W 0S 00 R MR- (CR1 0( j# 00c0S&V 0S00L! 0P@!<10@ @@@cR mR000 R000  P000  'P000 R 0`  D  , h--P.||--,..- p-@PLp R @a0S6 #R. \R' ỨP@9 F 1"#200b100c!QR 0S  RP% @ 00 0#R@  @\㇯P Df 4 `  [ |/>3=... p-@PLp R @a0S6 #R. \R' =P@9  1"#200b100c!QR 0S  RP% @ 00 0#R@ @\$P D 4    |/>3= /@/`/ -@QLMp)@0@P`@^ K00\ 0U@V 0Q 0  K0P0 0@;!QU`@ p-T`L0S P0@T  0<@T0PUp| -pL0S& 0`SJ2ጠ匀PC0 S@0S  0RPEH Q  廪`VZ巪000||p|t| p-LPP`p0"#200b10 0c1@T0@S 0 S0S00 00}p|/>3 -\pL0S ` PU 00@hfTP0`V|' -0L^2 0 R.x00S* S( S& 0<%100b1010b 0c1@T0@S 0\< 0S00%h"|$qv -MLM440S, `p 1 RQA0Q( @PhBP) 00(00 徠 000, 0R (K0/S BKAABPp ` P (0  $ 9|hL|| // -L@L0S 4 @00凭Pg | / -@@L0S (pPP |=0 -@@L0S (YP9 |=@0 -@@L0S (BP" |p0 -@@L0S (+P | 0 -LpPP 0"#200b100ca R  R 0S0Sخ@P gP 80pP  00@o|/>30 -p@LP 0"#200b100cQP 0S P\ 㛮`P 0@0 00`|/>31 -1PLP 1!@ Q0``ppP  R R 0S0HH!00 @T@p qP 0$V00Sp00S@0ڂP0 P  >; 0P 00 tp 00dP 0S P `$ 000||$1`1 -0LCP -$L@pTP> !a@T uP @T @P fP fP 00@PuP T fP(|111 -|0L@`TpP \ AT uP @T W0G0| -鰁LP\^ 1 RS x0C RO0Cx0%100b1010b0ca@pT#0p@S 0P!0S ! 0  S;00 S0000 00CS 0"<@P  fP 0 0  0  00@m8&00db|qv 2 -MLM"@0T,0  pP! @T@T 0S0u0S3 I!-h, 0RH(K٬@PJ Da 0[Q : TP (!  a= 000@ 0SnK`F`F )P  0^Pa=0 S0Ÿ\ H6@ ,|hG|(2X2@2x22 0-@LPU 0㒪P t0t@p ㋱s`0P008 0$Z0|G\T2|22  P 0S  PR00S0S 0-B0B N N S0N0B S00B N N Q0000L  0Q000B 0Q00P000BQP 0N0Bp@-^ 00BPB ` @@ ^0@0B ^00B @ @) \1> A0 P A0` 0\!00 ` P0@ 0\!00p000@\p 0@0B-P0!̠#*̠ 0 R0 R*0P  -$6LM0 S, F SS4<:864;0Q xtlhd|T!Ph. H, 0 $#$(,"(h Q Q   0ShC <8#"hj,888T8t8888899(989`99999:(:L:\:p::::::;(;L;l;;;;<0<<<L<`<t<<< -ML44M3Q (K @, 30S  0 K(@@*`T IK(@D3@D#0ዣ K(@@* `K(HXJKH(@D0@D@#'W` p_*P 0@$4,<4("4}! dwpW\ J TXn|>|$>X>\>p>x>>>>>>>> -MLMX2X0`,0 pD2pp 0:2:00 3 20 02&!00010S! JK(@D @D1( KP,<̠ʌ(832ʌJK(@D1@D!%̌(PK  啤X1@P5D10  P8#8 $A$#$ %`10 孿/P00S` RdJK(@D0@D0 ` ქ l00Px  0$0 ,0 Q P+)(Kh|||Xt>T>|86 -Ln@i@ 0-LcP>壹0 R 00S* 00S0@  0@P@儹᳿\0t X00 c0BQ T T0 0 S@ R (P0`||@B|X@> -d=LM0@ ,0 0 e1KpA fAK(]P  p<|0l 1   5D0@3S0<|T|,HT ,H`lp|K1 .W!;R 00 ;! 0@00090:PY00` 0P[OK+NP P (0 60<ʟ@P 00wP*:rP  :wPeP 8[ dJx*x:wPd d00T0000f1KIP [(  K1V!R m 000000_00w0 0t00q0 KV!t9RJ 0dˌK 0tV!eKR6 0K 0cV! R0lȟ(a?K-p0<-K 1CV!xR 0hy T(QpH8p 0gSn8HPg H{00U| 0?7 㹂{g! A 30P0/MPPP  000 YOK8,ul7@6 0ST   DF0S47 00t1 P H x60! 0 Q:<60  6 60<2S@&000 FP ԝ500l1 0PPD'E0@ 5 >Kr0 T5 >Kg   50<2S`%;0000U B>BS3  % 4E >KG00@000 ' 0e[R00@ 0  0 l1  0400T40 ! 40<2Sdd@K(P _#dK cK0 bKP Pta30 #Y?K@0C @P,30 T#Y?K@0C @Pl30 3 [?KּP{BD_KP#^?K|Q {Pmx!t1R\#]?KP庼PL_0;CS00VLb$CP#0P夼P 2Qt"եې"XR0S@ 0"   mjg@p Q0 hA0 02qᮛ`P@xDCXLDCCCDDD`B -MLMp0P@AnK 0 `F`F 90  U00U0S0 Ut 0RK@BP < 80 Q ( hXDLHCDhB  -`LMd&0 H" @?P 0STYPPW 0SK 0Y,0 ,0@0 p p @TP@P!P YU3oP\1 PFp`0OQ PP P  @, T000000S0ST0S  @|h 0TP0PPP04 6  6OPy|E -LMܡpP, h 0Ql$0S V0 P# /00S@0@,OV E0 @0 o 0 # 5"@0@ /P @ ,,0(0  0P` d,@@ @, 0S0S,$ 0 |\2HE p-0 P!`UL*@PP 0S 0 @0VP \ 00\ <0 0S \ PpLT p-@L,尛$!PL0(S `0 0S0 0 00 lSp 00C Std|ddddl 8#80 0cP 0` ,Q p````````| 0   -0@L d0 @T0 @0AS@4,(( 20000@ELE -X0L@jH0 P 0S P 0S HdE 0-P(L@T0,\P T00T0S 0 T @0X 0-( 0LS@P 0 ,Ǚ, 000 p-d`L0S TPT 0@1@P؎0Sӎю000pHTL -@LPÎ00 - 1 \:q`\ !50:1Q@(@F@  ,6" 0 0 ֗6P,0 $F 0  0  PΗ00@ ,0#0<0H 000(KHbD0D  X|P|E - @6 80(P@ 0L 0cp`@劗먠@@tP300@ 00`S mPܓP P, |E P00P0 S-L30 P/萟0S P,*`$F(pP@>뼠,6 R0`00!/|P$F&000#0 `$F0P5P@2*X|E -1` LV@p$`P  %#T*V&0 R  05"| P%#0VL0 R @ 05", |4EEF0F 0-PLL@T d0h0 R \d0T@0d0`0000,0 P|HF\LFF -0L: SpP` RHh PR@l qPqF -PLM@ l1 Q PP1P*<1P 0ES0S PUPQ z W W  W؀0 0`+P( 00P蔀0 0`P( @$KL@?8p^@Y RLH00S00   LNK @D@D0PL(h@  Q $tp1DH000yL4 0\ D(000mD000gY<<P*DP -LP@pT` @0S | 00C0 㵔|0  hpdLP P0*L R  <4 0S HGPGHCL p-L@M P`KF0S 0S   xG -0L cL$tHG -6LM tf@P, [00T&9p" b0@SlX8%p5`@TU 㲩P 孩딥0SE1p`0Sp`FV T @ 0S 05 RYp P 0SL0S P$0S 0Sn0DS 0S 0S K 0S p4|D xT0t j 0S @4X 0  `Q$6S@ 0 0&@R3 3 hbQ0S 3@T @T 됃0S @T p@T X#00#LS000Sq,3墈$3埈3圈0SR 0S 2 RzE PH KLP "0S V;"00028"000"000l2h2m `0>0P"Sn@g00!0002  0b1  PMd1 RP 1PC!K?A2@000) 00 |tl d\ TLzD801(`a(?Kt | x P j hH mH4|H(IP<IXJn 1 R e0 -0S1 R  PQ;PI00@@# P @ 0@S @0@&"!0l 0CS @㥊P p00d0 S t0p0    ~MPj #JFP|<dPHL|K4K@LG8KXKKKKKDKK|QJ -L4Ma1&0R P L H D @ < 8 4 0 , ( $ $p@ 0 0KL (0SP(0@S T00T0SPbPPK H0H@ 0S [ K6pS|, -pLWP,ڴ`@PT0T @T 0Sh 0 P0T R 0R pW P \O0 ((` p-LM4 ( 0AS02 .d.(21 .| Px P 0:90EKAXD AT$  D4<0 D! #Y0\$ 04K` M*& RMQKS60CO ZMNK@D @D u|3$Kb($ (ⅎ0X4  T$  X#PX@Q  0  0Q s S["* PPXB( 0R$Kpax2V⻌L@0 @ PWBNK @D@D0  6  0SXV0EOo 0? 5"@0 @1 R Pz&s!@ P h0X00 0P0C0  Xw P&  P |x P 0  0P0CX0Jd_ PxhL@DLLT-43|D0MLMHC@ML|LLXLpL|QJCKB -LM$ ` R0,0 (p0 R 0S 0L 41 R .!KQ `00-1KL KK `0.A[SN 0@PU ʅTh8(K MK@cP P $ R0S ȟ, 0R(KQ0.S $ 0'$00\ \\PGF  ' X 0 00KKd -1K`0.A[S PXOP H$ $0SQ(' $7 R'  P 0: S0006  0ASt:p766H5H5X6(KPMK ߌ$0@e $ X6 00C0 ᴈ@m Pk$ j$ R{Q  0.SvY P] 0S $0Sڒ^K PEPE0RNK^ @D @D0pW 0h%d-D5 R; PN$0S00$L0S" `0 5 A QP;H;:@;:8;:0;:(;: ;00 $2p P$00C0+$ RC L0SP4! .KA `0-K= KK_$ R0 0 P8#8C c(K 0$ 3 $   00C0(0K  (K@@@T= X X8$#0S3 \#X00/0-1K0.S{R  P "L0S `0 0S 00h P$  $ 0 SPX$0 $ P| @"00C0u T$0S <"b "\00(0PI Q:h;`;7;7;7x;7p;7X;00000000000000@e!E (KM?K P 7P@L0S X0`  0S n8 P4 P!hM|HLXNNMNHNNNNOOM0MN\MxM,ONHNtNBM -4!401@pPL * 0S& 0pGS!@`V PР0 R tpG0000 00C00020S0S`0SP0 R0S@PP`LT -`LVP50P p Ł1S7 R Q0S R070 X  00C0`V P@00T `V < p-L4MQ 0R0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $0 0 &d1 `a@H0  K D@ 0AS@d@P@d@?@< LK 0@S:0DS0@S*Kp kLK ~ 0Q R Q0S R00]LKD _ALKELK( U<>XO,O@CDLO -QLp `<DP@@(>T` X`OhO -LMf0,0 քPӄPU      6Ye(pQ ,6& O P ,6 0&E &ᲅ&ᮅ rK㪅( 0R01K1Kd1Ke   0S*1  11( \* P00P0S 1  1pG1( \:6Q&00R 0 >.9! Q ! E 0!R!0P52 5:1  11^ʠğ0S ,6 1R 0h p JKJD$ 0 ,6 1RJ rK vP#0Sg# 0 &ᗅPL0Sz 0# ӄ1&凅P_1!̑0  1 +`3 0ASB CEEE C ,1   1pG1\0S1 S,6!0  ,6!{  eK P l2&1ڈ001&4P,B H4 eKP 1&᷈00&PA| e!_p,6KQ01,&K p,6hAQ000F0S&\"*0 R !Q0 S  1 0`S rKP }}h, 0R(K! |@1! 0 u000SL]H' h|4OOP fedAlQQ -L`p@ IPPP5:Pa0@S 00B S0"a>CPP R R,1,,!!00@ S c. P 00C %`fxP0Fx3 @O&6F n  Pd @06]  f?P00`CBQQ P-L@ 00 R$hpHQ6 -LM0 Z3 ?œ3s ;@P (K謓k  `塅#3R 0X 0@cX, 40 "8 @0E8  OƉ 6F&V3 ($6 0( "0080S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+NP 0 R04 0 / d0\d0L `P@ 0R@X  aA T@P\|SRX\4hR$RR4RRR -kMLM0',0 7K@0AA`@`6 PP6: S 3/PR ႝ먦P%0S~ 6 Rn 0`St0Sn dfd6d&@`v@@ @@@@B ?0SL PJ P(0%%<0000PF%0S 0Se.K B BPL, 0R4(Kp5p@d5 R\U,3S. &(0<%04%S $R2 &P0S 14 R}T(T0Sp)< p0S |P, 6S!@Ƒ` 6S3Ɠ,6@ \   0P V[`WP `3 00B10@|3P LHC|`3P |D3P |(3P 6cS00 ,20!6 S 2" m|Bh|0"S[ PY &; p`\P@5ȗD"D2cוk@@)1 R_b)YP @0S@@0@S H6<4"D0#@1 ]P @0T!1Dx>>1\5H1@8*($ 1R  }hXD,SKPHTxS\\8@T4|XpUS`STUhSSUL@THLS,U`U?SHTdTTSST TUPPp@`8U|0 R0`00@TP%+PP @0ps+,$0 6t@ 0-@PLo!jp( b0@S|{{|{{{{{{{{|{{{{||p|{\1\ X^3L1 (!Ap,1,!0S1 R% w@P2 傯( 0000 0 000 0000 Rl0 RX0 R00 RJ<0OJX$tHX $  -LL0 L \ 00 (0 $0 0 $&4&P}x#(& -0L0 (& -0L0 (& -$$ 0L00  $&(&Qd d00A00d0X&( 0 QPh`$e-@0 0 S RP`4e -(0L00S 0 (&X}0S 00S0 $#$("(  @-0S\\ @ T2  R T2  R 0 SR 0-h0L0 X0XPT0 P@0D M40, 0h0 &T&$$#D&0&5i 0-LM@<P@Kw0[P00KnPPd\@\ |M0 000 (嬎P K0HePe#D&0&i pe 0-0L$M08PK @0 0 ᎎP JM[T0Dp 000L0 P0P02KwP@ 0 S,K0h#0&i eD&#i eX -@0L Zu(n -T L0R S S0RS  P0 ?upd(e -@L 1He -40L0S$00S  0 @&,& 0-0L$M0@P0 00S00S 0 QP 0K<-0 RP l *@K` LT0 LQKp@#  0 S,K0h@&,&fD&0&i fY -`L MPp@Kp P$L1 @P, 0S 0,0 $屍PK#D&4f0&i @f -L M K,0 Ap,$0PS` ǩX0000PPpp@ t t  @A0SS c020 K}Lf p-L MK,` 0 APn,0S 0V000 PP0 zt PPBN0S S c020Kp}Lf -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X  ;PPJY t H0 0D 0s 0D0 V Y P8 P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S :0PP0,0 @cT ds@(K\ftff -0L,M0Q5 K0  ! s0<0   <0K< bP `@<0\ 50KFKL0 D50K0|P4 0 S Kh#D&0&i f Y -0LM0Q@0  K s 1lPlR Kw*@KP KD0 <Fp4  0 S wKhfD&0&ifY -|0L0@S h ? R00S L00  tw,0T, @00 0 0 0$&4&(&x#P} -1LM0p$0 l1@K Q7s0WL1 H /:P JoK`F !JAP /:00:0@p.K>K6\P  0 01 R  w0S 00S Q  R ("(04"400! $0 S$ Kh}X}lf$Y-0 CR 0R0 S00 Q-L X6 p`@ -0CU3@% R 0S,,0SR00ӑR00Hӑ@ 4 R @0 S0S船 -@RLP 0S 0 TC 1@0S<p `(<0C3@ R 0S,x ,0So||@ l R @0 S0S400S(>hT>haff Q-LP z$i 1ZA@ _ 0(0 S^OQ@娀帐`p0 0 S V |Zt3 H/ X00`@0D S% 4o!踠fJLp}gcZ gg -PPLD@DDp(` <h0  $@TdJZL Qp-L`P 00S  R000 ӑxR 00 0 S r 0 QQ 0v03P0SLL  ph4@@Tp(gH0gD7 -0LM0&@K 0 Wqpp0 h@p [Q&0[S &0[< S 4 0 S ;Kh#0&:i 4g0Kp &hh$i -L M Kp,`0 m&$@\P  0傣 t000S \wTe5PpH0 p@h  4[5P$0 t@l  K@Bi(&,iHiX&PiHiPi p-x0LP @ T 10S c lphx0 gHzg8xS`RV$ Q@sKEMlL뾆ed0SaB0S 0BX00S ( 55P 1T00SH  4"x07@ phpXi`ilixiiBiiiiML1DM 10(0  h@K lmh AE TzpP 0S=8:>[KH@K$PEDPE >km m 0P 4` !E ZP 80S >KK$@D`D@DP]*0S  tP|@80UZX (0 S@f$K<&hk0&D&i \ji|tjjjjY -LPp`@P0 SP 0S@ 0-@PL0 p0 ,0h}j -L`d00XTp@Pp 4 00 0  2 &j$j 0-@PL0 pS0 0`j p-PPL@0Sq00pd00X L֡<8@P`RPPPp& &k@klk$ -@pL`@1PgP@Td -L(Mp0@ 0 `P  D@K$ |Plx Dl VPX L$` MP<դ 0R(}Khk0&D&i$hi$hY -Lp;$`PP h巤d p0 @W80 0P(@PekckZ -L@6D008 ,5$00 &kl$$ -L@D008 ,$00 &@K   j, GB 0倃T@K j 9B r@K j +B d@K $ j B Vpwp3`v`3  2 "RS XZ 2SP=@@&W @[,,& T KZ[Q 5QnOK@D ajX8DPK jP1 o?K  KcmOK| JjiK < A(4 \Pb[P aQ[U8 _@GSIzĤ sVZ (1SWN_K8&,K0  0S l3 lӂp|$&>$AT1S1S1S Q!000C S0:S Q4 P3`T 0S,, Q%#V @TP"R0S T%0S@d%K  2S*0S' @%04 ,%(0 %0 %0%|% "R\0SX2Stx1Q! [0 5P01S d10S  08(10S x 10S  00S p`p@[ ,0 S9(Kh#0&D&i i8i4iiiii$ mm m,mi|@mB8mHmPm`mhmlmxmJlZmmlmmmmmmi m@&,&Z -4LEM0P(0 pJ4 4$p4Q=4Q84Q3|40Sp  \U 0S 0SS0b P@Ked( h H@ ၁PW $|0PlmueP  |, dPxp @l4 @0R$ $30S  20S((4 N20S))20S  phNp20SP` pA00S U8 P0  p`00V pWP`xaZ10SAQ 4T0@$0$@SFNK@DP@D/PRKPQKh  ?41d рP/O4[S nKP[ <P P,?O[O[!1QppP5K| %NKP[5K < PP,i? 0)  (0 S$Kh6D&#<& n&nt#n&nn0&6i(nnho&oj(&`#Ki(oJ0oZ -1LM0\pK@8 P`K$0 g@ g0tL0 H0 0L0 D dBPT1 L0 , H D < 4 6 ,IP1PL0 00 C R0:S@H P`pK@` 0` P& `0@@T0P0S @K `0K` P `0@@ D0 \@K` >T0 L pDH  $0 S0< Kh`mToZ`oD&0&i8o$Z -$2LM0pK@P4 0 "gtH A ` gA0K0 >1 @PCKlBP 00S0xS  0K` P 0 S T0A7S@A0[S, K Ό@ KP00@KP 0 W> Ph@K$ fx E> ~P|0t X0 tP\ 0 SHKh#D&0&i oooopi44pi$hi$h0Z 0-0LM00S  gPKPP Ȟ @0S|_-P 0S 00StPU<\ 08(&,ix&HplpD&xp 0-TPL0@S s<0x L 0P@0000}0& -X4L#M0Lp(0 0S0+S pP`JOK`` <(P,=T307 OK.e =K x~P H01S`@K e072K8BKOKJ_Kk8[ <ۻP,V=_K.e J=K2 |~P01S #KKlOK.e8 '=K2$ Y~P01S 828282828282@82Z 10SC OK.be4 <K1 H~P01S) ,P&42S82S @4P Pd}8P Pdsp R (0 S$Kh0&ȐJp<&D&"i pp%i ppIi pq qq$q0q*P$4 TR00S 0 R@ 0T 0"T0S$@$0S 00 0S 0 PU,Wc\Z@@, (i(Kd}klp$$##D&(&`Hr -PLM@4  p@0P-S#`㨤娔@ AS@@ aS@q`00SXpGWPe @^:P $ W:P ȗpGW0`,0 #3@ )P3pG`@ $@P30,0  3 3  |.:#0Wp0t0 @t)PTpW` 3QW0z)PZWj 20Sa]j)P @Q2 R @ 0S   BR X0S= 4Q ZpR D)PP QD2Q P 0y  0pG 2QP `Q d 0pG 0030pG`ꘑWAŢ 10S(1@0S1E;10SD1Q< 810S ,0 9,01,0 zP J01S00S00S ,0\ d9,0 0,0zP"9d}`}D&0r_(&T}#X&PrXr`r$&fhZhrr &TZX}-x#0&4&rP}r -LpM`10@W,0   @KJO@PK UVp@K@ a R`P060#0P@U@K,O U  U U na 4P0\0#0P@U@KO xU  tU U0, 0R N(Khe -L\M` @ V^PP, p t x e 0Csb0l0 )`P\  Ge hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@K ex `d x V@@PKl  ` #Z ` hK`@K ` ,0 S (KheH0H'-D0D 88 Q S RP-DD0 00R4 40R-DD 0R$ $0R-DD( (0R, ,0RHHY'-D0D 88 Q PS R-DD0 00R4 40R-DD 0R$ $0R-DD( (0R, ,0R -L^ \ \ ^ \  ^ 80S H0 R^ \$0 ^h}&& -QLM 0 0,0 5 R    0`0 0 0 0 0 0 0 0 0 0 0  QQ R H0.S 0(@S@ d Dp@0T  ʛ 0 P10S01 0 80 T}  4 RC 4@T 8PK #0D@KQ_ #0L_@ dPd3P 0m^@P   6 60Pß : S SR ~0S0\0 @  P1 `V0S @T0 | m2K"0 S2 >l, 0R(KlH `\2 S~0 @ {42 R0 0 USa0 _QN2 R  HǗ勗 w1 R1 R  @3X@TL |1R %d@ T000 c ]6 0-Su XrY@K 0! ^d0t  x p ~^c0 l v^c0h R0d0  ` g0l c^cd Dh8'@','$4'&&l ''&'tn'8y -1L@\! pPo  1 R0SL t@P 30CS8(0SJH0SPHP ($1 HH0.S% Q0S,X00 ܺP`>0S0v03U0S  㲷80S d0 R LP0S DT8UR('&&l 'y&y'yy -LM@`JPh ]P 7'000JP7  w0〧倗80 p'ʱp` 10@GS p\8tXX<,h0 4&00-]P U 5 5 %ip 5r5  0@jS5 R0S 5 R5 R0S|5 Rd5 R0S 80SLU 0/S 040,%0S 0S S S $0S $4 T  4(K0S S S$4 p$0S4 R $t4T  t| 4d$L4T$$443 4#44 03 3 0 s\3 @3 3#D33 <3 d3`3 X3L3 003#23 20000"00H2 d2 2 t2"h2H" 2@20" 2!11  !001!Q ;8 0|x1 x0S !x1 `Q,K჉!`1 !P1 !@1 H1 Rl!1h!1  T4 KtP@#[R0 ;1 R !0 0 R !0 0 R 0 0  0 R h0 `0  y}D'''@'H'}y&8''0' '&''& '&<'p},'&&'('&'$'4', ht@D4:  S-L=  S*  SL2 RT@`0 CR` bX0=  X0 S6 I 1 R `0 CR` nX0*  X0*ͳ1 R:`0 CR` AX0@  X0h1 R%\`0 CR` 9X0/  X0(1 R`0 CR` 1X0|  X0=嘳|哳/厳@剳p0RX=㘳p0RX@㐳p0RX/㈳p0RX|〳p0RX*x船 -0LPDp*0 RH0P R 0 R : S=P\@P` 0BO?$m 00 A <8''0' ''zz 0-@LTP `00CS`0X0  X0@T 0S  808 R (@T0X ꈹ 0-0P R 0L00 R00|0 Rp0 R d0 @T 3]/]000 @T08''0' '} -$2@0LS 0pp2` R00p1 RpTC ؁PPUK`00CS`0`X0  X0  0P@T+ 0S U0S\`0 CR` 4X0,  X08!P(00S*0S!`0 CR` &X0  X0,^0S!`00CS`0#X0  X0 LP Gp0RX,Wp0RX P@ i4X HX iC8''0'} -LM(K/pPM P80SZUԡ@ ̡`PU: 0S (0S` 0S7`00CS`0UX0  `X0  (0S@W@0S `0 CR` X 00@X ޱ@p0RX @0S α ʱ``00CS`0X0  X0x0 Rl0 R `0 @\DPX 㽱`X 㸱船@'''z p-LMC P K.bP@ `0 CR` DX0X0@ T 0S @v T2 RE2 RT0Sn\`0 CR` X0  X0@0,Sc`0 CR` jX0X0@T0SL`0 CR` dX0  X0xp0 R \N`0 CR` !X0X0@T 0`S T#`0 CR` *X0X0@T 0S p0 R \n 0 00l x p0 Rx \p0 RT \p0RX xp0RrX r}$'& -MLMX , 80S <4 R04 RZi 0Sc 4D R3 R@@KG$ 0@3 R  3 R0: S S 0S3(` 8@0Rj ~KpGpG xepa  D@3 Rb43 Ra 0H@3 R!3 R : S S 2 R9`00CS`0X0  X0Zh, 0R(K@0: S80SdC^KPEPE0P"WNK@D@D8"wp^ (0K 08B:Y1 R  0*1 R r(o!(0(!"$ g, 8 Zp1@P` p0BO?i 00;  (2(!0a8@00^C^K PEPE0 @[W 0e0 @ZX ȯc|wh@''8'$zH',z4''Tz'&0' '@ z 0 0 !8 a Pp8  P`! 0 Y,0pW @40Sڔ!0S`0 CR` #X0  @X0T!0SH`00CS`09X0  X0000 S00 (K @ p0RX $@0 R0 R 0 @RYl :T@P 0P 0@nX 00O$ 0@ @0}&@'''z -0L $tHlz p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@⌮Qpp0R0 S單ꈹ' -pL@P`nP` P *p00pT@P a@Tml0 P @ P@0㕓#PU`pW*L'zH$}P' 0-LM@P  K0K PPYp (00S1 .K0L'zx -L MP@ `$K 0PPnYp $TpP 0 PPaYp ,00S  ፾ KL'z@0P0 R0 RP- -LM0 Cr  0N0 Cr P N1 @,K@ P\,PU 0   0 R$ PUQ RPD 01(1$1 R Q @00@S, Z&p`@+P @ T0 RRpPh` d0@p AP 000 ,g$da~~~d|@|\|k -p-M L M0` R P  0 R 0RKp  \]T ˬANK@D@D08 T $B~h~Hp|{ p-LM0 0P@0<0R\\0!Kp800 S800ta<80< <0\S*@ 0R&D0H@(0,!40Sa<a<V0Ϡ `Al $!B30b 0@@< <0S  K⇨0@ < 0Q =9A =CD H H0t0D R0<X PVL0 R `<`<0@@ {x|~|@BC?B~|~ -LpE`PW PPJ\4S@PV \ 5T` `P/ T"SPL z0VX0PPPPPPP$0 ( [(0S<0 0P000 P00003 0S0@ 00 /M0dh PX  M0$8 MM-@{8}4{||}} -@PL 0S@R 80< X0PdS J 0 <}H} -L$MP`U@ 0S x D  ᏧpH 10@<S<                                                              Fp6 6pg RP0S6  0S 0S  ) : )P !P0 80 @ #KPt$0S1@GTPa@ PP䅟k0K%p@PT D00Q  R1 0S0%000S D0\5 D00A00>00:0070040D0 140SDDU 00SHp@PT0U 0 U 00S 0000Sdp$`D0Sx Q 8 R 00S P0So R(KDP000 P0000000`V} 0#@e0003 R 0SH3  0S#/KP  㹫 30S0@⪫0S) -P :(P )#P P E H0W00kH ,0R  -Q  l"31C0La1 @KP6ں3[ ,00cS b0=9 = B 0S!000400 Q- $0< 0bS$0'0$00|,0W003X1 R*Pl!930S /@04, 0R(K00S0@ 1 0PKX@ T@ W0KXKP@ L@ H@ D@ @@ Q X0K0@ @0)@ R ࠓ    0 .@ B@ 0  100 000 P0   K+ BPA0 K<K@0 0 壠Pq <Kܣ@0tx cH0\ |{޴$0< sp0xhJi(|-(|-| -@L0S ; o0P%P000 0  B 0 0CKPll :蛴L0L 0葴x$0( &~---4|P P P P4 000$ 000 000@O//@00   0  DO~ 0 P.p@-` VPU \ 0 0)R @ TpQ \ 0 0)R @0/S\ pp@-` VPU \ 0 0)R @ TpQ \ 0 0)R @0.S \ p0  cR=9L = 00 0c0 -L 0U4됄H -LMq0.$0 PSP `e?V $ 0RO KPgK 90 KS |!A q 0  0 Q 00ӑ0S@KX :K/gKA aK 4PKD@K5X P8K  d=d=d=d=d=d=d=d=d=d=d=d=d=>0>=8 0  z -3L M Rßp3S00@@@@@@@@@"I "刓0 0j0e!KgP3Ƞ ,Ƞ("(<3 ",!$ Ġ0^0 `a2 pt0 0````J8#8 $#$2p` 22@H0KL HP D 0 @@ <@ N/W00S@ RC02 (0ᆳ0P (K ᳉ t00@@@@>J8#8 Ġ#Č 4J p|1@0K,0@,̠<Č4("Č!4 <$̌8K 8 40 0(1 @t00@J8#8 Ġ#Č I p0t0 0@@I8#8 $#$pD0@ i0R ʉ\OTO~. /DO.O~`OXO. O;8NPK .08P * .0.P h `\ 04S<xKlK`KTKHK,   04SKKKKJ劬偬~~{{xxuur2  N Q32ܰFٰpְl2  = 0`S fC -*Rb LȰ2<Ű8°0忰(弰 幰嶰峰尰孰媰Q 奰A-*埰;SRNPK .0P 1 匰|;V( ppMK⃰ @D K`@D @@ 0Td ;P 0r$. H. 9NPK .0jP\YhH(<:,8Љ,8HX(l;PĈ8T8pXDO@؊xp|;dxĊPЊ -2L4M  , P@A 0Sp S 0gԡ0S[`00CS`0cX0  X0TTڜ1PZpK""2! T`` h`00CS`09X0  X0@DT$PV @D <4("4! .0ܿP ίV x ǯ0S @D⨚T, 0R(K嶯. CX 㬚 d呚T`0X墯P埯X 㚚8JDOh̀pd\\ -GML M號ENK0@Dp, P4 9W `V Q 9   ߙ, 0RH(K0SX X9    @ ʙp 3 >P 0PS- Sj H0   9 ȟ08 R`00CS`0EX0  X0l0 t*,lh厙 P PP 0R8(0 00@|4 xD $04"4(4 .D R000t 0 7ǟ 0 B0@tD 0 l0u@F   aP 0TG #D7$   C(ǟ R0004'00F0000I\ 孮0Q :Q $᢮j3l ベuIv?4 d叮\匮 0  $0H@ 0@ @@ <@ 8@ 4@ G0KD@ HK0@K00 HKqş0S |x$itPep0 E0 P4  R b5Q% QaN00XPPPU`0 S PP  0 S 3 FKAhd , <$ 4!$EK 4A,,.<A`$ \4 5X 4C%  T 4# 0#pD 0| x #|$x4LD)% #8D0ğ |xVP|xD|x :P|x$X ޘڭ 04S *ѭ̭S 0HSሄ l P UKH@H p P4`U :@TJ4[S E( K#D@Pd $墭P4UuŸp$4\@P唭(B0 X 卭@TI T`六`0jS'V <4("4!L,[0F T@LoX@! T,M0glP t ,Bl$$YP1 RD`0 CR` X0)  X0lUP T,'A>`p0RX)5)\.P*UP q $1  0P4UP | j jhDO=\>h OPO~ /LO~h  H~\(0.$>@@~~~T@LJ`Č،Ќ\ -NML?M? $ $ $ $ $ ,  h$       \/`p= E0@2S2m\\|mPm\\\\@dXXpHFYP00 p Ο1 1 0`JKI I8^ " 0@D (Pt0 R=|= `0Q  B=P-0 k4S- -K B B@@@@@F>K@0C @"0C D 'Pl$0S 0͟0   00 )b^Pul,0 z ]p` ̟ 0Sa  ,0 R t,00`- AN{=P : T̟0Tڴ+00B0S 2l[+0 00000000`@:@`@ T @D0XD @;˟@ 0\$ SE>K0C0C5  \ d)* 5\ ]p D-K B B0$ * R44:0  4 4 ˟: 4]P0 ʟ$0R pspW@$R$ 4S 5P 0s 00) /d:   t)00P@@X04 .PH X 00) 30 ) B0pXpP UFnK`Ft `FP@  0&PGl4 RLWPDPlU@(ɟ0) h$R ɟ0RFNK@DPh(0PW]P9)0PN]Psɟ@)$ 5\ @B]P+d9)% 5@9]Pq(@o @Ū|m忪HgFQ @$@T8W(Vǟ0@ g00K @w娗FKKAHJ A H0 J PUT@T0SX'0 08@6t (K@ mP PP7PƟ 04 H0K4 4 4 ̤ D *Pz $46 R Ɵ0Rڈ&6  0 aBQP6 50SٔPU D5 &0:;:0{%0<0v%0:;70o꜕EKAA |6Pb0 R^ `4 RZ%PYqX%000QDş 5   H %080C ?xPRДEKAA IP-0 R) `4 R% )ꄔEKAA!P0`S `4 R 43Pt@@ 0r 3 T3P#000CEKA A4@ R `4 R0 S LIq`304 wPd#0 00D#0600#0@00bEKAL L0 P d$2R 0qvR0EK0AA `4 墔@h i0S 0 R `4h$TQ (pP2, *++ 0S @A0C2S2jDjjDjDjDjjDjDjDjDjjDjDjDjDjDjDjljDjDjDjDjDjDjDjDjDjDjDjDjDjXjDjjDjDjDjjDjDjDjDjjDjDjDjDjDjDjlj40SL!0<0 0:0 0;0 0:0 0;0 090 0:;80'h..`@$ 4 /t20GvP-   o 3PWA03@R ]PKT0 G dۧC0S? |匨Y:ޢ0S6 僨Y13p3=K0C 0C 4 l:I3 尤P r1 0`POMT3F>K0C0C@)& lD ZP8 `r 00) 0t   0,0Q @@$ -*94P @p$)+ 5\ YpkrX$E>Kd 0CYϑb0l4 |@Ph5P 4 xx%S00  4). YP K@(0CX @Xa 0-8P8@L4 ,>  05H$tJ - L⛐h -\5LBM0pPD,0 0C 2#=S0Sr=@ PRyyyyPyyyyxyx@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0xQP >X1@T,D10S CK@ @ыpHK D4CK@ c@<$ 8D p CK@@<$ 84 (sP1o0P  %&HQ 0+SH HXڠlY X nHLBNK@D@D0H$VT0hJ(OOO8$(<H4XpГOC0 S S  -`0@P@@T0 LE <00S 000S7/f:Oxx -LT4@P/4 p-L@m<P `p p-2 B 0L`@0PP 0S00#|2[c =%L -9L2@A<0P/S @P,P$2 B ?40S ,,,, 1RP @P`F ,V 0+S-S0S*P*P r+_L10S *PT1  @` P|P`T@D00SPPYPN100S 00St0Q?/ '9`9hPv8PQpxxLxX\`d\l\y0yp 000TT 00@`T 0-L@PU0 0 G 06S000H,0 0@S200 XT 0PXT 0- L0S( 4 @ 0   0)@0Q@ DLP 4vh 0T4~)0@0h=0XT -0L Qp0q 0 -0LPU5 40 0@044D 0S+040P`0$44p Td$T(d,t$0@044D $ 0pQpqh(XT -0Lp`PP#,0 4@0$($,T044Dt T$F P 404(0$00 4siXT8 p-L@ 00sW(0@L̗ -4LtMP3 Q $$0R($0R,0Q00 :$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4S^,P3 3@ 40 400@000  D3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʝR4S4S 4?  0jPp@Pq4'20dtŸ q 00010*b%ph Pz'1 4D0O4D0P00/0d4t`10S% 0S+K HG'N<10S01KƪP1 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PK*0(KXTyH ,yL@y0y4y8yy 0-0LPU ,4S0C$(QP40@eP $4(D 0@$4(D0,40h0XT -l@L0S{p D0,$R0,4$4(D 0@$4(D0,4XT -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00XT,yy -LP l0 P 0R 0R Q0$4(D0,4XT 0-PL@T 4 w 04P X00S Cpq 0hH0 0@ p0XT,yyp$ 0 010#Q0S4:Ss0p 0 00  p-L 000 x 0Pd `P @ r 0 04 (0$ , \T00 , (0$0 0 0 VdTlVdVpVtV0 0 0 VhVdVdT -LMp@P `@_00C0 S%"0 .S0K0 $ K KdT p-RL@Py0` 1TUp -LM`p$ @PL0 `pdT -L|@||PM$pK(`K  (0S0C(0 0$ 0b0 0R 0 000 KdVhVlVpVdT -LMP@p`z1   e0` p-L@LMPK@%e1`@@00S xdT -LMAP@܀,pK(`K, 0(  R,00'$ (000 0S( ,0S(00$D@(`K,PK 0S#@0 S$KlVdVy -H0L0S00@@Y$ 0@00dTpVlVxV -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 %00S C$KlVdTdVhVpVy 0-P0@LT0 0S0 <@/800 0P0s300lVdTxV -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  KpVdTyhVlV p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S "000 0SKplVdVy - 0L00S LlV p-PL`@/0 Rmpl00 AP@*D0P0A0Q: gpdTlV p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphpPtV|VlVdTpV -LMP.|||p`,K  ,P }@T!,0PT@:0S0 0 0 0SPdVhV0PPV -0LMK0 6" K  -L#P x0pq  T0 hH00S <@ *.0Sjp.0SPKw!>P J P L>| PQ p>0S ] P =D>m PB 8^0S @T$@%PT 0S:uP>0S 0S,>(0P 5;:>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WK+P@ @K0@0SP +aGQ0+x;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcSdX4<H@pTĹH(8TT,p( <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<Ĺ 0IRQ|80S0S L80S8  2RQ80S0Sf +0S0S0@W70S 0S0S@7U  W 0S0S0@9 A 0S0S0@)60S'0S!#0S 0S0S0@0S0SP60S6 (-6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ )7# k0S0S0@!0S0@40S0dSd0@h4\4 EQP < :{0S0@(4 P /,mQ"8 8K%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02PE'0S0S0@TP P #P %/ 0S0S210S0S0@%P 0S0S1x18K80 b0S0S0@Pdzw0@) P P k h00 1! j X0H0p0PN 00PJ 00 PPE PC MAxVxVVyVx\V\yP, 8 8K|10SP ,!P P8K8` XyPYP ,YZ$1 v10 @p 1 P0 , KP 0 0 0P@ P0 0R0 0Ul00S(8K8` Q(Kt@yVxx0y4yx y 0-LP@A@P gP0h#0 -`LP`pW,1`V@ZP PT 0 y 0  0   0  0   p-L@P`P U  P V  P php -L@h P-L 0h -00L P  hęt -L@)% 0r/S@ R -LpMK@XPHK 0QAK -L 0P - 1LBM0P$0 P2  04Apq) IOK,ԛ봀P`JK(A  w0S PP  m(1S*+ P VP`(1S:V $0 S{ Khy -HHaLp@P#R %RT0TS 0S %R #RP I$PP@ R묐0ਠ`P@#R %RU0US 0S %R #R P ! dm$@ P R  0-D@L0PS0P(000P0< -L M`4, A$@pP@0S 0S P W @P RX Y" $@XP@ d \00T @ P  d,M@000S0(KXY0 -LM@pP 0S `PKhB#@#@@ZL0H P`W +@K`8 -(1LMP, UARɈCpP; #@#@,#&@`PZ0%S00sSZ,   #,#P@00@#T:@~T o艈xD -2LM0S4 8 2@TytPP 0|S0P0@ 00 0-SP <P N#@K# @p`Y0%S 00sS  A3#@`00@*#T:+P%UV 00S h10S@  @)K P  B)[!80P40@p9d0p@d0S 00CS00`Ӥ0` V g0H v R\ @"p@`00߇0Sp(KyxPt -L@"8 0 pS` R0S000S"`PUP@000S 00XY 0-LpMKPpP@|0: S@@zK0 p-LpM0`0SP f"@ P KEPPl00S0: S G"*@ P, GP9Kpy,<00S,0P 00S00C@Xyxyx'00SLy 0S00\@y -Lp@P`WV 000CW`K@tPuZ X`!pWZVX (00S m` xdy -LMp`;p@P qV 1i 0 0-t0L0Spq p@Pq0T0U0000,y -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW dUV EUV>P@ 1P 0r@1@T@ ZZP`!hpP`qXp4q2P P AP!T 0 0S0uv 0 0S 0S0x  p 00pWZYT+00 oe 00Sux|yxyD\@y @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 VW p Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@YPE(`@0 $0`p9pq7  0@P Y0$X!6P"`@0 0`ppq 0@P U0T 0/`pVy$$0S0  00tyl8y 0-T@L0S0dS0 PP(000P000pp -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0c0@P3pqI  0 W0V  0U5T30@. fP'0帠@00@P Jpq R 0 U0T 0 Z tyVppy -L@Pv`p@Pt 0u 0 X00S L0XR@P*TU0@x0 50S(p, -50 S  R(pa0@ S-00LA0@S0jm 0-L MPP @K 0 000K0 'Pp-L7 $P'.P ^P"L1L!@00 0%BP 1 !1L0 0 0  P- 0s0sph<0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 P phppȚxphsHy -L M@K0s0s ?00@3K(p -,0L R000x@BHy -,0L R000y@By0P 00yxP P 0 ěx -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0  KYX؛ -1LM0P@ 0 ) T TVxQ@p `M "00C0 S10R!@>0,STT911 0b 00@0PK  0Sp` Tż 1` A @0T@Kap 5 @KH0`0P , LK@  0 S0[KhxZ: @4 -@PL ThL0 Dj@h<f8d4b0`,^h08d؜P P P0py 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@7808 0K10 K0yyyĈy@ P-L (0 00Sh, -D1L$M0P0 4 " P P>04K.S( K 040 (0S0-(0S $0 0 00S000K$@K T @P0t @0S  K0 P C0K$0K00 7 0 S,tKhDH`yx< -D1L$M0P0 4 " P P>04K.S( K 040 (0S0-(0S $0 0 00S000K$@K  o@P0t @0S  K0 P C0K$0K00  0 S,KhĝܝHyHQ PPP0SP 0  0Ps$0$0S0STy -LMK  K< -Q0LM00SK0 d KX -Lp@PQ000C S @ h,,@0`0 C0 ST ;@DT  0@TU0 `0 p-L`P@0-S000C S ph!!00 C0 ST00^ap -LM 0R0*, , 0*  txs| -0Lhfs -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i  fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KP$0S090S V0V 0U @00SSS 0010,K0,0 lV 0 \0   000CS,,------|- K舞О8y -`LPp&P`$T X aP$T T T-T00@f- GL 00P@T -LJ@0  s  -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 1[X!0Sn`z`@YPPT 4@ ,p 000CS91222222D2X@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(Ks$< S 0 Q $ 0S C   -LEP 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TRTDyd -p@!`PLaPQ Y 0T 0O -LM d 0 K p-LMP`d@ 002 0@?Kp'@B -LMpTq;`6@3@@0 P`l -LMK| -锠PLp` 0@SP0000ScTq0Sq0#S ,y -L P P Pp hf -0LM0o$0 0@p@`%0K%PK   000e' @PV-00e   $0 S | KhP -LPMU@( p@tPp0)0K)`K 0V00 f0@PW-00f  (0 S G$KhX -LPMU@( p@tPp0)0K)`K 0!00 fO0@PW-00f  (0 S $Khd -\0\0L@S L0 PKP p 0 0 贈s8y 0-L L0PS00C0@00 R+0 P00 0ywy -L@0@S -1LM0pP`9K$0 +%P0 p`$ pnR sR dR @@`PP   0 `P $0 S  Khl 0-0L0PS@ t00S P0@0S @00S w$00S0 O0xy8y 0-L@P>u9 0 0脈y p-0L0 S P` 00S 00S[ 0@@Xt0P0S h00S ph&X?P0 @@@]c?400T,0 phyxdyyxy8y -0LM0  l0 `0Pp `K  0T0P @Py8yyp3 -LMP @`  \Q  0R QW@X@T11: \ 40KRp3Q 4 ,0 0 0 00S0!P$K -@LP300 -0LM0@SpP  / 0P@" @h1`P 4@P2@@UPyp p p @00C000C 000C?001x0@-<0  00@P4 p 0q-  + YQ 0%P#uyp@q 0Q 0r S 000 P P808 PHZ0P:j|xwDyttyxxJ(0$0 0b0c0AVyyxĈ -p0p 0LS@ 0@s@3dH0H0@0<0 80b0cA6$0 yyyyxx0&꼈 -XLyP@LuDr<o804k00,g(0Ly̕8Ĉ@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3hy (܈yx 0-L@P<0  0S0S0 R0Ȉ -0L  0S;p3 -L hx-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R  00 0- LP@ R  0@ 0xxȈ܈ -@LP00h$00S0 0  xPyxx -@Q 1LMPp@  PP0T0 B`Kp@&P@ Bp 000  0S : L0R  @00S 00 0 0 xxPyx 0-@LPT 0S$  0 0x8y -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d PP(Kx܈ -L@MP`X T0 @P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K! p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH H@ L eH@D ,LD 00K@P  AP 8K00L 4@K @WP ` p\XPB H008KL 4@K@ ;P3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @L%D#QP 0 `LD@@(KytyxyyxȈxy -L4MP43@(3$H D @ < PP Z 08 40 `8 4 y8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(Kxxxt -LLMvwJ 010 @0R0 , (Kod00S )[~p@Pq v, R00Sp q Q0P 00 -8 00CXZ (Ko(K x(@yx -0L0@SPTpW"0000S ` p-@tPq %yl`00CV0p@yxxx 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S00|2 \ PTB0S v@2 V0S ;P `@P/Gp@Pq?@P"10S  S 1```/V@P 0@PLa0Z u@Pt u Z Jj@Ptu t,@ (P u(_$,K  0pP h00S00X0S  D0,K  $0P$KxԨyxyHyx -L 0 0S0 hyx -<L>P(h 00s030hxx 0      xx 000y 000y 000y -LM0 $ KK0 0 P$ K -@PL \TL h8dPdhd -1LX@ @@ Io */g0  @`Pp 0S0S 0` 0?0080  000S iTyPd8yyxxy -LMLp`KP p@P90[SPKT[y - L P006y -0L 券Ʌ$tH -LMP@P 0S 0S1 S K R3 P 0B?SP (KP (0Sp`$K $0(RpQ |P` WQP00 -L 0KM#+V -L(M< @ 0<[ ,0 `pZP<@@PP 00@P 44 04R0  00 4 8  00#0S83C尠o,0Z0 C@ 08 S00 P8S0 00CS00S 00=@P333L000<(#0S 0@Sv #0Pd00< `Sx2 ` R p @  0SO ,K04 ך@T# >\24P"L"l2 0  H"<0P P R0%SQ0Ƕ  001 `80S1 RE ¶STh4 ,0K@h堶b0 , 4"4@ 000 00D(K@P 0 4t#d3:<@PLP`D_ @2@ Tp -@LMh &>oo`p20p0`W` K -LM @`, p` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@)t K@PLL 00npK`2@PΌ  0`0Vp, 0R(K'zh -P8&> Y0L\"]280` R0<2<… 0S20@20D2 叏00CL2 0 0CH20P20Tr( $@S 0X2 g0bTX2i=ST0S0@2Uz D _R 0S2! 0 ᘭl0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@P@c @@cPE@@PcPPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PDJ^00e0P00 -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@00@P 0y@<P  0, D 800$7](K XX(KoX$< M-Lx0\@ P7P3!0SS`p P4 00 ,?0"10  !00  0,?0"100P0fY(Kx0 P0\0 0     !0   PPX -L @ p ?  0 1<00 `! 0! 0 ?  0 1<0PP0 P` o -L MX`Hp  p\`W` 2QPY.EEwOE B1 @@P@k\^WP, pH?`W` K0L 0-LM PP | p0R dKfFp PY@P D0D 09Y' 8DL\p -LM040K00 \,K0 @夦,P\`  \(K0pP 0 厦,Q 0 [x "10 0 d[ @T1"0 0 0@1!T$[Xx -LQ @ [ Q -@L  &> 8WU -L4M0t(K(0 [(0`S $pK0 p$$@\P  [ KW0( p $0`Sp ( r[P# 2pL`K2A@ @N P0LK000 F[8 -L@w -L!M(1`"( S92RS]2S\@EGP KP[/0p % 00`( 0R $KV@0[%U@vhd 0-PL@WZ0 -L MP$K@p`0 V$0S  Z K"100!aRRl@0S`VX4VLZDZ@_ ?0Z|4T -L M`(K@0 (PpU  `xZ$K A2@ @ 1P p-`L|P @ ;`P 4 8$0 $0p4 @`4 |4 't4 $ h4!d00 X4 P$0@D>P 08P01P ;4 3`0 pSp@HLD 3@=pP3H0c4 n@<0T4\2P)`hp墜@P 0 S 00K"P 0S0#3 5QPP  A!᯲/PU@ @R@X00SX00SL0  'H10S$"0000S "0000S 10S($B$uRp 2p` !0QP 0B`1 P !<t!Anp`d0W810S`RX 00S00S0  XDp30P @P P5PHx@u3q$t(̂d `܂ԂHxhЂlp 08@TtȂ؂| 00 0PT0P$ 00C0 R0 PXTV -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphpPTX`-0 CR 0R0 S@00 -h1L0`SPp@D@<10S T (10S ?T@00S T 00S?T@T 00Sp`?Wc80 9400S h  h?ꨂ:8 -LP \| -LZP  -L/P k -L 30S: S0S6R) 20SQ b 0R20SR $Ol2 2R P"7l2DR 0R08 KPK: @2b PKR8 K-z00C020S 0S0`KX Z\ 0S00R0S QPK000`` ``` `P 0S!0S @10S5\10S d10S\@>S T`;S`08q@S@`P0SU N$a`00S0P0S NT 00S0S0Sp0X00s03Q0S 00S   S\00S50`(KЂ@`\Ȃ؂pthlĂdlԂ  0-L CPP@ 3S S S @ġ 0DzH@B PM0S 0ly -L 0onH0Hd -L 0KM#+㋮ p-PPL `P @Pp.!P 00P @T P P H0 ՕP @T ͕P.p p-`PL& 0S# nS$ 0 @@,P0PP@`00@,ѫPp40oS0 ` -P 0-t0L0PS Q @Q  JP,0 r300 R00蘎 -LMp,K0 .MP1 -@,PW T^$ W@` ራP00S | , 0` wP00S | , 0(KzR| -LKMMMK@D@D0,0 `SKKP@AAPP`pP4: S  S 0<L KPP L KP_ @LKbP, 0R(KLK 㲔`Pd 2 RrbPq|LK 㢔0p03Q0S 0W $0PE% hd  -LM@08K0YP@`AK:XP0: S VPP SV H`@XP$KP U @`0 R000]K@XP l1: S 8I((dEI긎,LQ,QSVXg 0 0(K4 Hk 妗00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K pq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 Yt2 0`@H, ^^  0(4Pp'%#0\/ @T3 0Q  0ݖ P 0Ж@TRf LEPa 0 ||s20 F0 Ȏ(DH̎P`xJ -OMLM00$0 P坖EOKp(QnK`F ٿ@ dpc@T:+VPPD@K* $ghHp|Q P-L <@< 8S ,,Oc0 H$t4H` p-0LPP` @`P GP"H`Pp@ -LM0@0cSz bSz6 PK 2 0`S R  2 0 S PU 40!Vā,((0 "4^ LD 3P |@ -LP@@<1<媠Ppp`!-p mP \ -p0 !0@S( W VCW# _b0 `P  jP P 10 pRpp8t$XbJ$t( @-PR0 00@ R! 0b<,4$<, 4,$. !,00 0 0@SQ:00a0P<# P8#,8# P4("$$# 4S   8#8S ,8#  <4<("4  8,#44 갊ԍ-0^00 *0Q AS^*0rS 00n00 0S 0 \*00b\:\00\ q00l P: !00S갊8P8(   0   8                       @   H   P       X       `@<840,($ Jܼ p-@L M0KP`  @:0S"V8#4,|4 <0 @!0 0 Kp@8<#4,4 < @0 0  -L M A`+QOT0  Qp &0S 00000@0 KP 踏 0SKt XX0  QPp <04  Q   |@܊ -L,M$K@0 脏$P儀U`pDK( K,0K@@ 4@ 0` , PD  0aP0,<S*0 CR )00 \ 0 CR 00 \0S + \0 R \++0R P+>h+0R>h+ꈹ -pQL@ᬡ0S:`00CS`0YX0  X0xmp`@``!o0SD@`00CS`0FX0  X0 Q 0 CS  \  XQ l+P`U ( y@0S0C000@` VP  X U0 K+X ^+X Z+ꈹ $ p-LPL`@LDL@0  0F@$  phpԐ( -LM`@ .@Q |o*Q P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R p?T dB0P0 L?PW 0yZ  $?X v ?Y @ l  ? @ ??!p ", R ?0;(?00 L 4?8@T700 L T?P1 R) 0 4?0! C$1 R)`00CS`0'X0  X00Sd0S`b o) )<o 㯂@`8@ U?H o8*X oK*ꬍ4H4$8P`t$t -L M0B0r0 S P Q ) 0RuK0AS??0 0CS(X1? >QN QO > ! l> 0 X>PL!0S 8`V;0 40 L @L@(`@>{0@K>(P >> >xx s x>p>hWZ``8`ꀊhH@ hP` <D< -LM0@0 4 80 9xu/-aT,  cT ,  gT0,0 ) ( (@şş0`4 ğ4P 48 4X0 P$`0 4 dX@ 4d0S0C0Y  @  \\@0S4$0 <400S0C0PP  0@Sß0 30S0C0PP  0@S0 30S0C0PP  0@SD#0 X30LS0C0PP  0@SŸ0  30S0C0PP  0@S}0  20S0C0PP  0@SmT"0  t20hS0C0PP  r0@S@g@02 R (K0@gS@ X1 RQ PR,0SlA/WLP 0SL 0R!0S|B  * ( <JA0FQ$Ba>q :6}20S,  p 0d0,   00 R==D܊|,ԍT P -7LM@ T0 P`0gS 7#wHQpK >K0C0C@ @p> 1 R1 1R wfV`9 8  0@pVnK`F`F+(Ip@S50S pD}$ K@ @g H4:02(/hȐ -4L0M@PT`t4 pPEU50-S,@P(&&('(&&'&&&&&'&&&&&&&&&& PU  ,K@?0o, RPEUp|3PLK 00K@L H@ 4 DP @P < 8P PPP0P P0SY Y *0 @P0 0S! @U (K2! 2 2 2 PU} yP d=0SP P20S 82  Q 0QX 0SW 0S0S 1 R00P001 001`PXP00P0 1 R0SF0 `> \E90S0C00:9,4k40 Rt (9oP) 00KLK PPqP00P\ K0-V d`9X8P Lx8  \88k -PLM`P/ڗt3h#p1 T0@"S",+++++++++++++++,+++++++++,++,++,++2 "Pp2嘢p2AP PP@g3 Pn T2 RoF <2p ,2 R!  1pv1 1 1 1 1`1 0E2SN-H.-H.-H.H.8.H.$.H.H.-H.H.H.H.H.H.H.H.H.H.H.H.H.H.H..H.H.H.H.H.H.H.H.H.H.H.H.H.H.H.H.H.H.H.H.H.P.00"TsT|0TTDZ T>@@pT<xP4(Ȑ$0 R P"!P 40@-t0Q Pl@ O\ 0 l# BN0R0.0N0N 00B0P///// \HXP-^𝔰1S00CS 10T0T0T0T0T0T0T0T0T0T00001L0T1|0P01 `R$0SX01 `R:H01 `R:D01 `R:01 `R:01 `R:L01 `R:T01 `R: P-L   <4("4#6$ $ $,t -LQ 0S 0S S hGh 0 d, -LKM−0HK,0 @T`? 00CSPPU`p@\K P0 0Z000 00 R@U0 0Q0V @0S <0S80S40Sd ZDX1R_K@\H[ <@^P;0!`, 0R9(KP` P` P` P`P` P` P`P P P `4 ` Rh4,l p-<L 4(M"4Q l 0SPx1 r3VQ0X1@@UT ,8i0Kp <4("4!\P@ 00@U 6T!P`UU U&Ƞ& &< PP{&Ƞ &<t hPq&<X HPj&Ƞ& @&<, P@ P\4, -LM@0DS7777777777777777777777777777777700 0$(hkhhhM, -T0 ML\@4 <@IP , K4, p-PLM@  0 R G@,h媟`xK )`P @.PP (P@T 4,, p-L$M|Ÿ|b0 S P? R6 @!T#99:999999999999999:99999:99999999t:"RH :0! 0RYKp|,DlpA00vP! 00t8@K0 0 80 40 00 ,0 (0 $0 0 S08 K70K ?.qP , B 00[S S/0[0S S Q"[-K04"48#8 0 .K0eP/0[0Shh,,  0-L(MtP9@K0l 0 0KS00 R004 0RK05Ph p-L`!\P@ pR00 4 Ll4. 4f4$ph`4# [44z p-L\P@` !\ "1Q0 0S- S ^T)0 R ph/4pN 00S S 0004"48#8008 ph4 00Sph 444z@ p-L@\ `P3TN  00ES??>>>>?>>300CS???|?p?P?33333 R R |ph33 Rxph3p3h3`3X3P3Hph3@3H<X,4  \ 0-QLMP@& 0S S Ux0 R h 0K0h|3 U04"48#Ƞ08hp30 j384d@p0@SAhAhAhAhAhAhAhAhAhAhAhAhAhAhAhAhAhAhAhAhAhAAhAhAhAhAhAAhAhAtA$<3  93y -PL$M@C !P- 7T H ldd \\PP L1L 3@1 R;41 R2(`00CS`05X0  X0K  02@ 0@20 R Kh||2X Khxd\ht 4 0-LM@0PS$ @K LL@@\ H@@X TQP 0v _K0I000l -L@M0r`@0TP 0   \KP201 0S0C000 R2 R X0 R 0RKP0SaD"0T @ \@T`T E0 ><0 0XS0[  s( <24Q<a20S;00`  B LR` BX0X00K @ @1<1 R 4Q  10S `00CS`0,X0  X04P {P `10S 00 L y0 R00p0R PTX g@bMh0 p t4 -RL(M0@``PD0  0CDK(K, @ 40 0 <  08P @@P}(Pj (pPz  0@@Pt(0`,W*@0@V0SU0 0 R0@VJUU@@BP 0@ 8 DP < 0@ 4@ @@p2 (P- P? p 0 @@p2 (0`,W*0PS@ 0PS r01@V t,UU@@ $K,0*S D<( <pL$` r |0000 W0700c00B02p  4000 W0700c00B -- LM 0P ^ KP 0v3 -0PLM 0x -dL @tP H tP 4 tP  ^P08@H -pPLo$`P 0@0P p+R %R0s 0D 00s 0D jP P@ Rd L 0-@LtP 0000 h͉P%T r 8000D p 0D00t-0 CR 0R0 S 00 -l?LM`ϟ`?, 0\1 0  P`1 vz P" ,s ( fsP2@p  ]sP@p  TsP"@p`r ,"/cP 0S U Y T p 0  S2  0S` UT0 PB B U0P/SXQ X X1S X10ST    0&P00S2 s z\ \1S|-\P rP\1p \4 rP\1p 0 P " " W 0S  }0\/S/00LP 0S00@@P2 0S/ PP:ֈP  0S h R o*PL   "*0p  @00\:Ⳉ*  0@Sp "" V ` `At /P02 2`Kp0@s?K\,<@T X,d d1S X /B <0S; =d 0h1 l1 P h1Sh$l1S l [0h1 @0p@ dP  0L`l :R0@dp@X U/lwP t1P0`t1 t!R 0S *0S ʟ0S#d#e0`0S0S*}*`L=P t l:0S/ 90S+9R&Q$90OTS 90S9#*9#*|90S|9 h9 X9>tAT X.g)090SHhtPQ0[S ]0P 0 :SSp`  :0@P00 eK7T01 01 7e_KUoK 0ʩpp70X L@K \'P0b 0ṩP  (R TQ0SoK`1 B 00   0P,ǟ0S' ||` `1s# ` =P(0S (`1@(X0@`1  00L@K00@ 0RP PUTo`1S ?.0`6 0S|6 ;|lP`@'P@PUPp@P\e"P00  0˿@PUPP\AT 50S5\!|"R ğğ$ 0kEğğ$ 0a;ğ$ 0Y:㵆P wPPT %㫆P@8$0E#0=X 壆P0#2ß3#+X40SD4  P p@-P " ]/K%P K0Bt1 t!R  00 S S  ZP PNK K> Dwp1SPKPP 2P "0 S00`ڌ`匸"0@K]/KP 80Bt1 t!R  00S S S  oPP@oPP0 vp1"S V  oPP2| @YPh v@PT #ۅ1PP0S10 z\ ᪈`1s`X! $P Th(80@@h2k:l XȐ@(,d<lJx H.(,83 hP<L$kr Ph,@x,@h|l00  S X d d1S X},|00S0:d 0h1 l1 P h1Shl1S lP0h1 @0 a@ 吷 CP T0dt1 LpǏl B:"b0@Pt d p@X',lPP `P`U"0S 0S  0S#7#8P"0pÏ0S0S*Ot1Sl20S/ 20S+2R&Q$20OTS 20S2#3#(30S(3 <3 L3tQ p+.3qr t1S0S0S 30S 3y30Sh3P Q0P2 2 IP\ C `1s ``'2 P巶\嵶島屶4, 0ReF(K -ML MP70\ ,0 004 ` d$ 4@P (70S04 PL  0 S L$ PH  0SH 6C.K0 BX4 B>K0C B0Ch$ l4 04`:P 04`$t0PT4 H D mP T0 mP  Ɵ0THd$0FpZWT m@PL$R Td$6pGT4/p̓:`Ƀ@@ŃPT/ T-*P0#03V0S& L@ ᲃP@@ᭃPTT*XW T$0S04`~{ pP  P$ 0[S]㉃P P0#03V0S @T 0:S(0p0@T! :p/Pl0U0PU P:S V  R0305P1 :T:WTt`PP PW 0S V @@V 0S /N,P@@@`@,30SD3 0UD4 @t <$  0S#d3 TP1 \3 RR5V*U(4TV 0V04V0S$30S0S U UR"2 t0SU 00D Sp2l 000C00WH2 0BSpRdppU00W0S 00D SW T)T0000p 0"pQ045@404 5dW(TpU-T4$R4$1 4$ @4V`X@4p, P@?d!0SS5V4VP10SP0,S O {1圢ZD4BK c R+# A4Q 84@T S8D 8D1V0   h 0 TR 00S <0YY 0F ,0 SX A(Kh4r HxxضHx p-`2LBM T2R00 0  @P 4020S(2   yy`AK@0@!P蔷10S1013AKAA 0rP%A s10S10x130l1Q K,  @10S040381K $ BK@@!P%00S0  N 04S 0K0 ANK@DP@D0S0$03+3P+PT00S$ " 0 SH[@KpHhH lx| ' 0-PL@Qx000S\P@ TOs勡< 0 000T@0H - 0L0S g0舒 0-PPP0 L@L  \0S 0  0蔒H 0-PPL0S @@P g0 0cS0h~g0舒 --LMP@p0T0`0 P !d0 @ 0 嬿trh0 `}p3l0PSTEKHx4r4 p-DL0 M0 4 0 8 0 }}P$@ 3#3Q0$0 3@T 30S 30S@@S0SP 3r5t30S \3dwr+T3 0S44rP(PP7c008 0 bP@  00 0 $4 NP`B000<24 \80P r}82 0|P 20S 20S Q0S  @T$4 PO 1Qp30S @T $4 pP 0S5 2PA0S81p30S 10S10 110,K , 2KP#00S0  m a_00Snl00SD0  2Kp 4(0Զ8x@<xq|l '| -LM<0 ,0 R0l1 0S 00SS   -K ⤜  ! <P x̟ p Vd̟PX G#0S S A)0<0S $<0SL0P 0O  P00CS; ;qQ ; 1S. 7{ q  1˟ 00CS|;| q^ h   P P@T +{&0˟ 00  ;P {PP3`V ? 0B S@@R@T 4KoKbK aKr/Kq?K (PF ἴ1[![[8[<04,([[ $#, `Q{PP9 0B S@@R@T 9`pGpWq  W:rKqKKoK ^KbK aK.K]?K P t p1S[t1SXx1SU j1[![[8[<04,([[  $#,00 rKqKKoK nKmKKkKjK iK$K(gK,fK0eK4K8cK<^K@bKD<aKH.K]?KH厭P (7=pp1St1Sx1S  [q[Q[ [[[A[a[q 1[![[q[X \Hhq q[1Ll[吡[@!D` dP,xq (⠁[,$<q[ 8T,4 ǟq &< q[., 01(*t$% 0 pNdz@PpXA 00CSL K LaK`1PP L6o.1[![R~[Q}1[S t 6  Ƞ,Ƞ0 4,400S 5@T tu@ş 00 "|!`'U  GP0S)l  [?KP,c!HK` ğt\|ğpd$ SXtPLD!V 0㠔0ğ0S |[?KPl40S S l  [?KP  #l ) [?KP !\C`S KP0_/K|1 3P P h3PU qG[\ \'Ē0S" Ÿ0S000 G[Z_K\ hKH[HK <@@P  h0KPP 8000S S E!0 qx@p@,28  @P` p , 00l40d10@00   @P` p$(< ! DPp0s`00 P+VD000Sl  [?K PU `x@0V0  0 L ! V ,0 S3;(Kh,tȐܶXx8 ,\48DX\HTp@`0. -LM|Ο0 ?`ppΟ00 ϟ>@P00LΟ@P 0 , 00 (8 X` Tp L xPD D0S = 0RS 0S  R00-S 8> m0S> m=0S D0S  `= 04 S< 0@ D00S0H0 0 PMY0SMP00<0S<,80S8'<=P`P0=`*0<0  8 R|axPQ 00|SM cP>0S 0 S ( `<8< /A!@P000T  T =T/00P;0S0 S8P;0S 0 S \;0S  0S DQ,;0S  ;;0S j:P 9P.D0S :0 PcPU   PP| ]0 00S `V%(wPL:,0 :`) 00|S o@ i, ,0S  ,*P0S00:P9 Id, ,0S9t 40 90S,0,,KP0S;0 `i0 SPIة勯P0P0( P0: S 0)0S00 9  X80S O0CSL8H0S 80S,0,,\80Q (`40 S8P x8P00pxP0JSP0S,0,v,' p@0 S YPdU<W0/S' g0S 70S0S#J&0XKPo@0X0 T@ 0XKS#0S*X0S000.,f6 ,`PYPPv000 D 60S3 60S 60S+6R&Q$50OTS 60S86#$6#50S6 5 5V ` V kg%0@U{ Yrt\u0E 0S , *ePP@",Sp50S,00#30#,p3P 00 P@T@, eP0S @f040PS4`P4` 40,X TL00L0 Q N0SH#t喙X0K 0OX0 T@ #0S #0S @#0S 0XKS#0S*0@0 P@H0S 0S,00#3 ,IPP)0S, , 2T t T 0S,,"0@R刂尢`p0p@`20S000@0P ,20S,00@,P  L0S BL jj10S. 10S <10S&XK0S0S *h10S1#p1#410SP1 <1 ,1ۘ00S000#3 0PP 0 S j. 0@00S3,00#32h(, ,8lHprt,H4ԶD@p84k Pl|\<xPXt@,lPP @kj \m40PSl0`Pt0`40,<8@0S@ 0w0RnD0Sk RQg10S` 4 (1R\ pP V ^0` P0`K\0 pKt1PK@PH7 0i?@0 S1P 1P@ fc10S1<  #Q01@P@@40S ,0S40,00S0cwH"0S0S<481(K -4LM0P,0 l4pP` _OKT~ z@4|  U?Kx t pQ 取p!LPKWtP RtP#LK 0HtP#LK P0L0[S LK_/KU?KkP p / ld3 T1P`Q,,84,#,3TQ(SK ET10S  < P,0S2 i`P( P[0S* 0S 0S  <PD,q<@@< @`PUV1 T [\q 0TX1 @[V/KTA PB0S P  >KhPhdrw\A\mw0LQS P8^ 00S 00 hLPPLvP Hv W?K\ ,4p0X0  ,0 Sl5(KhX:l<xȐ 4X@`\ pHL\ -,0ML  0Lh5$tHp 0-LPn10S 0P 00SY(@Eu00@P;K000 t00S h0P \00S6(D@"u00$0 (0  LP0<Ht -L"&X -AMLMP64 H&H6H D&D6, ါ4&P 0S606+ 66PP6vP5eP5P55P5PPZ@P 0S rPP rP rPP ~rPPPlJh5htrP,5  P/L%P 0S450T0S 50@T ,@@P 0S PrP KrP Fr@p@3@40S'4PD4  40S4p4q'PB^KPEXt\D\PPE`TfP3  g\F E\@ 6\1 4\+A\/ C\a\/ P\f V\~c0LS~~o\E k\, i\u%m\6 n\p6s\n p\F r\hLt\\ v\c]  @3 ]"00"P$3 2 "0G|2 1 Pb0$2R0<P2 ,2 `0S`0p/ qp3|2P00$1 1 11 Pb0$ 2R  Y"00 `1A4 !p\1P1 14 1e14 P qPΡP BNK@D@D+\1@L44S 1@P 4 P3 ,0 SG3(Kh4hXжXDPܶLLyT\$t\Jtx(LTtHض(lHh@- @@00S0T0Sxxpl`P QR0ҷ0δ 0\0R0SQ  \<| p-0LlM`K  0$SP$$S \S0 0\@Q K1PL!l00l00S T K1$HS 0S Q 0S0K!0l0#00[Q \Q $Q~0S0 0$SO @K10B00B SG0R 0 CQ 0Ll0ST H$ 00BQ >\R( $R"00A S0Q0  CQ 010AK!l0SH$  00BQ T   @R@,RR ]RR @\S0S0S ]S012e<0,S ]S& L 00B S0R0  CQ 010B@K!l0SH$ 00BQ QP< 0S`0S0S2Kp|<$xH -L@Pt00}S h00S`0`dTP40 @0R80 P$0  dxl&p 0-@PL0S 0@0PWr 0  0<Ht -Lt0t0S 00CS0 0  0  0Œ0  눹xT -AMLM! P, 84 0P0044 @0P04 1  \ Zp8 10S) 10 R`1BK0L`Lr 0 r 0 R0 @R 00S" /04 44R Q00s384t 0@Y 3T00S  ,0 S00(Kh$ ` -AMLML1@ @1BK81@@ @@, 0$ 8 4$ P  V< B^KPEp`䐟䠟䀟PE0S0 0S P c 0CKS 0 0A 4D ,t0@ P@P<% 0, 0R0@8|0(KhPTpxl- 0 @ 0^ 0ꀒp 0-0P0@@ TLP Q0T 0S`0hTL 0S <`0\P 0@0P0Զ  Pp-LP$A /cQ!a)c P0P*cP@ ʼ0 c mP @0S0 c 0 p R 0S ph P <h~0D 0@ 0pxJ L$H Զ 00 -0LMK   0 0  K -LMd0@0\S0"H Kfp 1[4 SP00 0P @K船xht@ -3LM 30 ,0 K" `Q0=iBb@B mB@Pႄ 2呉 0zŸ 0j+PtR@ P@ݾ 0zSVW@" <"<2Q0P$$R@R@  0^0!Kdp0SK 1WXVV  0}POژ1QK1 @PUETBP@P᏾ 0, 0' 0\`}pK;KP@Ꭸ<`ከ<lPEd@d0 婥00S0P "P@K UP ,0 ST.(KhP.A@?JdS(,@t0A|,x -$7LM0pD ,0  G&6&K60S 6`V66 < 8"  d <2d 8B 0!੷|&D D?~dSpdpRq@ P 8]06$60S6PU ᠪ P@ş` @Pşş!`@`0K%0 p0K%0 50``VdէOKPxxşXşea0\%pL _K`%5;FEpP`V0U0WXOKP$0 \ Ba$@PȤt4 b0h$^8B0=ɌBJB ͌BS00` EB?T * 9 9P@@Z Thh$tT(J<D,qhldT\@, -L+ 0;'H -GML1M a |!@0P$4 X!Ep oP9 4!<p 0bSQ`A~K pG0pG4 P3 $$004 4 =K 0C0C P"zP -P P pWZ0$t A.Kh0 B B\T0$8M' ,Ih,((`(L -LM@pP4  PP 0S nS6 =d`P00QD @ Q? uNP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00,K   0   S _2 0   v>  0   SJ2 0   v>  0   hS`S(KoցLp`(KXJH\hLt0X, -LMA0S  嵁)K0P ` @00S p00 00P9@T00P0l@叁l00S0@ c@ 00z4PU2 2040w1 @441a 1P40Se@ 4?40S p1 40 0S00`400K r410SS 1 0R00,0 0 0/0K000KC<2K0S00040 00S2 W("(04"40ࣰ40,@c [@04 48#8x0K 4 <0` 4040@  0 S8%KhP4`L < 0-PL0 <0(00AT 0@L@00, 00000040 000hP84 M-Lt0 RR R RPDKh10@ 00 00KhKP p-PL@0S ,0` 00phꌔ(0z8@00 0 00 04`phP84 -1LM0P P 0P00Q 0S@0~ 0P 00 000|0}00 0 0 H0 0@ c 00dhrP  4 -L]@1p0PW@p "UPUaW0P 00i41PSЀ0p = 00000}=00 0 ', 00ip`@00 00 00 04P <0(0iP48 M-LM1P!1QPja10+1S|Kh/0 S@H` RCPG @T0P`PKh0pS,00,00_΁ 0 P0@ 0 P P 0000`  R`  0S`L00UKh54KhKPH<`Tl4  M-LM100SS S Sl0>PKhA0e0@Pl10 P0 0S100 0;S<000@2S t0?0000@2S f 0S  B!  0  0000 0S100 0000 0S100 00 00 0S1 0KhTKPl4 -0L L2$tH -4LM @ 91`ltlPlP cP dPqP` uP 0$$P0$0 4#p3P0eS\㻍CPN 峍3PF 嫍3P> \0S0x0t#pl. Vd3  \C*PTA os000`0(3C, PXPPPU  \L0˸z00PUŜʴHb\r@0Ph.T0 U\JLX ?L2pD8 <"`P4 4KPp$ 044LA02" "pP uC1P 2 Ap (0K* # 墯pt l嘯pd `pX  ჱp@  p,  %pz l@'▱0T0S P0 002(K$t(8 $0LP,`(<4XH$ 0,<PXTlpXJ4,,?@ -@3LM0,0 @~KpG pG+ p@P`0S P( K0U~8[S}8[ 0CS񟗠h2 05R P PXBu T0@0 P@<@ @@K0PwR00S 0Pf0` P@ 0zPUPUDl1 05RK PEL10SA 0Y8A)<a P5R60A 0T 0CS00S* +T0T0S# 0 000S0 05R@7Xu 0@0K @K@\ \0| ,0 SD(Kh4LLP\0@lTlhL -0LM0尀p$0 P8`KP ネ@P9 (00 00@ ,P ;P <q  $0 S k Kh`(\ -LMP,K  P P pP00I ,`@0>pP @ T  Tt7 a @ X,L,   ,P ;P (" L, -LM@$PKpA A?@0CS`h A@AQ 0#$QV) :P`R :Pd0P`H $P& R`8 `0Pp -CML M4`CK0@X @,0 " \4@P P0pP4DT,p1@TP p WEC.K B@@0KK B0LD `$ IP Jd4 L$AQ XQ IQ8 BQhLQF SQTlQA bQ^ fQjsQJ tQ`4+hV  #PDT᧒@0 S Z `4 s P$ y@KnP @ d@ TD n`4]e  h"@P \5D 0   $2@PD 0v  } !@PD 0g  n 1@P Pژ!pP  \$  ;TI DTp=P \=P  0 <=P ,=P\4  H4K b T$ T$ T4Q> 0 T$0AS,P4 ;P~P4Q`ịX$P@n CKAA ҐX4p ,0 SX(Kh,t <PhTpxt 0-LMP@K  @@PR('T(d(d(d(d(d(d((d(d(d(d(d(d(d(d('$(4(D('d(d(d(',00,07K 0P-00@JSP( R "oP8u8(8$88 880c8@. XK ;P % O8L@ -LM@w {P  $Km7pP .,0 0 , / 0s$Km }S \N d10S$KmH10` @P00 00A P X0 0  @TZP  00 p%0`@T 0 S 0  P 00 0 0 000p$K`xLP4 0-LP  @@%P񟗧x,-----------+,,,- --------+---8-P-h-+$,L,--,<20h$Bp 0 1Axpy 0 1Anpo 0 1Adpe 0 1(010h/l1@<:PA, 0h$1  10hY00000x0@Zp000h0h0h=@ 5 ;P 0h 0`L  0-LM@PK 0P 0QP {P `  80s4 8}S 8L` 0-t@L d>@P XP0s S 0  V0h4T0$  -qL1 < 0C  0 0K/0C ` 0` P0CP 0D!0C L0 ,00 00000 0<  0< P 0 ,00` 000 00 000 00=@P 7p q^S 0p3 ` 0 \J0d 000d p-0L$M0` 0 pPp <@K ̉ Pa Dቢp@,@ 0 SKph0i  -,1LLM0` 0 pPT @@K ᝉ !a ZpC 3[A0ASp0HQh@K( ᄉ a xAp 0H0 P0   0 S dKhHi \L6i( p-0L$M0P 0 ^p@ <`K G ` pP "[A0AS 0 h2KpPc_[ 0 SKphHi i  0-1LLM0:PK(K0 p@P@aHE@  L00L0EP H0S L0StP 0P0 $00 PKH0K  P_ 0 SK0hL| -LM K*?Pv @p+0`V&POP  0S 05 000` 0D0S 㘇PP\N  `0DP@T,0D0S > R >L -LMQ刁a刡8Kp0Sx' 0T R X@TP0S@ 9 0R0pp0c!S0/0S (0s0 (0 80  00 2K3K-p 0#S 0S 3[ R T0S (0s2[ 0S 0S pL\Jd4  <4\ -LMPaphp!p(o3 -0L0 S 00CS00Ӥ0-M M \00! P 0 000p0 T0 p LPQ(0  B000船tb -LMlllC`Ppp 0  0#Pp P "P 3@P2pPpp UP\P P "P @ T 2嘂7\00A S-Q5`"d2PX"@HTpPpc0%xP00S P0p 000D1 T1 @ TGA1ā  !0^\JqH t0 00A \!`1PT!xTp Pp@B"0 -P_P p 000 w0 T0  p 000D @ T@" 0弛PT0 PL0pd0 00i\4@`p !! !M` " -錠0LSt`tP 0lpl@ 0\P0 H0  0 0X,0000p x -L@\ pp00S`0 \0 X0 T0 0000 (0 T(0 00tx p -PQ@`Lp e a ]0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0Pb x| pt -L@`P%R0pmS^=0L ۀp  PF"``@PV Ą`FP R @ -p-L~`0"K RQ 0~0"K 1KE000K0L -!0L4!4M K 0a2 -!0L4!4M K 0a$ -,<4(L"4!<M K 0! -,<4(L"4!<M K 0! -LMK 0[#@ -LMK 0[#  -LMK ߁ < 8#"  -LMK ρ < 8#"  -L@-Q  TpP 00S0xS @  @`00C S @0`SW C @S7 C/S0 C X R 0@0&&SX E0022VT T X X  X X U U U0f0fifi1U U U `!ii/$i11Jt2<2h22 -LMRQP`00  p,KWp 600P` ]\ Q 0P ZBQ@@,A W(K22 - LM  .0 0-LP@}PT (@T0{P@ ;PT00 P0hp0 -L M@,K h2PP``,z+ Pp@/,q+42Pv@ H/PPI P`.,\+ /PP8 PP1,K+4 Pp c;W&,>+0 :PPh P` LO;V,*+p :PP  PP ;;U/ ,+P ;P .X! Y 0R100#0E HRcDf0,05( 0@ 0 5 -L 0LR RP 0R =5 |00-PPp0Ll PdP\izp@ L&DH0P 0(>,0ᆱ556 -DL@ P(0( 00000 S蘹 0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@0 0z00訔Дܔ 0-DP@L0000@@0 0 0 0 -`LwpPe=z0 SPfu% ࠟ0S @ 9.PL=00000 ea`PV p 0@4=\Iq@P`0 @0O26(6@61 P-L`h 1 @0Q0S 1 00N,P<\DX` Q0DQD0 Q@L00upP<00CS04@0T0, )0@0CSp0@0A0@p00 PP <\, 0O00(6Д2ܔX6G-鄠儐Pp0 0S0 0 BS00R \P@`A-D0D@00  R P  p-P@0|`00t0L@l0@d0@`0@p0@0CS0 @@00 ph%pДܔ -1q00SL-P`0L00t P<000CS0#@00 0@0CS 0`@0w0(000   Д2ܔ -LMP@0 2>PB ,K @@P vhhhrhb`"PYm 0 P40S0`00*P, 000S SPp P=P aP =PTAZ,KPPU 1 ,0Q.0 Q@L00Mt P;H00CS0<0A004 Z100CS@ 0@00H,  z@p0P@ d P P \0P 00S Pp(KVДp6662ܔ -LMP0@ T T3pP- 弐0帠S0@0+@P`P 0S  0  0dp3PPP0T@6-0 CR 0R0 Sm00 -@0LP` r PeX`Z !`0Vh2`c0SUJ L0SF I0S\\@U`T t<P 0\!Sb/*0S@(0@00US80800US00`zUPX*X00S\ l L  U 0@^S00\P0S船666 -LLrLLL`~@0S 00CS00PӤ0??PuG  Q/0 Q@L00r P :00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 WPP 90S0`00(` 0S0`00(V @V00 00 0 <0 `船Д2ܔ66 -3LM, 0 0 S@`TA9P, `3@, P00T$0S p>0`>PrP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PH==QP>P0 nR pR lR 0P0P00PP d<  Q <0Sw <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P( %P]PP0S!SH  M@0S, 0S @P ; ::;0SZ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S  ? T9`V 9sP`GTPPgTPWVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TT#70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P| $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5'@5ZPG 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S< h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S:P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P5q 0000 10S1  1 g@P! P0 nR pR lR:0P0P020Pdh88̔$|QH8t(@886Дܔ 85l87pX9,8xX8ؔlP 00  Q X00S* 0S0!S T=0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 ;1@sTP000`00V FvV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0LB0y0D ART P ^ 3 @ #00CS0,C0[0VPP=PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S  444 |g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S+P0 nR pR lR 0P0P00PP $6  Q PSQpqW QWPd6 Pt60 r 6000}`P7 60S6 R6 6  68P%0 nR pR lR 0P0P00PP \7  Q 0S0!S ;0S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010CS  [H1@s rP00 0 nR pR lR 0000P x9  Q |9)00Q0 mP0 nR pR lR 0P0P00PQ $:  Q D:P 0S4:\:Mh:0St PCP0 nR pR lR 0P0P00PQ :  Q \;;K;0S( 0; 8; P P;  PPp P -LxM  b5 8hPڠ0000SrSd5deddddudU@sP xP pP00 @ 0 5$¶p0 10 00b0 0S 000-S 0@S@ʠ000 00C0 [O|TP@K⫛P0: S  0000@OP*| '|$|!|{@P @7-#000S 000S 06P 0qPX30S 000!S 0 L90S 8f000S  20SsRcT0S C䒟䢟"P FLPB-"0S& <"0S"p5820S  p2Rlh2 0LP20SH"0`008"0@0<"000 S 10S!@0`00@00@P @P  @Pt t t$ @!00,00S  1R 1 00 S h00Sc 0R0 0V9xԔؔ9Ht(49ܖt<9@9L97̔$|QP9Jh9p60^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P t0 S\`0S S,140 pcQ0A0 QP\00^P%00CS0-P010% 0P0CS0@00\@DP e H0 0`S  0o 99LДP2ܔ p- L P p P 000 S S@0S pk`Pp0P 00S% _|0P@P%pep\0P@P P型P 8 80儐YPpp6T92$' -L Mğs@, 0 40 0&S903` 0hQ0 QP\00] P{ 00CP|S 0l#0wX0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00] P5 0l0CPdS 0T"01@0,  2 0P0@ 0S0!`V&0 VP\00[] P$00CS080t0CPlS 0 \!0H0_01 00@ 0 0c SC R/`p0 RP\00!] PT$i00CS0@00 .0P0CS 0PP00(0 00@(KДܔ2 -LM  @$" (2 P  Ld0S  0@_K  0 B oP$" b  ," (2S  S ;#rPU0 U@L00\ P; 0ß0CS@ 0 h0MT#00ß0S 0E ,c K 0P 8"RpW$0 W@L00p\ P#00CS0U0pŸ0CS@ 0 X0 D"0u Ÿ0S 0 bK`0S 2S ,\    ?KҪPk  "向0pf 0 Q2 /hQ`0 Q@L00\ PL#<a00CS0AA009 &60@0CS 0@00W "1 $ 6p00S 0T@ {b HubQ"(KДܔ29 -L M0P䑟0C0 4 , 0Q000 400pP^A SPX|0`00pP\`P UDA  LPP!00CS0:A0,02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(KДܔ 8 -L0  0%Su0 SqB 0Sr  Q.0 QP\00[ PH"]0@CT@xR00 "0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 5tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00ZpP!00CS0#@0A0 0P0CSp0XP0.0$ H0@0082ܔД -@p@@0LP` U0@ P0 R00R00 10BS k1@s @@ gR0000,8 -`吀L p Q0@P @UT00Cs0,0 (0000 0`Xdh -2LM0s22080  20s1xB0Sl2  /`"0X0 @0A0 S6$DD 000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L 1   @Bp4`K07# @D0 0C0n##0 C0?^NPnʬ00S>t0x@C d0 \0T800@ \P00 m(Kdh :`ДXܔ -PpL0` Sd 0 )Y@P 0 P 0 5$q 0 5$k0 % 00D (YT@@\`X20# RR R 0 PP PRP -/L@[P  0 ST @T 0/S 0/S @T  -L|M $呹P  ) PPP3 30CSXt0tt0tt00SB 80Se 0$ p0/S0`c04@ 0T/S/000h0 S" Ѳ  PPc0S ᴴ(K@A 廲00 嵲  p00TKp4 3ST D0 Sp * R2 0: S  R, T Rw  RV QP  0S. O@dp !P$  $ p3Sj D00* RX2 RL2 R` 0Sg ;PS!$ 0 pf0: SF1 Rc0S? D0僜: R5  R+  R1 R q3&P) 0S lD%D 0: S  00  1 R q3-P -@ q3BPv  ͳ00 0: S 00xT yL p DNPTDi flt(:ly@L::t:y -LM@Pԓ0R0 1 p0#p5 H0@*S*,,,,,,,,,,,,,,,,,,,,,,,,,,,,p,,,,,,`,P"巭p2`@fT"0Sa 0S !001p2`Dx2xBQ+ 1 P*^PDd 0 0!KpPw0SkVu8  *!00}1 y F1 1 q1 1j00g0p 1 b p ! ] p ! X0S 1SX0 0S0S 10 BK⨔1: S0S BK[. 0 . B0 )kp 0S ph \c P 0: SJ:t: ;@P; 0-,@,PL(  ;H$td;; -0 L8咆P30S t; p-0@L :#:0$ ?RP@3c0(  ,0c?B3c 0yP`[U  PP0U* PP*0U0. LPP.p ;PP0 0S `0U<0zPP r0U`0dLzPP 0-SL0S 8([`p$U`Mbt;;<; Q-L@ hPT PD0P4(4h[,t<< Q-L@ dPP9zPD0P4(h6t(<< -LMMpA^K PE0PE`@ 0 wp% 0K T04B0P0P 0RK`oP XLHD,ht<D<4<: -LM0S  @T  tpp D Q ! GD0S>4 R, D$0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV ut`v`Ꮟ{0S 1 ,`t`v BKOPP$1:( SPPf@P0?8 0 x ᫏. 婚p  0T00(F@PU 2 WP/0xp8 t  00 dP0?PX 5P;0075\+I) P 3H( 5.:㹆5 'E@x 00.S.0<0K`8@8 @ g b0)0@8 0|%00Fd%BX%000.P P0(! 5Ptp@M5@XNP 4@0H(R 40TS4T 0HST 00 RÄŞ$0s 400s030 㙯P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S30C S;hhp30S٨ 㫪0S.P@  <KP ^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0Sxt< -0L0St -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #t 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P- $P Q < ^018 ,<8  Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$PphpTELE0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 QP-Lp@T $PUQ (\N ,0SK 0,! `P 4P $ 0(P0,  OLS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Xl0 $0 #4N4$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b N (0,00 0e0`U`1`!  NPU 4e N(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  C @0P P 00( 4UbdN(0,0e \N,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗓1/΅T 0 l@L0T l0p` 0P< Hl0X P00X0` 0  0pd P0< 0 `6 03T030CL01 P0 Z , 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ D% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R004 hD Rp @D0 bSH @c 0 bR a(00b@40bRD@0 Q !0a@0 aD H 0 R0@0HSH 0= DQC @0H AD 00H 10S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f z8 QS@00<`P  \ 00R40 <P<  < <(K@I=$=<G-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍEE`D"D K 0`F;>Cz -0L R0 R P0 |P0 |@||0S*X@` @PQT0D0L 0S 4$tHKsKKL -L M0@SK:P K0 R 0yHL 0-L M0@SPK0<P K0a R U0xyXL -L4MP@<'匧0儇oS000 `gR   0P` mS000 @fR  pT` H` 'Gp= H0@0S0 p6!  p0p0t@\E\%0\Q) p0! @p0t@(%(5\%R 00OQ  44\%R 004OQ  D08 v+P` wFp6 Sp4^  & |6 00P @@b b3a R`QR|6VFU 4@^  850L 0 0 0@4;D$+4 0@01 0( R  0 OK,CHß00 0PSc,C3 L00 R  C 0L0 R"0 0\2^ pF1 0p & l&R0 0@S1 pC d!`2 R TV0 0fK A ?p6 S1^t  & 6 00P @@b b3a R`QR6VFU1@^  850L 0 p1 0( 0Ox6 tF 0 h04h000O    p l& 1 0(p6! (0 h04Ch000OQ  p 1 0( p!1 0( ( |& pF1 0( 0O6 F gP*P z & h]TLC,C8C -LP`"D0pS000000 `S8#80 @0c 0 K)0p0 B 0-P L@ 1?P 0 00 0)0 00 -L@Ah30,qSP: !0S2 0 !: S0Q  @ fΫ0S V&0S P*P 0 RG*PA0S 00f0hd0 PHh ㄎ4r LHCLC\CCC|@CtC -LM\%EnK`F `F 0,            d$ `$ h P0: S4X@. 4ДP4 R 0$\Qp  00p 0S#Pm)P t0S!` 0pL4 P4T4 0$KHt 6 @D40 0S   带, 0R(Ki0: SP+ )P 3 pP@{ 3 O@t M|#004KT$ Ht 5(A-(37&(0S  00̢g0S20S BKNN"1A\0A 2 0!00c000l\#0 0@Pb%H84p!0S" 2 WPk 1 PN 1 R] Za`'0X0C0W )PI  h4s `!000'000,)hp \h'0000S 5$BKNN+4K@T 00C0 , 0 S hHCLCTC|qC D@DxDC̜DCCLDCDDL -MLMp0P@AnK 0 `F9`F  0'U0 U| 0RK2@(P 0D: S40P ( hDHCLDL  -X2LM (40p  h, ;;S  0SSYPPV 0SJ, Y, P` ,,0+@+PU`RP ` YV4 P,$/+0;;0b\c/00S@\,0 @ ( @,0 T0000 00S0SU$0S xu( @,0 TP0PPP4@ 0,0P<  ,0~E -LM⸑40Qp,0 [0P (0 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 0,P  K??K0P  },0@ hK?0 0 0< 0SP0SPhLE 0  ` p-d`L0S TPT 0@1@P40S44000p| -@LP400, -LM@ 0@L Z%00CSlllll%,%00%00,PLE -X0L@=H0 P 0S P 0S |dE -R00L(MQp h0b43X^u  0LQ OTUi H 8\J0@O /00@@D @ /T<9 H 0Po 0L0O<0 8@ H, 0H< 00 8<  5ɯ @0O 0 @T40 0@ 30 ,0O$!D@K0@P U`] S1 R(K  0@OP`0 @踧P SWSH@DPK`0PO` 0 @VU1 R 0 40咧<0O\%t1R H 0 RBNKL@D@D08!4410SP8   HH<0  r 3Li!P 0\Q H8! 0@H0 00H"ؽ0 0S @0 @lHPH08(ALD hi,TpGGGPG@M -LM$0|S 0, $0000`6 \6\Q 00 @8F0P: S S\ S6^K 0(ŕ /R \5^E  0 RKAA` ,`8($R>Kh d 0 T5 PE 0BO`E?DE Ih\ X T8 4 @E Kh d lBNK @D@D0$P_"2\%R 0 L5O0@唜2 O @E(0/"08 t2( l2\Pk 0 TuP21COpW<2PoP `H% / D5 0  R+ 1PX0OD0 H 0h!H5DE0@H5 SDE t0w O\&.x1P`pWPX0 S R40S00X 0 BNK @D@D0 -k!P 0Wh0SN?hd%T P%  0\Q 00S@0@pl0 %0 L5O0 @W<00S@0 @hTpGGGM 0- L8M00 < L0 H0 D0 @0 80 40 ,0 (0 $0 0 0 KP0 LK@4p0 l0\Q \,6ubH  0@K0 6T -Lp@PST$ @0S 卛 0`@P``0 0\Q ,6%00i2rP 0p : S`0P T @ 60S GTGHCL -LLMDH RS, @ ȟ 0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R \h0@S 0S 0S 0S YD 80 | | O   Q ?KP``F0`_K`P`P`B2 MP`K 0D2/R 0O? 0@l& @Ācp 0D 0H|B K2@şU0S %0 0C@0S@Q 0Mx5 R E0,P/OQ o 5 pPş@@_@P004@34 %8P|o% "2"_K`PU`P@`P`D0`ğ0S Ğx4@T 彞@T 㜁|T0S8 p岞@T \嬞@T ㋁*#0S4u0Dp i00Dp ~i00, 0R(K " (?Kp x t +sPS3P@@@@0S3 R2 (ß 0S. p, R*@0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʬrD"0PBS400q0, R|b tb@ 10*Ÿ@ ,0SDR@*@ *@0L** 2*!0S pA0S 0Sd0S兙Px KiPf 0S7 X;J3|=tmlj7 0SbXd 0S`D^]<[N @04@0 0S ⿝PE!川?< 嬝[hI(IQQJ RDJtJH(,d|tJ H|JlIIILIHHQJHRM p-L@M P`K0S 0S  xG -Lb@P%00"p~ N0@+S+ؙؙؙؙؙؙؙؙؙؙԚؙؙؙؙؙؙؙؙ\Hؙ<ؙؙؙؙؙؙؙؙؙؙؙؙؙؙؙԚ1h!0001m 0>0!Sd 00!000|1 c 0|t1Pd<@1 T 0bqD1  80!000 1!0000z0p"IP`g I0 RIV 1P@@ 0T0PlH\lR$t\R(dH(R R.#P 0@ 0. 00X000 0@P`Z  P 00X000  0!0@0@Q 1 R= × / -P1 `XQ 00D1 R R 0S0S R0S 0S0 0S P -PP8<| 0ip 0@0@QL] P[t\O8 KJd$KK@JPU0J -xLlM,0SPڼ0@Pt@ pP D 8OtP0, @tPK`P`RtP p` 8ڼ0p/t@ 00T 0 PoPpǏ`pT 0/ X|P`1> 0P@`UVW4HTLd@0pǏpX30 -=@PmP -0000-m  ,0 `0 , K\0 X0 T0 L0 H0 D0 @0 <0 80 40 00 , Rg|@ xP |0 l 4-x|0 O*| Ql0`  0ǏOP`L 0<\%R  l0SN < RJ ,< R\00S 0C1 0R' sR"QX,|@0A@ @,@0\0  |P,0 @|PK`P`Q|P x` k00H(Kp P`0@0@0A@D`ePT@ [`|0V ` *`Pa `  H;@ P0@` S0 @ `+ h d *Y [J`0\0ZE:Q :Q 000hK@ h d R0d@SlZ,j00 R:Y l@QA:$Z@c0T@? Q Q%T*pP RL:)@00pdSt)00PO/ 0\ux9@W 0T P9W 45S:  Zu I0S Z 9W 0 0BO?BQ6p3@P2 Z Z@ Z6 T1!(0p  P P0S  \X8W00S0S @8 R (80W 1100(p @8 R 7W 0ҙ  00UP@; Xg@ 0|'\Q ,0+ s(L7W_ 0S0s,7 R 7WV  垙(0 ,PN  hPV 0&\Q ,T0P&O?@0\u`6@W807pd` ,PP ,P0S 00 U0x R ! :S5WX v,P0S 0005S: P UD5\uW (uU` 00%@0T0%0 0d + DPt@P\.PPU^1!X0   0 S PUKX4W00S0S @4 R (4`W1100X < /%O( / F3W  (Ř Q \3W+  0 0 0@1>@ T DR @Ӝt0 BR @P  0@" 000S00S Z 00 *60"2@P00`KD ~H"0 404h20 \ő\h0O0/S 82$B\h 0 l , 0S X Q!0\Q00h0 00O0@Q pq'nPw1W}0 0@#1?@|W1> 0P@`UV& d 0`\%R\ 40O0@10X 9P0 c*P 0\Q<  0 < 0SR +00 ]t,@hܛTU TxRK@LGK$8K,TKR80S|KRKK@J4SLS 0 40O0 @\=P$ Mp U)P 00 00T+h0SV g P  [ ㊳ U ㄳ -80LM, 0,   )P@|S -1L8M11!00, P ,0K` \ X T L H D @ < 8 4 0 , R"ڸ0 @Sp`T`@ PP D@ o0`KS . @0S,  R00(KDܛPH -80LM, 0,   )PHS -LM(`X0,0 90䠟p,0  @,0P0T,0 0T @T 0S0S| 0T0`0T R 0R X 0@P`0,0 ,Dd\O@-0 0 0S@TTS -MLM0,0 00CSr,$pع$|b xPqlP} 0:0090 006 $6庈FKL0%ş Z%@%0㴕X$ 44K%50h d i0`00 0S_ S;;SV~KpG,(L%0H%\Q@5(K05$( Kɠ0%\Q 0@X5 TE  R01 0#SP $0$\Q 0(0 0p0t@  R01 0# SP R P\\$0\Q0X000@\0FKL4  AH$ Z#0P0#3Z 0@00 R 0S 0R s S{ #PMPPZ<ß40@1`8#0T0 *PP 0S P0P0@V$Ÿ, 0R(K< 0PQŸ"0\Q6 0@0 @C 0@`5 \E [BNK @D@D0` \2 R@ LB 0̠DD1 0S@ 0?044 0 R P!0\Q 0@0@ !3dP {0P00u00C0  }ZXt HA 0̠T@ 0S <寐Z(g $ P !P W PIM  e70P0CZ0:Pu墰hL@DLxLܻPܛ<T0MLS4DC@MSCLL|LXLpL@JK M -LM$$ @0 @8'PLPS -LM44 0, @%'Ph,LPT -LM0 pPR0,0 `'@TM,04 KK,.1K-K0-A[Sh00@PUnʅT6(K MK@B+P 0 RH0S|, 0Ry(KQ0.S 0 0T&000QP8&94PU 0 0PT lP 0S ^00P0  0 R0,-1KP0KKl.1K4 P-1[0 00R000 P8#8D c(K 00  0 30 0C0(K &(K@@@T0ZP00 0 Pv 00C0q00S0SX$ T4 RH4 R<$OPPv @0: S00S00000CS񟗄(TTd3(KPMK f*00@e 0 00C0 =&@P0 0 R%Q 0.S PPP! 00S00@0S "H0X0P00C000SP"3P0S 00Sڒ^K PEPE0RNK@D @D00!1 R 嫎V bPdP 0 x0  P,@0S <,P!00o嘮 t0(K MK)XdP 8uP  00hMHLNN\MxMNNNONNN8T,OMMM0MHNtN(MN -|!|01@phh1PL08X0S5 0pGS.000PP 0S0S `P @ 0 R@ P`P 0S P 0pGS00h 00000C00P0@00ܛtT -LM$$ @0 @$PTDT -LM(p`W0,0 C0,0  P0,0 "1> R*A R P) R 0S0S@00T pW 0@P`0:0 @   0@pW,Qt -h2L8M```"P0 0, ,0K` \ X T L H D @ < 8 4 0 ,0S{ڸr a0S:ڐPTD@ 00CS54t00`K  P0S@0\!\QA  000S. `K$d P0S,0S3ڸ `K NQ R Q0S R`Kx 5A`KP 00 0S 00(Kܛ@CTXO,OLO -LM$$ @0 @#PxX`T -MLM pTO0 KPK(J8!J,0 HK 4Q#> R K0(K8!Lqt QF ;hK8aXQK0 ŢK8$UU`~UUL~K8Q$HK8AQ`PHK8A`0\3  BB00B"1hK18a0 000S]0S  xK8$PQP`ӼhK8a`0^3  BaK80@%0 B 0HK0B!8A!L0   XK0H͟ (K8! LqHK8A0XK  Ba 0p@WHKATd7  R\0?00 10  B\ hK a Vʜ (K8!$5S.p`l h0Vp0&P P U 8K81$%U  1P01p`0SVU HK8A$%U  101$0XKXQO0@0@0KOX0@0 @P`(K,!  /  0`O0@K8L#P !P8K01S XK8QHK4  De[%0 0K8K,,KL0` P@`R`ZK8``L5HKsKD!8KP%81X?^ !PTD, 0RM(KK$\^K8 K8!Pp(KP `p$41> 0R#4  R`0?00 1HK08Ap80P@`PW8 W#$0#0$0QK`08800cPKϊ/.Q00b\KK8T!0K880O8K 1 SHK$ATXKQ`XKa0XK008Q$%RK80#l 0 0 08S8K>C`(K8!8KK 4L! P2 RQXK4Q 2Q\01\XK4QHK4A\0KH! P KP8 P K41 XKR(K4!\0t1 daR\0H! 0 0hK4ax0 R0R0 "KP P 0 0hK@aVK4p 0Q\0?0`0RXK4QHK\04A0?00SF P!hTT8CT\ ܛ`|QTpOtUTUxUC0, ,0 ,0 R R2"!5(K00@ S,", P 00C 4,  Q0 0C#4 4 404P8080 00,4 徐`Bⴐ00(m|, g8<0 0@@,@@8@଀@D ?U4RP%402,P$e<@ @ @ T 00S  0D0 00<D40A@40 0:, %0I ! Z 0,d 0S d V`0P3  B  B00B11@ 0008ST0  000( ,0 R eDMUQdp P-L@ 00 R$hn喉Q6 - 6LM , RvfFXS$3S Pu 0ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),`y ?.t$0ttS} \%h4R& 0O044D $0O84 R  0S> N娇0S \ϟP>.`@P00`` `` `` @/ O ;0_Ss Pq nP(0..<0000P@n = R0  TIM0S T^m 84Q ,h\`žP &R^Pb F06 00`pW V p0OO  Q^Pa `0O?0@@ c@P)5P f0, 5P 0%?>T 0 5U  p5PXE T5P k|ş 5  05,5  z+Wh4 H]!   , 0R(Kx0Sß@T" 0!ßP@C0SI gFD+P, $(`SOL3-K B BGP [P S@Td 002P c\54 S0 `5S|@>xE X娄2OLß<0ង,,o%P cS  0<0 iVfV$:RFTS8*061 Rb BR0 0 0a1 R lp"0 0 0L1 R 8B ,<K0K404Q5Q@ R*0 4~V@ ` P0@_4 0K@P k4 <0K0@ h)0@@ T (Koc(K4<Kt <Kop|pWxW RhW -LM 0@S `V 0K V p̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`VpJWZ -LM,00K, K00 0S3\%RX` B2 R7Br  @T T `U@ | P~ | U`Q\"\0Y00/H2 RB$0S] 1 RP ?.$10 0;0 1 R=|P 0 , '<1 R D1D!@P2!t0 !04Z 0 `84$0@4(0 H4030 3040 40000[0S\X@I0,K 0`lfH5T<`hpZ,XDXXW -L q, -L$Md"0POc*!0` ,p p,p 00KH 2Q}H 啍pP4 q   0KH02Qn U~Q4 Y 4 0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LP`  PT  P P@  P8  P( $ 0 - ' / ,2 D2 l $0  00 0( R. 0  -@LP P  h 0-L@Z 0PP HP,P@@vP,P0[ -\0LM@(0K( 0 @ K$ K0 P K$+K -0L@P  hJ --@0L M,K0,K   K [ -`0LM00 0@0 K P @,v K([ -t0LM $0K 0  $  K K0P $0@ v K8[ -0LM0S P uX@0 @00P uH[d[ -LM  K K0K  p@u aK[ 0-LM 0PS    KK0p @u0 ;K0[ -L@0F0,([ 0S00 -p-LM@0`P0 RluP0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ . 00 0SK0 --LM0 0 @f9f K p-PLP`   05dpE rP@@p0S PwP@PpUP@ 0@pp[\,\ - 0LP`p) 0S& 0S# ,u , @x 0 0pll 0cp\D PP@ V0(0(0$`@(@$`@L8 -T1L 00 0(Q,p5@p 0`+P0 (@T" 0 0R 0 0Hp 0 0S 00 0IP 6 00 0bv <PP<@ 00 0Ov (@T L\[. 0-|0L@0S(@TH0@?PP 40PP@<P Ph<04 . --LM0 0 /e(e6+ K -LM@Mp`PK!  +P4 0v 0 &x\\\ -LM@2 0pP,K&pl PMp`dP U` (C,K 㣇P ,C`T,C0[ 1S00 0KU% ,C !t(pPs0S s0S s0S (N(C* (N(zCxC*W0`SʌU*0S o*0 $K$0 0pv0 ,N &`K\|]H] p-`L0S* @P'   0P00 $0( S ( ( R$0$0phSp, ,0 pᄻphp'  -L_0@ 00 0(@T p`Pups0S P* xp0S s0 S s0 S @ T (JZp]4 0 0-L P8 0@PU 0sl `0  0 (@Twp b@0S 0' -L@$$)s'p$ p?%] -1LM@ 000 0t(@Te^!T1?p/ 3Lp`+ P#,@K ) P (` $` ,P + +D  0$!1(`v !0;$ KRw 0 @p`P#40S 0:0DtpLr0S P) 2wp0Su< vP!nK00`Fp vp@ Tq0S (8[Sr0S 0@T(80 Sxt(#`0 \  $0 SH Kh|,D^4_$_P_4 ___X2 Z -LDM@CP H D~.6P 0(㸑  aJ(P |7@P v fVP sVp lБЁqP !@\p`10S[  5 P 0 P#0T  P< (@K `$ ` 0 p , $(p`0P 8@Kl  4P 0P 8` ) )@@@00Gw_H`4`4`<`T`4 l`p`$ `$   8 20 "P: -LM@pPg t`P 0S nS0oS` =PP00 @KP @Q  0U0P P00 00 X 0000X  n<U 0 o00,K ,0@S00?po0"S4 0O<@PZD<Tp -LMp` P@( P(K,K?  0mP(0Sm$K -000 0LS    'hx$t`HHa --LM00 @(<P 80 f` e`^`^F$t p-\0L0`SP@8 ,PtphpgdLb\b 0-t L@hP\PP P 000i@P 4,t$@0edAЬ -ML M,>0@,0 09 I > uP = = = P y'K J= `|* P-] p J`Fp* lz -N0@&S;? @ LD LD LD X@ @ LD LD LD LD LD LD LD LD LD LD LD LD LD @ @ LD DA A A B DB LD LD LD B LD B LD LC LD \C C < +0 `"9S<0|:  '| LNp RQl<@0@0 X  L< 8 `) <R 1 `);R  1 `ҽ);R 8 `½)p;Rd 1 `岽)8;R, 1 `墽);R o1 `咽):R _c0 `傽):R O 0S hh*MF@\~PLL*000:8sP$:$ʟ1  h- 00) p 9S9S T 0s 0 l*  0SpAP 00l: p*BYp0SD9P (j 0e0bS |80S NK@D @Dl2P9I9 I 2 4(1 R0h: -W |pP& P! ^KPE[NKPE@D@Dh(0\(\8PpIp4(88p@p B=\70S' PP"MKe/<1 =C1 =1 7p(Kz xz J tZ 0C |K 0KK!G, ! !  1KRG6 Rx D'=K 0CPx m  K@ @ȩ,mpP#m  I PPPP ~P) u9>9 l  P ``rpWZ50S EP fP Y  0㤐* t: b  0P l  CKA A Y=Pl  |540S \:: Sl + \:: SX [hj@pPtz  P`P`0P00@ S Kt 00A Sa>@0 @@00@0h:  0 Shjtz # 0S (0@Sh*Xl:YiS xC  dp 00@@ 0 @@0@`0@@0` pR@P0S 20Stzh 0TP2`0O?   ß4;DQ#| `P`V u2 (2 R P 00C   R ʄ*(0 S;30 R 0S1  0#R ʌ101 S90!0Sh1010x10S ʀA0S l10s[00 !0S00S00#1ѣ10NK@D @Dx: *d00S  P *x/000Sx T; R;lh$tx||bbb(ԜbpbܜccDc؜tccccc f4c8d(Xdddpdld8@Tddde4ePee80@SDN $N `N N `N `N `N N 000 10B 0# 0 10sZe80@SN N O N O O O N 000 10B 0# 0 10IZe -L80LS$O O O tO O O O `O 0S01S 00  00 #A10 #1 0S Zf -0LPA@`|  `   [0BOpcP VB?㖃! p   K h -LMp`Q pD4K i3P00SDDT[0 PAP 0$V:x|(f -LMp|`Q D@X4 iTP8D0 PcP 0"+:xHf -LMte@D hUd : 0 H5Q@60S 0@p4 00 sY@040 0@ 60PS`08 `?4K P04K80Po4P 0` 0P0o ?S4 RhHY 4 0 <4@44 `R`0_P 4K  ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000p30SuH3 8cRT0@PTPd 4K ?_00C02P2 R @4Kd  ?M@ @4Kd  Xp?@pPUo50@0 p2P%R, 5d 4Kw ? p0O<0 8@  00PO`&,ᕃ< K  < K ` F!P,` 0OP## ?@00C0laD@00QH 4D A^X18 8 04  ` P80 $0`ï @ 04 D0$ 80p00`$00 8040`!40 040 4KoQ`0ς`0O1>Q`0P0 20D080U00@ d 0 0H4K(KU hfffԜ - L0R  PZ5f -`2LM0, S(,0l$,@P(2(R@ d  0? 2Q)65 00C 0 БP\01 P\0?0 0! @ d 1 0; 0@4DX1 00C0p帀,0Z ! #,%5+ 0 OS d&0OP `hxv`0d 0@V@0 0P`x00S0 xP0, 0 xG0,,$000 (00(KoԜU hffh -LMK@,0 K`_0@ P A P @ P T T! 0!C Dp  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d ,04 0D KA8h -LM@`pGK,P[1@ 0 A SA  )0K p P  0K S  ,K01B00@S  0K4\P L=EK0@0O4;0 dD04 0GKDKxAԜH8h -:L4M` ?P L0 X @P T@ ɯ08D@`:0O0P 1H000Dş0800Z(U,08@P( 0` E!400400, 80P0` ,`\`0,0\`0?0 0 2 0 `,` $00$0,X,b0t S`0O@ @ğD 0000SH 0ST0T@@0d0#00`C0S S0dԠ ꄓXP@PdP5XßpPYd@`00P 000080"P8 0SX h!40Ÿ0@40 Q`0 Q`0?00 20 $00$0 0X40X@4ƒ0R00$b0@ TJ 嘡00 x0`p䁟Wp@ 0\5Sl@PlpGW0P0PO LX@,00 ß @d   ,a!0 g10S70܀80P)0p@_pl@`x0W0POP LX@,0 /0Od 00 06080P0x `RU(KlpgU ԜDghT -LM d  , V<<P O,;PK̬;0S ; 0t{Wd{d 00m4: @P0+:p   r7`;:Q: `: Sr\ mQ (:  S4Z@ ,00x J @P@PPjɟ 00T 0L59 0$: 049 0B90A  0`0UT X0PD RD:R080R0Y00 8 04 000cH0 400cL0 H00O85(jdjxjTTj8 ht@ylhj R@|xԜkkh` ȐY P<00S<0|  00 00 ,00x0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000h1PH P=LV>00h0 h0 S:h0@2 0ȑ<0P2 0\ \2 0 0R0PT0XT0P0P0HU 00 00@v0PP40@-0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0(40S0 8<4@Pmh4 d `p8<4 00@ PQe@p4PQ`NI H5rP`8, 0t5e@  K K0K @@|PPK`VP ` Uap` p 5尐K蠐 圠  6, 张 8d 0A@@c00@ ZḐ 崠 0Y @K$'J F%*0)Z\P-O70S~@P'B*0[\%7R7\5*0"G*0P7( 8Q0\570S( ` 7PP PT8` Kp [PP PPd80X0 h R01:0P&{ H *Û`p㐐K9)`0S-90O ,00 /@_d J)P0d PcP@c@t 0 S F  d `pP0I,0V0S F :0S :P (:0S8P HD ?>0 ?0 ;0 4 D0P  +J*0`PJTHLV0Od 00 f0 R 7000`P pV0 008P40 ?d @@h>hJff 0-PL@0S(0h_BQP x_t d\00SP e <^J 0r_ (0hm_`\l|llll - L P_*m @l  mO -LM@/a"P0002Pp2 lR dr`XT2T"PPPfP tP  Ep2 10 bSP PP P 0@SX :㛸P*10S Ya@a,@ pQl 4  !PP `@a0<S 00K@P Y0S 1 0S0_+0S% 3KP ,K  04 P,00S h&040 8K[P @00S d) 0X)=zh\(0'l&ll(XlX@mlV -0L Ez$tHm -LtMp  Y6*V0/00屡@ᓡ 0P K S``Am0&p3 p 0: S/00 V P X 0: S RY0 0 (K 2P , -Lp` [[[t!Dp mP2 pP D!Dp81 ApP@ @`㟷 0@S 0P/S @0P/S00 R:X  rPPyP#@P #P3 UP#2PH^` 0}%>P` Jm(@ -`LVP@p\Vy Vp P0S [S \S Vi 0P [RW VY nR 00P \RW 0[V 00 ^S00]S00S5 ]S0 0[S \S \* ]\0]S$@P!n\ 000.\ =\:\ 0 0S  ]R  S @L4 000$) 00 " 9mm -pRL`( P P9 ;P7 0@  ;P p0P P\ 0fWP @5  @B hP P@ @0@  p0P P00P@n P-L`* 0a0CS"` ` 00  `Z`Z X RP P 20RP |0AT@T 0Sp -P0W 0p 000`Z0n p-L`@eP @P# 0S0Xpp0  R P L 0PCp$ 3kHn 0-LM0 9SP 0S:00 KpG@8\S d@8$S0@0 /S @P 008xnXn -CMLM/0X T ,0 kP@0  r @0D r 00 0S#S ;S X$000 X   04cPi 0P@0  r @0D r 00 00,S0l~`0I 0D0Sb 000Sf 0D S . ..MAKEDEVconsole tty memkmem֬null֭zero֮stdin֯stdoutְstderrֱksymsֲklogֳbpf0ִwd0aֵrwd0aֶwd0bַrwd0bָwd0cֹrwd0cֺwd0dֻrwd0dּwd0eֽrwd0e־wd0fֿrwd0fwd0grwd0gwd0hrwd0hwd0irwd0i֡ ... . ..chowndhclient~ disklabeldmesgfdiskfsckm fsck_ext2fsfsck_ffs~ifconfig~initmmknodmount mount_cd9660} mount_ext2fs} mount_ffs mount_msdos mount_nfsnewfs newfs_msdospingmping6reboothaltmroutertsolumountsysctl . .. tmp db runEempty:Fhashh:+tzlist ... ... ...,^(S' P0S {0S!0 S񟗈ꨠ ̨ t < Ħ H D p H 0T$0R0 T0T4 0D@T0D   r P00  r 00  0 @ 0;S@0D TRd0$@0D 0\SS  3f` y@PC )\pD oPP q X<  0s 0 0  @T#  @0D 0;\ \ 0$@0D 0\SS 0yP0 N 0@@0D 0PD4 SD4P4  0`+0<4 <`@4 H @$ <0aP <4 c 0`S@ 0:HH @H<$TL ' Lt\T  R; Z@T`F ?P \000@S0PD 0U}0UP@@@@TL@a$ $`P <$ <$ 0D@T0D   r 00  r 00  0 @ 0SI x 19 PU00]0) pV0D_UF 09P@0 MT$R ,X4@P`@T&U @ 0PS0 U` Vh8 @AX8X  :',08(Q}(K0D0@T0D   r @0D r 00  0D0@T0D   r 4@0D r 00 B.K B B8 0S 0SvP P0"SP0&1p@T@T 0S0 ` EP @T0(0 000;S@0D ?0D0@T0D   r @0D r 00 0S 0V00;Sl@0D 0@T0D   r 000  r 00  0   0"0 000D0S*0D000ST0D0D@T0D   r \00  r 00  0 @ 0\S P 0D@T0D   r 00  r 00  0 @ 0SBK0JCK` JPpI44 M@P6  0fP  f 0`SP0:p0SB  0S \S @ R @ R@@ 0S0l^`00400 04@T0D   r @0D r 00 T400DX 0S T ,D4S T^@|QS 0S0 `PHq`@T0D   r 00  r 00  0  f0P@0  r |@0D r 00 Lp`x  |\T&T~\00@zhnn rLrxpon|ropn`opnphqoqoopo lq,qpTq$oXppq4om L$<4bH`Pd PD00D P 8D 008@P r 8 r 00  gR4 "9R.1R5*R\0 6 3p1 ,00 *r( 00 # @0D  pRa wR r8084 ;RT0@0TCKA ʟ0@s@@8@P8   r 800  r 00  8  8\ \BNK@D@D  \  B8 \0T0 ᮡ 3`V" 8~00HYT `0DB.K B B|  #p  R 08L RkIp 000 S R 00 RU0T p t00 r 00  @0D P <F89BNK@D0@D,4Kr* ,8S  P{X;rT -LM(s0S0 g 0S00 (K,KD蒟@0SG 0#3P00,  "0000S+00CS0:0 0r%\"Hb0Pd 0S# 8B40僜PP@EQ, 00S  r 5aQP1!01  aPxh<h0PPP) 0S00CS00 0r+k0P 0S0 00 S 寲 Ͳ 00e0@PΤ 0d0 U`JP0PP0S 00TP4l6 -@L00 @ 0-PL @0P@0 0 -LM0`S($p00S )*P' 2 0SN嶛2PPw 0"000S㜢B,K0PPr2 ʱPS XB0S\R , QD R 0Qn00 R0$  ,00A,0 Q 0#S0nS1  SA0!P1@ Q0 000 \1  L =0, ;b, 00@O 0|@,000 R ,0  R0#S0nSl0 00 000, ,ܣ0,(Hrl p-LP@` "R;pX E0@0S00 ؼ 0 ̼ @e 81kp,UQ$1 1`!000 0 0 0`P 7P @Pd0`妰P2pQ P3O@ osrH( s --LM@p0l  0DSP0P <0D廢 $ >TKoHs s -L@P NӢ @ -L}@P N @ -P@Lp`8 0`P 0W8J Pp-LP`{S sS PV 0 08`,P<  ,P3`[~ [~,P`@@<@TU ,P``b,PA ,PYm,P,P {UA,P Á,P Á,Po8 2A,Po8,P,P ޅA,P* ,P." ,P."   @C,P* ,P* ,P* %,A,P* ,P* ,P* A,P* ,P* ,P-u~!YW5,PV,P%$,P%$ Inm!,P ,P ,P "o!,P ,P ,P |!,P ,P ,P`!,P ,P ,PLR!,P ,P ,P ~y!,P ,P ,P /W!,P ,P ,P זiH!,P ,P ,P !,P ,P ,P h|!,P ,P ,P}k8&!,P4,P4,P4!,P4,P4,P4ga,P4,P4,P %!,P4,P4,P %aPVa,P4,P4,P %x!,P4,P4,P %;+a,P4,P4,P %2rb'!,P4,P4,P %Wa,P4,P4,P %9}!,P4,P4,P %,a,P4,P4,P %!,P4,P4,P %QtIa,P4,P4,P %,(H!,P4,P4,P %1a,P4,P4,P %!,PD,PD,P %7_a,PD,PD,P %c!,PD,PD,P %Aa,PD,PD,P %?!,PD,PD,P %ia,PD,PD,P % q!,PD,PD,P % =VHa,PD,PD,P % !,PD,PD,P % ?ta,PD,PD,P % rɬX!,PD,PD,P %  :a,PD,PD,P % 3!,PD,PD,P % Ca,PD,PD,P % ֻ!,PD,PD,P % bDma,PTg,PTg,P %!,PTg,PTg,P %Ofa,PTg,PTg,P %K!!,PTg,PTg,P %Ma,PTg,PTg,P %"h!,PTg,PTg,P %- a,PTg,PTg,P %!,PTg,PTg,P %mrQa,PTg,PTg,P %vL!,PTg,PTg,P %Qhna,PTg,PTg,P %SB!,PTg,PTg,P %4a,PTg,PTg,P % 16!,PTg,PTg,P %ú]a,PTg,PTg,P %-cU!,P,P,P %la,P,P,P %uJ!,P,P,P %H9a,P,P,P %j&!,P,P,P %_a,P,P,P %A!,P,P,P %;ca,P,P,P %Zy>!,P,P,P %{a,P,P,P %7!,P,P,P %QYa,P,P,P %ι!,P,P,P %W$a,P,P,P %v!,P,P,P %`a,P,P,P %&h*!,P,P,P %a,P,P,P %$!,P,P,P %Ȇa,P,P,P %T6B!,P,P,P %da,P,P,P %?B!,PR2,PR2,P %`a,PR2,PR2,P %|K!,PR2,PR2,P % _+a,PR2,PR2,P %-Ae!,PR2,PR2,P %2Fa,PR2,PR2,P %H!,PR2,PR2,P %_a,PR2,PR2,P %F!,PR2,PR2,P %Ǔa,PR2,PR2,P %ȭ!,PR2,PR2,P %QRa,PR2,PR2,P %1!,PR2,PR2,P %r a,PR2,PR2,P %z!,P`,P`,P %"j+a,P`,P`,P %& {!,P`,P`,P %՝Xa,P`,P`,P % =']!,P`,P`,P % )-a,P`,P`,P % w5!,P`,P`,P % ca,P`,P`,P % }b!,P`,P`,P % ba,P`,P`,P % n!,P`,P`,P % s|a,P`,P`,P % !,P`,P`,P % cba,P`,P`,PyN !,Pc,Pc,Py ba,Pc,Pc,Py y!,Pc,Pc,Py!,Pc,Pc,POP tمhBu!,Pc,Pc,PE( əBua,Pc,Pc,Py,;!,Pc,Pc,Py'a,Pc,Pc,Py.!,Pc,Pc,Pyw!,Pc,Pc,Pc?Z!,Pc,Pc,Pc?[Oa,Pc,Pc,Py#2O!,Pc,Pc,Py"ya,Pc,Pc,Pyl!,P,P,Pya,P,P,PyL!,P,P,PytVa,P,P,PyGW6!,P,P,Pyg8!,P,P,P<!,P,P,P= j!,P,P,P"!,P,P,P"H ~!,P,P,P4=!,P,P,Pyf,P,P,P@D0 },P." ,PO,PO D1Vi $'9Gcr+g&b:P٧9z}u(!2"ՐN&8w3٢72:IFwSp |P00PVp p oP 0 0 @No 08b0@}Nd 0 W l -P` PLpW000  0 0 K ]@ -MLMxx0 S, /p``P10pS `"0 0R RdPPJK(@D@D 0*0UP0pS `ʰ0 R 6#3P , 0R0(KM0S T ,MPM$nxh sm -L\M00O?P 00dpW X/000S  R  P0OSpP0~ U 0 S RPE4/0@`P `0/ `10P%0p0 0 0   r 3R^ 0=0C>SY x (  p T 8  8 t p  P-0S 00pr$0@S  R =| R <@@p] 0 0S 0S  RpMLPl0S0S<n@,T 0 p18LQ  0p'K0S R  B \P|  |P0` c Kk 0S䋟PBAD  0 0  @PPp0;T Qp;@@0s 0S(" `0Xmp  :  0 \P 0S`0 CR` bX0X00S0S`0 CR` rX0$  X00S\`00CS`0X0  X00S(*6#3P@ oL0S S Gp 0S0 :pi 0p|9` 0p{H)00PI0S,Y0S d 0S ^ ^|  N| 0|  P00C|0 pSX0S ȟ l0@0S`@*P000PUBb0@0S*l`PVl0Ϡl "000t4 q6 cPd0@00S8*<3 X0 <000 00B S2&R\RPK@ 0@ C0S^Zu qr cPd0@00S:K@ 0@ S 88/\ cxA000xHPB 87$8&Ԅ0A0Q 4NudPUXh $0!,PK8EDEPKXE`E` 0  @P0SP PU 0s U #0P 0@iHP0 C_HV0Sl  0S@k04f0@ +0@S_\$[K@ G0@ p0R P!8(K B P| |P `0  b`  rP1 \p0RX$8 00 D0 TT'p @G 0|X 7s00@P KNP4[S 0" 7U@Y?h`V<6<00$$(p @S0@G嫛 0T@Gyk00 P0-LP 0@@S0S T R0000 R000h 0cN0  0-PLP @rT000 0-LP@P 0R0 @@0=N0 -LPp 0LP`@P U@@V@hN0 -pLP`@ Epp lP) mP ?P`@ 5ppp0AP` @=㮥0P H+P`Q`0 ;+`Q 'L -RLM|"@p?P>@ 01p@Wk `PVk 0S0M K֏0S2 TPr 0S0PP 1S0S@T 10TMtA ppo0_? P .U?0#K"0KR0(0;0@ ;0-Q6  “- #K⽓0@ RU t3MM0+0#0K"K!pK  0a , 0<Y<7MzF'x((؀'Pl 0-PPL $0$@QTmPP0'( -LMPP 0-S- `pC#6op lP sP ?P`KL`Ph$M`PCP#oppV OA0' #0@| 2  0 "`Px @T3 剤P @, 0T00S&R+PppT] 01P` KqP@ pKGP=@T 0%SSP`yL`T; 01P `K0S L@T' qPw !0LSLL 2Q0 dLXL`Ew 8L```TL`O0 R @[$ R @\LTWL`0SHKV ~TpV? ~;P ՜Pp` `rQ  nQ bQ) cQ`tQ  vQkA 00C R 0B0S00C R10P~~4Pp`P 0004=4,20  1pP' prP 1p 000C1!pp0`~' z'x('(t p-D1L`P8A0!fp LP PP ?P>@p@ fp`0QU Dp`0@ R V"T - PtDpd@P `jD\0pv=]4tDp%m@''Г@(|Qx( -L0M8dP0D($Xfp LP PP ?P(KC#Hfp0S ADAˈL ȈH X PU 0S x*Dl3p0S\!Do@P `T @gT 3p"P  "0 @T0 D P 2 ; 80 4 c80 0x@0 < tӋ0pK@`K,K0 < ,0@P)00S "0 HkZP<j<@U CD0Sh !b<嗐 C=.t10S<<@0/S4ZBT0 ylL 㻉P  3D0S> !D7 w1P+ 0D0 P0  PHh0P DP P |nCHl<@H ㉉bCxFCl@P<@XTC''@\`Г@(x((9t|Qh0fP -hAPL`!*e`pp mP <1 8 !C0C@`P- 6@p  ep01 PR @@1ST TVp =X 1b@V =XB@0 pR@D b@''t` -`L0 R" p@@ T 0P P 0 s 3T R @0 0S  @n T 0 0x(' -LM@PKp@b0@0  dp ?P pP :P8B 0008B@0S  ڄ`P@ PR1S0 01 0S00S 000@$K܅x( -LMQ@  WϠAl  Po K`@H _Re$àLWO( lFFd $@ P7oꭋhJ -LRMPp<K`&KmGKjP`y @@@@@@@ .`0SY DK&KNYKK0  c0Rc=9 =( (0 (0,  A, B, Q=9A =C, ( , (0 0 c0Rc=9 =0 00 4 00 A4 4 Q=9A =C4 0 4 00 \B ^b A, K0@S4 K0@K_0DKPK&KYKW 00!X 0R=9B( =C , (0 , ŀ0! 0R=9B0 =C 4 00 4 \@ 80D c<0Rc=9@ = AD @0 D ^ @D K0@D K0@t, KX0\@4 K0,Rj$KH&&?B4&<$,DL -LPM@lPK`ሀ|dK 0lp 0k 0 0$K\& -LPp@ bp fP/ vP ?P>@@ bpp01@T `jP0 [XPᬃ@T W,@Tp@'X\ p-LM 0S@P1  KnfP/0S"  D 1`0P @e0P0fC10C0 0S0 ,0 R$0xxxx('(t 0-hALM`!Peb?PA 0AT00  KmeP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0?0bP[K0@@ (0?'x(|fl 0-ALM Pb?P80AT KdP%  0 0 rR P0S @\ZZDP0@0d0 R R 00C8S@ 0  ?'&X(x( -<LM4D0P$$,0 app ?PA DSP#pap0aV #0p6 00LS001 000C0 LR\^:0-W0  =W10h0 0 +W,UP (PU n?, 0R(K6:@4:P pUv ޖP a0E`S                     PUp 幖XIP `@PU ᭖P X0E S)                                 @II @`@`*C`@` @`A`p 0S>p~X9@9W" >KP`@0 0=00 0<00^L@D,00tP@T@B>FD>Ah'(ІĆ(t|Q p-AL!``?P8 0Q@P yP# PyP@ xPp@B^ 0S `> _l[>T @pTj>pP@U 0-S0S>@p'*܆@ -`L @K`?P@ hpNM0T 10 00PS<0< ^Y@w'x('(& -0L8MT0 0\0 0CPX0 PEH%`p2 rP ?P pP,Kf<PT ,>(KsP uP@PT  , K=PT , =D0$X0 _p01 `Rd40&T/=X$Tl?@ZPP 00T"P -=X0S Tp 0 40 0 540P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0SvP 0;0 0S C@kP0\0 hX0S L0 cRLK]pPp<0  cR<K]`Z4 UJ uPu U0S8V  Vp 00S 0V0 R`FV00܁0`D2 R98 cPOf0\0\U00Su U 0!0  80S 0SPr|1$ RPkTlP KH1K PE][  0fP0< fX0S@x@3uX# T uP0  D0 @ ZD0p0H L0 p` 000H4H@T;' L,&@x(('T(\( 0-PLM @^?P0 01P@PK B0PS80S08PKBP0' p-,QLM$!@^?P5 0aV/ 1 0K&P+ 00 R 0 0  Q  0S  0pXPxU5< XR<xx>@xP4  D<x''&x(l p-0LM` P@,^?P 0AT K04\0\  00 0l x4<x<x(' R4 5:0Q|H -0L` Q\p 0PS @0S 0SjP00@Stu - LR@:Q0AS Q 80Fp3P000 @T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P T8$K@pK 00 RӏP @ 0, p3p3@pK 0 0  ,@0 ' & p3 t3 xp'| 0-LM@P$K $Kp  ?<7K0 Kpq7R -@LM`vP@Q $K 0/P $P 0 07 K0C4pK4@ 0P ,@ (P  P0@T 0善$77ꐈ(Ȉ -LL0PS8H 0 S S0 0   0#  A0A0 S00`pB"yYp?@C "P9 8 8 8 8 8 8 8 8 : 8 8 8 8 8 8 8 8 8 8 9 8 8 8 8 8 8 8 8 8 8 8 8 8 9 0SV0SR 0RQQ  RP A!6Ypp?@0!R .7``*WhA\!Yp . ?0B"S9 `9 `9 `9 `9 `9 `9 `9 `9 : `9 `9 `9 `9 `9 `9 `9 `9 `9 `9 : `9 `9 `9 `9 `9 `9 `9 `9 `9 `9 `9 `9 `9 : 6W |Q @x6QQ@T  8P$Pv'؈ `v0 0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`z[~T- p@PP 0`pc@W P`ҍP ̍P@W 訉 -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008PpPC (I ĉ Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd/ p-`PLP@$VP 0R  0RQ^p^p -PPL`@p 8p@@P VThOx( 0-@ 0PL⏌P 0c0 -@QL.0  [00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 DP Wx(̉ -RLM0 a PR0 00#\R00S  0R0B`C0PP0 F P  `L4`(K`14K!, 0 4 4,0Q*0 0` 40 p@W1 1SP` V' @`0 @`DA A@,@ 0 4 ˋP 0Sr`lT 0 `0K@PpWx((Љt(  -LM0K` k kPp   XP P0xU* YP kPp  (K @`DA jAP@Px( -L,MP L T @L 0 40 0 H 740T0<0 8 p P::P8@w  YD  0< 0 bR<KS@Y R   P /00D00D0 H<0  cR<KS@PH DT 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , KWP LPQD p@< @`WT 1 00 R P80(K,0S 0x( -RLM<0 / @P`4`KcH#8#000 40 , ##0@T T@T"0 !wz2P 0 0p400gCz @W `2  @WY8 @`P X`P @ 00NV 0P sP XP @  81" 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 <  (K !|UIZ0 P`` VP @PA0<x 0X0@` DA A@,@ 0 4  40" 8x((D'D(&B  -/L`2HPDp`@P]P@ T iWvt| -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@K(0S0S 0S0 S0S0S  P H, 0R (K40$  # ^Kh&.pv -@TLPL x0S C x  Tp0@ p0TP`[@,&(x R p0 Bx p0`[,& -`RL@<PPT^ Tp ppTPW oU 00 S/R  0R B/S PUW10@  `1`0V0 T@j DA  1A` 0V@0T00  ohP@j DA  A x(%Z& 0-LMPK bQ@P*0SH0 R k NQ@PT[84( -L M0S 0 0@Q@ K0 K;P1[S S|ࠁ ࠓl 0@yP[vw1[S < 0yP [hw('pht@y 0-L@P}\ 0S0S @p00S@ @'d0 -@L! @@@ @@44iP, 303 0 h &; (.* P@p 00  0-0LSP @P0PS0 0 <0404 00, (0 -l 0S ^S 0000S$ >R@0̗?R!000 0 ,0 -tLQhd0d @pT *T0`VPUzTP@00 - 0pL`P@0 ^000@S@0C@0000`P  r 0  @ 0p-Lp0s TT 0RHHr P@4bU0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP=d\@P d0 R} X0 =wK@T( -\0LT0L0L0@DP 0540 ,0 7h P P p-P0P`0 0LR@ 0 R R00CRphp!0DS x[ [ [ x[ [ [ x[ 00C0000 p-08`PLP @0U@Pp -L - L p0    -LM`@p0Pd K"d@P `00`H0H T w,0 (0$ 0c0AL(|($( P-L@ p D 00 hK^IT?@hvؓ -$0L x v& -Xp@LP P <`0T: 0S0UP 0-LPP @@ T0 0-0 L\+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@00  0-0L@Q 00P:|0@0hlP P: U T00B0R T*0B0R T: -1!L@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `yq 00  Q` 00r 0 R0, 0 & CL}U{ -4LP $0 A , -0@LQ 0 Q 0 R 0`S Q0S0S0S0 SS CCQ0y0Sv0S  C' -0L -0L -H0H 0L S 40R   -H0H 0L Q 40R `  0-0 L P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*0H@  -L -L.0 g -LD0<0< 800 00@@K -L> -0L `R0 PhP0@z|0 p d@`0@TPT0T @@@Th '|($ -T0L R D0404 00 0@' (|( - 0 0L $ -0 LA$  -0L|( -0L|'< P00( 0S P0CB0@ Q-L@!00@0@ QP =D0 @<0 40V 000  -LMpP` ȀȠ04 <0 8 0 00 , @@@@4 0 b00Z<08 040 00 ,0 0DJY Y (Kp p-0L@`0 ^P :ϠQAQ 00S 0U^@*pp  -|p|0LP R`*\@  `ֻ һ0 0 0  -L@tP嬀`@P0 ㌠ 0 |pS030#0j0V 00@0Ttw0S:00 0-1L @To 1 R@0S S S "S 'S0S  R0S"S 'S 0S S S S S "S 'S0S R PU "U 'U PU U U00~P0 D0T'* P P "P 'P 0CT: P P0c0 P P "P 'P 0CT:"P 'P|(  -l0l 0LS`\00000C0P 80 40 1$0, 0-PLM T@00Cs0 0K0KPK00Cs088  p-d0LX PT@T`0PP88 1?1c"10c Qp0gfff -tpPlp@LX`d@D0 <0 40,0p p, -`PLP LPD < P0P0f 50%QA!V0Pfp p@@Tp e` PQP0 0 B cRW@@T P 5U@@/T00T0 0@Pt 0S:\, p-0L MP 0 K$KK a0a(@K @`PKp0 %$0 `xV P0AP᥾H HPU$PPl  p-P`L@T @00TPc@PdH@p, p-0 LQ 0Q` 0 pl`tP0P Y`0@d0S00CP 0p 0o dt 0 -0 0Q tt0 `L X0R 0`@RJ@d  -LF -L -H0H 0LQ 40Q0 000 0Q 0 R  -T0T 0L Q @@0R `=  -1L Mxx 0,K n0nP(K4@K0K @`P3 U (4 - ($K,00 (pcfVW00S@ X (0  0R/S 0!U00SQ(l(4 0,-(0 zPl -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P RPe0@  LhP0 -0QLp @aT`*@DT:PPX`0@@0@^SDR(0P  $'|( - MLMKK I0 , -1KZ<t`P@1p@0T-9K.yK@ ^KPEPE@T9 V~P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @nP 0i-![ ^R@Z 3`P, 0R*(KV Z ^Y *00hY ND fZ@h{ v o  w -@0 PL 0px@`00Cs0 V U }PP}PPZ  -L,`p 9\ 0S  2 1C P@T@T 0U P0@T @rW0@0 P`n 00  0@@ %,w, -p-ML M` 0 R0 $ P#  $ 0SQNK@D$ @D NK@D$@D $ 00\ | 0RKp$ ??hw 0-PLM00 @R 00   Rp0 RP0 R<0 R$0008v v p U V -h8LM \ T8  )@P 8|P,8  $ȟ@0 i0 d 0@^ b0@X <0@R0 M C0@G c0@A #0t@; 0`@5 0L@/ 08@)0 $$ =0@0 0  0@ 0@ h0@ d0@0  B0l@ L0X@ l0@@ >0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(KzP (Pu'U d 0f h $d b \ dy y $y x v v u hh b h Hd 8^ v b r ld Hf g @u Dy y y |\ ] 0m f k @} { V c h b U 0o dt hi H -0L @ 0S ,<"',h"!0 h"\dP - @R0 000  0L Pì h -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @"T( 0R$KP" 낎KHH0" V^ 0S2@T@S &zPP0"1@T r@TUpAp t1@T @S zP0}@ 09P9U @8 P yP0@T @S yP0[21C 0@T @T yPP"|XP L"t@;<$"mh,w|Q@l

P0 ` h 0 |  Z   0S PD0Q D0 D >ZXP  _ Q    00 ZPY 0 0 "" "Z  R Y ZJ Y 0 -0  00C0 40S  00 Z !  0儠 0C0 p Z m괪  t \ L ܥ ԥ Q D@ BP ~ R0P00S Qh,0  R `Q !0J]S~Ꜣ Т Т Т Т Т Т Т Т  Т Т Т Т Т Т Т Т Т Т Т Т Т l Т Т P Т  Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т Т ` R 0 B 0Z ZV PRJ  000 00 0 R 00   00 䬐 0 00  R0 S0    R0(  0  x0 t :x00| 0 R  pn0P/S@g0P/S W :S 0 cR ڀK< @ 0S 0SS|p0S +S -S AT 8U0P PX8U |tU 0S 80 cR 8Kv<0S0000STd X@ / <`` X> S`S0@P {Z @K 00 Ep Q)p |0〠 p D00 p 0 p 0 A   00#0CSX h X h h h h h h h h h h h h h h h h h h h h h h h Į h |  |s@TQ #T  Q00  0   00  000 RQ5@T*T000 #0CS #X50S&00 R 0@T@@@  0 @PD0   0@ : 00s03S; 0-S=S ?S@ 0S 4P 0S0   Sl0S 0 400c0 P 0P0 0#0C S H  H H H H H H H H H H H H H H H H H H H H H H H T H 8 p , `p  & P $00(   0S 0@80 cR8KC;0Tp00S) 0  `p  0 $0( 0 0S @80 cR 8K;0Tp00S)00 `p p Yp 004, ` `@enSP 0P0U*°  PZJ 1 ( 000 ``, A000  80 4  p Y[  3UzppezP 3I0S p A x0S  Q   P0UK*` ZP(K400c0 =0+y (J(l('(( 9`'\0 x(؍40StbpP 0P0UD*p0 P dGPEP 0@` DA AP@P0 @`DA AP@PC@w  0S>0 0R900 3` 0 P40@XA    40` 40֯!0@Pc `a R0 00    00@"00@040apJqP0%S #S `V0S   0S` p   W>P6PEW0<0 ` l<#S(pp@`Ph3 `P( 0S K H`@|P  |A 2U  D` 00   p` ` &4 0 | dPK@K0 p )a0S @80 cR8K9900 R `U` `PV' 0Sr[pP 0@S*S0]S @V*Vpt5@ 0Q  0S00S T  8%00  > P  LZP?0 00 ~0 :S 0  00S     0 [HpP 0@S*S Q  =R  D]P`@ F7R 0  P@U @` @0`'Y`l0 R0@T  0S 00ST\ 00P7H`PG @ 7Q00S+P@ 0]S  #0BS  #880S$8pZ\PP@ `0 T l@g DA A`p@*`PUg0S(0@S@@lP k 000?0 0`A 0` (  `p0` 0r<PF`EWS|t*#0  R Q+R  @ (\_P#\_\;@P@q q 30S \t_P PP <0 00p`0S [\_P g u>`p(Y[(< 0@S@P R  P@V :|<AA  Ap`P Dp 0@@S000 u e0 ,W ] Z p-L Ml`0@P 0$K 0 $0 $00`0S@@FKpx( p-L M`0@Pj 0$K 0 $0  { $00`C1@@ S @ Kp@x( -L M0@S`' p< P$ ( *(0  (0 P (PK EP( 0Q*00$ 0` (0 0@K  ( $ ( $ @`DA A@ @ $ ( x( p-LM0PS` `@\`1T@S0 7Kp& p-LM0@SP` P`8P1V`S U T ?Ac Q0 0( $0K$@ ` 6Kpgfff&$ -L@ 0 #E@ 0-LM@P0 EK0D p-LpMPK@`"P@@PU Kp : S  S @PV 0SI -SLM@0 < @ 00@/YmP[ ᳫ1P  000 , >00T080 4 1 `:AmP4P7 X pf80@ cR8K5P@ d/00P80  cR8K5P  T4<@ P 0S4,(K` :mP4Pa4`, <@  cP x( p-LM PK`|-M0M@P  V 0 /R 00M@PKp \(' p-L@`P0=S\ *SZ +SZ@L M 0 ` pD( -0L@pT`T P *MPT@0t03V0S  M 0 0 x( -L`L2p/@ulPP`F  U  Q22p 0@P 2U @ |9X  l2000Y @ @ ("00P00 FY\2P 0 P 1 P  0 @B&1 ; 0 8 TP5 0S0 h LP @ 0  P PU00SP LPP 0 P 0 00 0001   /PP 0@pX>\h0P@@  0a 8L0P0{''&'x(D(\( -LP`000K  @0`|;X P0 00P;000 OXKv30L -x0tp00lL @`0PPC0D03 @<0000'\&(8(' 0-@LP}K ,K@P 0h  D(l0PR000AS  0-PLM0( 0 , i AF/$ 0 0 R<  < 0S41  V.2@PA, R  (=- ApB K041,Qk"( 0 0$ P !0 00 =$0 P0R@@B )`0  0S A h0  -`$0@ ` 00x((t(Prd|Ď -0LM  00  P,0 0P, K  0 -? R:0 R< 00 0;0  0S N@PY 0 @ |0 R\ 0 RW `(X p>$Q \KP004>X #,QT X 0HS񟗡H @ $ 4 0-S 08 KpP*0S WJ= P @0SP YQ  P1X VW 0S 00CS4 4 ` ( P T T , H x < R  , pWw 000 00 Sl<  0S0 00@,0,000S 0  P 0S!%M; R0(K|p}; R 0@H  VYv @t+\0KrR ` bG\K007Wt +AoPj 0Sg :Rc0 ]0 R  0&0 R 0 RKP0: Sh`0S\z sL0 R8: @@(:  A4 0 $9# R& 40 R" %VY >40 R @440 0\9` 0x>40 @R8 :40 R 40o |0 S0 0 R  G0   (\0K Q@F -^ 0X XH |(|8XX@@0 ^ 0P0 0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D *0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sj 0 h64 00T6z@P 86  O0DSLT0 t00@ 0Si 0 Re0 4 40 R 40 yP  H5Pi40040 4 0S0 0SD0 R@ 0 jP 0  a0 04 4@P 4  0DST0 0%0 0T00 0 @0 @0 R@@K <0@0  @.000 00 0S C0 0 0  @c00 0 4 00 0 @VX4 I/*04 0Snh@4`{TWPP 0S0S8S 0 0P0 @\0 8 Kݟ\2 y@P6"0S 0S>Rb0 @ 0 @@`K@PUPBP<0P0PS *8K 㪟1 00 0E _0 >m*4K\0K (!O 80!)X*V*0 00 I0 q0  @0  @!@0 0< 0< 0 0 P0 0RPPM|PO4(x(' &܎&h (T' LPrd \,h''&yX@Ll<0@ 0 R_ 4@80[ R`  `0`SQhSV0SPPuSVD PhSV0S PNVPP0DQU000 0@ 0 0 0  0 S00P0#Sp@8@K0;S T0 0 40 R\ 0)S40 40 T0 }0 40 RH8K 㘞(q){b[ 8< -L$M< \@0 0,0 ` 0S<0 SH < <0@T8<0<) Q <0,) Q <0) Q- N.PpP(?0pP pU H  8 R=0H0 (01@PTs H0+`< <0SX 0S <0S <0  xX<0S <0 R4 0D0 7 0R Ru Pp"0'0Q70 ;00 R   0VD R I p Q0SO 0 47@# R WDaRU;4 :@PTP  < <0S  `H 0PS @0 0H @0 0SE @\ <V S7 D 0@p|V Q0SPU <0S < 00CSY0 P P 8 <0  005 `0S 0SLe0 <0  8ş#000 < <0#20#0 ,4 <0<0 00@P 850$<<#04 <00< 0< S T'  @0,(K46. XH WLD <0 `<0 R <0Y 08 ~0,0 < 0@<0 R <0 0 )PqD P 0< l< 0 0,0 <, < 00D0  `3 , 3 R /LdP  (v 0,0 H< 02Ģ@!W`D@ B\ @0vŸ<0  @  0`, sN ,p n04M  b l2 , d X> 0,0 ]&s'<0@{bY0 , 0,0 K0`H0 <@ K<0 RS <0MY 0 ~0,0 7<0  < 000<<0 G< 00<0@  8L1@ H@ 00 0P0׾@0 0S @=E :Ey <U<0 >RkQ   0,0 , d0 &' h 4 '@ &L܎@(x(P\0(&(*t؏\ 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00Tcp3P000QP ^ K K  L0S0K\ K00;%h~y -8@L ?0000 x( -LM0@00Q  ( < P & `& &0BS    | 21Ch 0 X 0K 0 K 0K4-S0lzx -0L(S 0S     "(0!B "0!B z -`L@t `2  @t 0T(0`0< (Ÿ00:0R _T{ 000#T0Sq 000#P0S _PqPA f 1@;0<000 @ RPP '0`0`@0 [T5 0S(Q ` 1@:O&00`Pp+0 0pS T21C   KP0p`040)00`SLP`(  (x(zp 0-L$M@8 0 0K, 4 $@ @ 5%1@P  R050$ T+40S)K00PK1(0(S }#(0(S8 0 "R4 8QP$ [Q0C(0  %W  x( -0LS@P 00S p `QP @0u@050Q0 050p c -`Lp@T  00@@0A   P  QX @xPX @ - QL M`4 ,@!0DTPPTST] #Tq Tz&0DSpQZ(K4!T 0p0 0 "TP U 00c 0400C00 @pPDU%21C0 40RcT  , \ 0D,0 S, p RSTT T 0D0DTST U0  |  p ` H  |  p ` 8 ,0 S(0    Pp@PDU$21C0 40RwT ,    0  ,0 ST  0S 00 00: P 00C 0 0Rö 0R 0R 0PSPUr  p0%SUv 00 0  00C 0 0S 00 00 0SH 00C 0{ ͛v q 0Rl 0Rf 0R` 0\ 0"X 0T 0RP 0L 0cH 0D 0S 0SI 0 0 OB 0S2 00 0  0p0C 0 0S# p<1p 0Zp- 00s03 0& u0p$S 0@p, 4   z,<  0-L M,P0@4K4 0@ (00K00-D0D 0lCQ  /10 00|(' - @L"00 -L P -LMP@, J_P00PT"QaA0 10Q*(K0100CQ*00 0!  BR 0㷹P!` pP4 ) P 0@0pP 0 R @40 c0 0C0. 0PP `E̠E-K0 ED,K+K-0K*@K)PKy 50 r 0l$0'(|(' -RLM@PB `0S  U@PER | l \ L 0 0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PL6 @ ,,0  ``  |('' -ML3M 3R, , 0R(Kl#00d#dSKNXP L+P -d@P sT~ 0ø܂P  0@P0 p` 0S0SZfJp J@ @0S00P :S $   P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!E5- P$ cP@f @d \T/  omP[K@t000^@0 J06S 019-P 3IKAAP$00P8'hH' ((T{ -<@L0S (0}/ }J0 @ '('|( p-0L R PP M]P l`PdphpL0@D@@80( ,0 B @@''|( -`PLl0V ``p0`C!VQA8 0`0Qe @ᢖ(|('' 0-L L0L@PD P 0dCPB00P0'|( -LMQ@,0 ``p+ PhEQT00?@AP*Z:a@ \FP X@0fPZ :,0S 0P 0hC|(' -D0D 0 LS:PS0C  0|('\ p-LMPK`@)P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x x|('\p -$!$A0LS`: q Q0 R 0B0 ֵ00C0 V pP  \P@ 00 R0 plP@p @0 ,TP 00D'|('|Q( -:LM$ `R pp p p p I)<&pV 00@CS                                                       D     <  ,      P[PHx(%p0XA P YW pW 0S㴀 Q Z0S0S  @TK X យ 囙7  000 , &004 080 pP ^00S  8  bRڥ#P@ O K0 Pp/P `g 0 .8KQ}yu(K6 U2^ # Z 000   7$6@  ^* p8PW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A0@ 0@ }ZPP0 d /Q00`Z  X 3R+h|dp`d\^ 00S 0Y   ZJ =q@N gb40&([@ ''tx(0|(\&8|QГܑ4(`@0     '(0$0PQ00'ؒ -0L`0V`Ppo@@P,@ p0PP z0! P 0$0  00(T( -@@L 00 00 D0 0 \& P0-LtP lPP 0SP@0  0,@P00P 00' -(@L0SS 00' -8@ LP0SS 00' -0@L0SS 00' -@Lh p-0`0C QL@ R pS0S T0P0Ppph,PP0&P00S 0P0&10P0` T 0 00P0P0T0P0 < $ -LpM|KQPt0: S K --80LM R 0 0 5+ ) K& P-L( `@T PU pXPp0 -R  |-@T PU 0 S0HLo- 00$0$  -R  h`-((&6\ --LM4@0 0 * *L)K& --LM@HH;-0 40 *( y*3)TK h& --<0LM R$0 0 * K8(|\& --LM0 @0S)0 0 R   p0  KUP0 R 4@,0 0 x* %*8(&&(''6 --LM\0\ @0S<()0 0 S* *8(&& P-L@ ^@P X0 S@ 딓 -LM@KWP0PR0PKK봓 0-LP@P0a0 S U딓 P0-LP@ T U  0h"0\(T0h&0SS   0SPS00Q00Q R 0S 0S R  -LM@K 8#00 R000  0' 0-LMPKD <00S@ @0@S 8' -L`\M0V,0  0d#@00X3 QP# Y+0x t0  0 S 0-0t0 0PUP  p R     0"20lK@ f@VR 00Sm x +Vn VG ŸR2 T l K0+p PU  R0SVa V "Q 2 0 +PUp0S +, 0Rk(K0 0@9V0@50 SS@@l K.l0[S t!Tp1 0xl K_+0p0 V0@l0K 0S/lK@@ hf@00S $ t0G+V  A+lK@ Tfz 20lK@ Lfs @Q 0@ x P@%+lK@ -@ R x+4hP  +Thԓ*@0T (@x{-0SSS 0PSP^(0000S 0 R00  p 0Sd 00C0X0X L P000P00 $r(( $\ -LM pK` ᪍@T P 00CS0<0@T 0S 0@ d X& ㋍PT 0@  ''&| -Q@LP 0= S; 05 @`p40 0^@Q Q 0  P  0RQP tH0^0   ^  <00,h$1 4 -@P#0L0F%T0?S[$ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ ($ $ ($ ($ ($ ($ ($ $ ($ T% ($ ($ $ $ $ $ $ $ $ $ $ $ ($ ($ ($ ($ ($ $ 9<2P 40S 0Qk R0S Q PZT႒1`@T P0 =PUSP@TU D1P;(1 P 0R@0R P0PU p0@T `'P Wp@TPUW |0P P00Q 00Z 00Z 00( -LM,Kp`P\ <WpV@ 0K@P> U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@  T  (KU<0@  0$0!'\&Ĕ{l 0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0(''J̔Ԕܔ -LM`00̂000pSp Q  Q2 R  a4P 0@`00@ 0060@00 00/ 00 R 2 R 0S Q[ 1Q;PБc 0SY 1P 0S4 !k 0S0;004 S 0S- (h1, ` 0$ 0 P@ 0S 0S $!$$ 0S 0S U 0S0  ZxPP 20 5x0uP0h;00< 00>xP@G 00'p(0(p .&&&* -L M0K pxƊ,KPP  RI Wx0@T `0S0C00$3`\# ~@Ty#V @GW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  w(K q@Z@ 0S㮪PJW`A00 R ܑVQ<PY  KG 0@0 t- h!P0 -  -0@ hPPF0  @  ,0!@#k괐< 30S0n  *x $0S T0P@F 0L'DL \&$p <H{l.l -LM$`K@p( ʉPTP  KP0 0S$ @ 㴉T0d0K0P 0 P 0S 0S 㘉@ 㒉@ ㌉ R@ $0!n@'({l 0-LMPK rx0P h  g}@8008, @ U8'ȕ p-0@LTP` `@T P @P`Tp -LM$pK` P* K@P'  R 0S eP @ KPE \@UUH   0! @'l{0000 R 40S0 ( -LM@K 8Ј40 R 000 È' -LM 4@, K孈%`V00 0 0000R D0S $p0``0$ 08PP@t0#SpTn 4@ Riၨ PP@@ v T$0S Q  $4 R 4LY0$(33 T:V @,K N#pW00x 3P \1 0S, R 0' 0H3, ( $  ,00008 2"0`p` ,K 2A>0@g`YN2    | 8 0p00% u(" 0S DD $0@T $($@T  " @1 1l/p!)@p )^ E ,K㺇X!0S = @!0S 1d`1@!@ 1@ @@81 v$Ns 0S 0 0_$@P  ?㐧@` PD@D 0T'(l<('p$(&0<''&xdT \*+|* -RLQ5 0S^ܢ܂P0Br `D@D \0T0rS Bb0S Px P d2 00U P@ P8m`t 0 "S Br `D0@D2 T 0S m7! 0Aq `D@D 0T 0Sd70Sh1 R80P0Hp00度aP @20S#  /0R 6 PC MP00lvC B00P`jCx 600xy`CT ,P00K'p|*' ..H-Ж -1L@TX pQpqpa@T 0Q 0S S0% P 0S @TPM 0R 0S㊦ 0SP 0S 0 R0Q`0  hT@QH0 b P p `(''p -1QL@P` @0Ǡ) #/Vpp 0S00 B%0 S0 R @` PD020@D /T0S80 R h6h{p('(- @ '|* -LMt R `4 R 0S044 00(KtK߳,K  lPPڼpKԳ`V 0@T@T 0U0,ß Q,=A A¼ ,(p0(c(Q=9 =t ,,00$b @(( Q$  =A A$ h0 cl Q=9b @ = $ $0H ,00, 0S|0C0 0SS0000x 00S  R R 0QS4 0S 00 S000000 00CSX@Q0S2 q 0Sf 0S& 0 S" 1 R  0S 0SA RpA #  0S 00SA> 0S; 1 V ) 0,0 000,`V6H g$ p @0V 8 R 0R 00CS0rTG00V(?B'x(| 8'\ -!MLM$̟, l( Pp8 d ; 0 ST  @T @0Pd( `( \8 , `\b TQ `X( \ \Pr !P- @\XX00SH p8S `x R p0 Bx p0`0, XQd( d( Pp8Sl\, 0dR(K0!S@ :LPK 0*0#X@ Xd@@hpQ`(\0" XQd( d( @ P P0d8  `X8  P T8S`,`X ` `X \PPU 9 RZ!0EVSVQ $0 NP $0N <00$ $ $@} 00S44000 00  0R 2 <@@[2 RY0,00e  P `> 0R, SK 0 , b  nRڷ,PL 0 R %GPq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, %*,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0 土 ; @('&'& x(4((T( p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00p0(, -1LM  0(,0 ( 5,0耟0P40 0 p@`T`\TT 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `w3$Kx((, -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B ۟101 ? @  p@`00`" l `L/ P\P< 4ϟ0S006 P P #P= i> $0 0$0.0S  奟Kb  P\P Ο0S00 X V V0$.01 cRKp Vh_ 8_ d Lc c b d c b b a a 0a 0S0C0  P\P ͟0S00 )P \XR `X $X 00p0= R P-!X  $01 P\P ͟0S0@0 @ TT T !TL 00D-T Stt  h 00  " PK@K T T T @-0KU l  P\P T̟0S0@0 r@TPK PL+1PUF 0 !RB 0(r0˟00; 0 0< 7}Xm |X (Xl @X*X ?X+X !X 'X \X4 "Xm000 Y 0 p`0)X |Xh (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY] `00 p'X00p1 IYQ 8 0`0 p B `X0k \X  P\P ȟ0S00$P "P3 P \00p|)X (X000 'XK0l0 0  Y D 0 p`0c0S e d d d d 'Xs @T1 IY' `@ pL"Xm \X@00@0C0(X@@@ J"X 'X|  000@t' P\P \ǟ0S00(P 000 Y[ 0p`0&(P gt 00 [[X`  -P [00 p| P\P dƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0h% P\P Pş0S0P0 P(Uz {U ܄000@ X0 0 1@ cRK @P P\P ğ0S0P0 P00  0 X  p`<$ P\P $ğ0S0@0 f@$T "T 1 cRKy pT@ 0\  p@6 0@0p- 001 IY ` p#00 p1 cRKL p PC<XPP>X V`  Af V` 00 !`ග0FbSRT@T0<"0P(RA  `{T0Su  r "@i  #@Pc 0` 0S  0TX   0TS < 0S (  @0 <0L1 ] 00 p0W S WV(X ;X |X' 1 P\PI 0S00CX\ |X&PF 000 p`0w\TA `T'0@0pm, 0R(Kh'&<'D'(t(x('( 0X'l(|x((,ؗ0 Y 0@ 0  p`<00CS0ih0 P\P 0S00)P1 IYa `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRK* p X00p0P@0  $PS p(P ,0 Y 0@  ` p 0 0 0 Y  K0P0P`| @T\T 0S00 @Vo o p pp o #T`6 3 0`/`, `(V&004p P\P^ P0S00X:PY %P#Pk0 Yw 0`0g#0 1 cRK P@P0$0[TKP @0S @1 cRPKm P00 R$♚4 P\P 0S00 41:P@00 P\P 0S00p%P#P ]0 Y 0`0\P `Pr\XD `XB X@ )X@@D@ \X@00  %00C0@@00 X &Xg>000& P\P 0S00 P Pd00C00S0&0 H0`00C06 P\P\ 0S00VX >P00S00 &P Z00 0|P0@00 000 0 7E` KPj 00p0S @1 cRKp00  0pS (⽙P0S pI]@00W  K]k  K  Kn$0 0 p)  K  K@  K;.p0S  6  0BD)000@9 < 1 ! 嚙1@0 1  0` pa P\P 0S0P0 PU W U p0U 1 cRK@P@` P\P0S UU  UZ 1 cRK@P@  P\P 0S0P0 P U 1 cRK@P@L; R, P\P< D0S006(P㐋 ` Q@ dx00( 0C p( B`0    K  K K0PB  KcVT  KZ/CP00  KN]  KI;XȀ |Xㆀ <&XK  XPP< " =R }R3=u (0(20@0 00 <   K  K0`!坘0 00C02 S " :2 d O.h>X00`0  Ka>X007 `00 P\P 0S00 -P0 00!!#U0000L -LpM`P`U @TD P$00 `P> K:$>pP000T\S/y| w%>@PPD0 R 00@`P NP0: Sl0 0 0 00W0P `?=@P 00$K4'' 0-LpM|P@PpP`Tl 0T  KP 0 0K0|0: S\0 08' p-LpMr'((!0S00cS1PU3 P K`P0: S 0 0PUKpP L0 `  `  0S h0R|8* @!,0S\ePX(`  4}*P 0 PHL4 |Q8 0-@PL 4P@T  0R @T0( -$0L@T @Tx( p-l`LPU R @0@Sڂ @T0 0PU 00px( -(@L0 01hx( -laLPp0S  0R/ R @@ T 0Q A@ T 0S 0S W 00h螖 v`V0 Re0 xP0@CTT W1HP?@0 P42 px(&'&'* -P`LpG㖖P@pPY P00 Q @x( P-@L 0 RP0S 02n T000e᪎PP80 R (`P@[P@'x(*. 0-LM( , (0$#$ R 0 0  ,0S2  $ 0S2  2m@P T$ 2  r2 R=(0< R? 0SJ(@P- 0S0SF (2 RB 00C0  R<( 001 R (0$   g10S 0S !0S001 R !(0< R\1 R( ( $0$000$0$0 0S (0S Q0SwP (0  ,P/$0 0K004J 0S T |0 R (0 R0S( 00(0d ( la $ (0 0m'(X(x(44(@&  0-00P @L@PP0hx( 0-L M, 0 40  00 ( P$ Y 0 R100 0  0 00   1@P P0 30S D0  0 T3 x00S 0 0000 ,00P 0$ ( @ 0@ 0S 0 0K04E     4 R $0 R^ 0x(\& -/L@P@P:P8:P (:P :p3hlt| -LM0SĘ, , 0(OK0tG/s8 (K "Kj8@-@-nl\ `L T< D(@ 88P @P8P @Pg7 0PC' )弧@000u:P'g'00  P7 0! S P @ T 0+P'8ǟ8@P0PP @+# D'P*0@/Sc &0S6T  (ݮ@-'O))' (0hFS 0S 0S0S`V\'0 0SD 8J0&06Q,f00$&0@ 0S t0P 0P 0P `Pt@0S,"R@T %PPP5 0  _PDQBK߫P1: S pPp/ 0DSxI0,2 f 0 0D 織$0( p`pP 0S 00TS@T  0lP X,00V00 0S3  |(K 0S r&)L0S  0)#Y9Pj0S)G Pa 'ҭ0P]k@T0WW`H9P wP0b@"P ᵨP[3P"20S n4"1S00} `1QS`Q0G 0@Ttd 0i+~<%Y)Pk("Rl g 0S/ ,K)^P P$P$  $ 0 00 KPBKP 1R 1Rp)07  00P  ` 0dQ0D 8P6 x`90P @ - EC('x(\(D' (D(0t|s'^4'q '( |(|\@(l'4`&x@'̗H|$З|`HĘ0&l -@L哓P@- l -LM0@0cSz bSz  PK  0`S R   0S PU  40!Vā t,((0 "4P _P@nU- k|l- ` 0T00  R000 R8 # 000 R( -L  4<0< R808R;\0;LD<4 ,@$h(,ĚȚКԚP 0-0@pL@P`"s00f-s@P 0 0     p-0`@R0 000 LPq0Pf 00 p Pp-L phDXPXG@<`P u  phPpx( - L@v P  mP -LPp f`PZ 0#S@Pʅ@ -@QL \P PP@1*@U0S pd \0P`d  @pU p@j00 -LMxP8 < @0 @庐H14 8 xrP``HqrTXp V8ʕ `grPVPW0 ,P V @PV@PX4 80<@ , 0|  V  ] YH4(Ko@ 40 00 V0``ppѿx( 0-L^ 0    0 0 S0h@P H0S C H @0 @0^ '^ Uh\PH0S C0 ^U0(eP0h(@,&XM  P-L@Pp*`@U0S)Q |Q00W0S V  ,6@P`U`V*蘍 P-L`H* p V0S@P*T ?T [T ]T$ |T' )T/ VX00S% z35P XpX0S pX Y 0X0Y0S X Y:0 !S ]SppZJ0S0P ꘍ -LM@PTp p0 `V Rc @-Q@ 000#+Q0Y00-SX `SR 0-Q  0 p@ p@:V?V@ ,V;V00,0 0:S0?0` 0402 ,2 `h 0? ? (K#V )5P :P& ;P$ ,P5 #P0 `@V4 !0`W ,0@000@@ R0p00p 0 0Q  0Sp0p @@,0010 ,0 0 @T! 0 0 0`@0;P :P00 0hP0 L0 H4P 00(4P` J($4 p-H`LP@@%T 1S 4Pp&@Dpt|0 > -RPLM@ D - R*D @0ZD @  ҅< @< S@ < RD Y@0 SD0SD ?SV ?[S S D <0RP (KS:SI0CSD  "P D@ 0PpBSV DP  Y, 9 Z@!':,0`C@Z!: 0P   0P *SD0 S @@@ D  0P T@:,PX< RD  P D @0R`@S DP  Z8 :p@@@Z: 0VP  0OD0P C  0V EP@Z*8PXuD  Po @p@Zk:`DP  @ 0D&PPX  0P`Z*O< RL D0 RD 000 0R40  [R w RF R Q] <0S < 00R00S 040 Q*  R [R(0:S R@@`:g3P 0S# 0S ]\X4 00R D DP0]S  0  S   R( 1pf@T P P0S @T0-S 0S$ ^0:S<0S 0P0S40  s R2[\0:S  0 @0]S  S  0]P   0TP < !R9 000 7? -LDM0QPp@$0 P$ 0R) Kq`qUPP0dP@Ud`K /2p3 0 0≌`hx(`| 0-LM@P KL!0S  P00Q0Sp008 0-LP@P0蘆 p-`PPLP p@M PBp 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0Kht|'x(h| p-LMH@P4 `0T0 @ Kp'T@ -aLMpP0Pp' PPR 0000p U0HS0 0Q$pP PSQ U00R0S00QR R @K$ ᓌ0 :'('' -LMT0Sp! j W4|1  DK+x t DK|!p@ 40AT00#`9 oT" ?T WsT0x1  8$PP%U 0T0  s%U (K<@T  PS0S 1#0  VV<00t1 VGl\S@0HS LQ@%T80( AoB* PAo܂Jψ0S 00 Q0W002|1 t0-S /-P 0-SXRDŸ | b`8sPpA `AT go1(K! 0 DAHQp1`Pp P%Up!>KD40D !R 0-S-S+S 0SP h!0S#0D0 \ t1S Q D0! R  t1S 0S "0S  09x\ D 1  Q 01 0Sl t1SD! D  ! tD1S1 0D S H<zPt|'x|ԙl HP\&  t 0-@QLP]0 00h0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`2QLM0< /SPw .S8 z < pW 80S40 00 ,0 * 0S:S00S,0   0S:SS Q ,  gP00<R04 0 ,  0/S4  0  000 4 ,0 Z 0SR0,0  0c0@p n P0 bR.@  l80S<0(K40@ cR4P@4 l4 0 Sp/R/00/0Cp@80 00< .S0S/S000#80 pW{8p 4p 0p ,p m0@ cRP@ l 0 S/R/00P -MLM0 c1\, @ TPA @/T@/T T9 ///P `eP V9 V:  @/00 0 0  cR@B^K pPEJlPEp P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/SW0S7m`h} -LM@(m0     峈00 K 0  fP 0Q/0000 `ೈKx( -`PLP$ l@0Tp kU x0U p0hIPpT @午 kU0PPP'@(x(' 0- L @   0 0S[ :Q0 a/ 00 0 P0  00h  $0 0 -`L p 0SL;z ( S , 0P@aT#T 幪PP@`0S[` k` 0Q$ 0% ` 009 0`j`0i `0%` g000 0= S, Ӈ@0  d0d`0 0 `)$00 -P L`pM WP@T 0P Wd@ j0 0 dX`0 WXDp X0Q@ i@`Td#T! P`@`0S#0 ;0 00$ \WL X ~j 0 0h0 0,@ 0-@PLP k 0h0 p-LM @`, v  0`KS' PK+ 峩P P0S  ;0|0`$0x R 0 B `0xT8H4 a$0`0p`  Xp -LQ,Ml0P ,0 @ @ L  P %P0`H0 D0 .  R 0 B 0@@ P0 @00@0 , 0@R(KP0P0 L0 P D0 L0SLP aH0 P H `PU 0ELSL $ | l ` w0 A @0E0 P 00D@SP 0000 SH0D E  `L H D `@ `| 【 `D w `t `q `n `k `h>A0ESD0P o 0Pc0ES l l l h l l 0 PP  d0EP P S񟗺  P0L0 `L ,pK4!000c00R0guU L R-00gg|+00ggw 00ggrgq`H V0<0 Hf< P <  = b S< @ P0P<0SV@0C00 @0T  0S@1T@  @ <0S@0 B @TP0  R@T@< @ r # 3,pK0  g \x0X0 G0GpB00g0B,pK0000g 0S000gg  V@H` ʼnک30#P0 `,pK0倐80K3P0#P0P 8pKq 30#P08PK8pKg P0pP0 1WpFi30#P0X -P+PI PG 0P 0Pa0SS 0C0 00 @`FVp@ 0xS0SB 0C0 00 @ p `F0P@ =@T 0 B P0T @ 0T  RqT @ 0T@0<<@ 0a@0 0S 0C0 00 @0p0`F0P@0 TQNh(}̄ --LM0 0 K 0-@LP! u  :? P  &P0 : @0 P@ 00 00 0S P0 X~0PS 0@0 0p  ꤝ - L @ 0S# & -*  P ~0S0 0S0:0x6  a$00p 0+ R0 00$ 0꼝 - L@ R 0 B 0,p RН -P L@3 T6 pD `Q!   OP 00a0S@@ fpW   0Xd0P0 `\p Q V`T` -P Lp! X `$R9p R V@@ f 0`d d0Vp0 V f0X ` |0  0-0L@P 0P  0000   ,؂00 0- 0LS@P P Y 0P 0P 0 0- 0LS@PP BPP0  0,壂0,垂0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppEžk(0l⒂@x($ --L4MD@K0B 0 0 VK -p-PQ L4M`PP 0L@K0 0 0 P6Kp< -pl`LP@)# T P (0V0W< `0``0$     xdzTu jP PPp P PPpPp|\ -l`LPp@% T9 V`+0 0,0$ (` p ` P  -/ $PPP P PPH[ȁP 0\⾁00@0x( -@`L#0pᨁ00 0,0< (0P }@P T00ӧ2 0 o3Q00 ϕX@,Gx(@- 00(0   -<0@L Y  @     x( p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@,X0T0@` DA .A000 0@@Pt(x( -RL0pS@3Q0@A0T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA ΀A000 0@@P41P``(P``Q 1&`p`3)P``0  0&`p`3TEP0  0BS Q` L `P H040R@0@ `w&x(t(~~~~~ -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  P 0  QP 0x  X\ 0KT  0~8>p @8~ > @0@40 8 < .~@0l S` 䝟0P0=URMUq0KU t tt 0KlpP `p1@U@PBPU$=p}t Pt 0SS<@40T*``8 ` <@ }` t0X\*` g }tt(KEUR 7|<U 0U6^0< KX0 T Lt  t 00K00Sb 7 7P_ {P0Cd0 N0 Sh \ i d0P 87@y|`0pSr 7 (P0@@P0 '00P 6 |P  U:@f DA e|&A0P@0`PM|P T1@0@ f J|)]%0S d0S  O\Q\ hp p0\p S5  l5@f DA |A`P  %h t0K 05t P<@40PT*$ + <@ <@40T*4lp  `<@ S P0  ylpP`t E@P 8${  0 0 ,43  PwU*00P3@f DA {AP`@h3  &0U0;0g0S7<80 0c0S7`3 R@C0S!,3 P<- `X :2@g DA q{A@p`@ 00Uap0P`!Pt, <80 0c0S2 R40\C*P00< 7Hd P;Pppf0S=TBp f ,{` Q81@` DA {A @4@ @8 < (8@1@` DA {A @4@ @8 < 81 @` DA zA @4@ 8 < z&0AA  zA`P)P806`t 0Ug Ps  Pn | PBhx( p (   t(&~'r  u8<( -LP@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00Pp  0007{ 0 @Fz0@?z P0P0 :00 0p0 p@(z 0p P((x(P 0-0L0@  PP0S p0P0S 0 P 00,00X'l(( 0-L| Gt0@T P@T 0S  ,0 00 0 0@T0('} R 20 R00 00 0BS 0 0P0 00BS 0 0-0@Ly0 S@P0SL 0 0 R0S0eCA 000x( y -L\ P0L `01P@U 1pT@P4U 0S XP0 -p@L /yTP 01 R1 0d?A1cX0@ P. Z$` $ ` V AT 0 K 0B0S 1 P00S@0`0C V0mxxgfff -LMZ, 0 , 0 0J @01P`U ,  1pV`P6U 0S,P(K0Szʊ xw,]@x000 @0 0P, [00C0P̟R    T8 0S 0  0R 0*.T0S R 0S 0  R 0P *. 0- L @P 0Q0   Q Q 0 00  0<  0Q0    0000ܟ p-L M@`!PPP4  "   0 R)00 `0`S 0` $K$` 0 0 yKpT$ Kx$ 0R    ' P H, -P@L1  !R 11* 0-D@LB^T @ 0 ! T @0*1 0) 1x* -0L 01!"Q0  !Q0 $4($B0TPt`q40000嘠@0P`0  B@phTPt`q4=  L9  @5<  o0*x *+,* 0-P LP@w0T̃ 0 0R0q03 00S  H0 R00 0h00Q00 0000' ' 0-t0p@l l0LB^T @ 0 0S 0S T @04(*<(0( - pWL` % 0S !RRP, 0@l@   p <00l0d@P]PLv  @ 0  ; 0  6&T'' p- L@PT" P0@Bn0 0S T @0S UTp@80 000 04(*<(0(0 R <( |0p-"L@P`T0 @ H0  0S40,  R߽`p*4(<(0( -LM04!0`p Q 8P ZP0U) P@T WKP ZP P<P| PP L0UP KP R R0Ղ"P(*.4 p-L}L`P@T wPptP 0@0lPpt<( -pPLPH Pu0S P @uP0u0S P @uP0u X @T `Pzu PvuPruou@Tiui_u -L0ML`K@ B 00P St   ,         S@$N(K(HP CP)=):@$5(2P -P)'K|@(@}P@$ p{P PP @0TPS@@ `0-L@P^$?@0h0S 0h^$?0h p-L`P0@ S 0 $ $ 8 8    p p VU@ PEP@p0P@SP T0TSU S 0P@SP8 p-L`P@et phW -LMP`0  t0 00  S 6 00R  0Sbt0@0P PP00 R00  0Sbct0@0P PP00 pW6 @TgGtPU%  , X"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU 0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ ꘥p( (0 R00PP0' P-L@ 0 p-D`L0@ PR  aC e 00b 0pp p-@QLP! R `0 Q 0Q 0  dC 000pT`  0Spp0 aLC 00 0p 0-hPL@T\@D P0R  P 0,0 0S0C0000x p 0 0  Cp 0-4@4P0L  C0 0 0p `,0R- 0Bp P0 0lT( -pPLP@`0e R0@00U0C0P 00 0b@0U00P 8 0U000U00P -PL84M4$< 0$4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<04 S _RR  V^00@0"0<0pWS0N 040  VP\ 0SYW00S 4 0 R 0 V0WP ڐ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b2`?ÐY 0@m 0` S PPT M0 V0 0C V0 0@p40 W!0040  V080   0R00l 8 00@1V@8 0P 0 qS 0S  ~000PU@8 0S  +@R<@ P0S x0 ~0@0004 S  ,00c0(KP @>@ p' -`0` \0@L @T ~ ~$0$  0  -,@L0S ta0000' -L~h  0- P@L]a0hYa' -L0L @R TT^h~@@$hd~ F~@'\ 0-@P LD 0 00h p-X`@LYaPUa D0 0 p' -LM@Pa0SW P 00|q$K(K0 @,K @xy`PJ (1 ($; $0V0 P,0AP{E yP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6PꌥTpDN  -L MK0 K @KK @ y@P }zK -L$M@PPb0S S P 00唢U0 ,K0K4K8@K @xP U@ `EX80SF40qD`@0,0,  !{xP00SP 1T0 S/R  P4y1!1|1|!@@R(K40X``pwy1 @ 40!A< :yXpPPU U 40A+y5P40< pꌐPz CP00dQp X0P@@^P[8 4|4PꌥXpDN  -PQL@0 U a\`V T 00@,00<,``4<P x< R 0R0Bࠡ0(K4< @6 ;+;;;" R% |[y0S8cP` 0 @c\Vty\ 0` cR@0S0C08J0 >0 :  `>Z cVH:`V@ :0*00fc@A ZWP)00@rTJ0 0 P@0S0C0c9*9)@@ >9@bl9l9X)l9V<94)`Y89@@ < 5P`FVT P9 0S0C0V) 6HXPn0 0 08! R;T8(@8L( 0S0 0008 HPIAV QB P8  q 0 QrQ8 \, 7'x7@@\ 0`l7@D7嬧4'@7 0S0DW000Q0 , {>1Z``g ? P, 0WSwS0  r 00 0 0R@s B 0d -L MTPD H P兡դ.Pՠ^0l0ŘnN cR0N 0NRlN dN`.0ZH.Z  9  90  c > B >. =-@@PxQ4  P 00 S w@t) R ] 0S 0S 0S# RPTs u hu t t ,t ,t ,t s v Xt 0-0 0 @_00,QB T00^@  T  0 TPPU Q` Q < R B 0AL c0  9H< 0S P&0S S S00l000S 00OPm 9 ^0 0@0$0  00bv@t 8v 6vv R8 0 R0[ 8PȟȟH |P 0S cQsQ CQ \8P'P8 pq 8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@|O= l u uJvH0 SD Q 86D 0 0 (Kl&0SDƟ00*Ɵ0 ( 0b00v P)uT@T[ H6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T (0STS %PTdd| | | | | } } | | t| y | | y | | | | | | | | | | $} | | { h.P' %@K# 00C0D0 R84 0@ L4 P 3ß P @ğ@$a00@P P0 pg00x3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ž320P~ @ R B0 0P0 0 з0C 0 0QH2P0" !@0S 0 ` aU71 0 f0b 00R0bP0`n"2`<0 @0K0` 0PFP @ `vPE`X@ ڰ 00 P  a7 1 0Pc 0/T PP  XPzbd.10cSsS8 CS6 2 xP cX )0  c6 00 0; | x \xT(tp' & P$ ('px, -"MLMŸQ p,  S P2 R P R+ PP 2 RkKAAop{ hV~8: S}BNK@D@D XPw +;P 0@(K0$S RM jBNK!@D@D0+nPP X$ ^K!PEPE0+nPZ ;`;VP +5+5Hj 5: 0p P0+5, 0R&(KɱdCRjj jj~jmmuj|rjtmpmhjj+g50cjht0ȤХ(Dl  0-L MP@P Q 0SP R:00 0 0K00+j((j %j !jj0DXt -LD0"3 00Q@0P 00Q謥/ -LSM✀0YOKp $ Mp `IKPK@dK 0<@.$ 0R K*mսhtd@A -L$M@0P0 , 0S ,S0 0,SS af\ n\ 4@K 6  XiS 0R KSi 唽hԦȣ -GMLMȑ0Pp,0 h 0S@`LS@( ,S0 0,SSBKHH j   0>pP< IKAAimp: l41` V,0@SV1S   Q RQ\ ^00\0S l1i`, 0R(KD&i 8ulWl $olihT4  أ p-L M`P 0(0P`0,P 4@0 0 0 5400 PPKph뤥p0 -|\< 3|Nh p-0St0``QLP @3!   @儠@Q0S pQ)hz$t0Ч -LMMMNnK`F0`F@/㸀K,0 p3[K 3"K 3 3 K !0,2 0 (2 $ KPP6NK@  0 0 ONK@D0@D ,2 ( $B t t K@ 2 2  2T NK@x(, 0R(K k帻h(Bp p-LM|`0.^K@/0 2 ,K) L0 DaKPKK 0RKpj医h'B -MLM0PQ,0 ` H aT`  p1P +r2TpaT cTL CT hagT0#B:WCTGWC^KPEPE/R2$3$# 3( K@#(0KV0@ 吁  1 \  0<p@ JKAA C0@3S3ꔧ P P P P p P P P P P P L @ P  P P P P P P P P P P P P P P ئ p \ P P P L 8 P (  P P P P h X $.p$0cP1 @ P`T  ,0K j7ttp0 < R#@0U U U U0 @ 0@0 0@0 a3 {#0 @P`0P D0 q3 m꘣1 0K@0 x3R_ 0da0<0 XD3P#S0#8 @P`L K30H0 G0@P`B3 >0@P`92@ P00@ S`4 . 00K@ |00S8#840 `"0 @P P `D 8"0@P`" 0@ P`8  @ ! 0@P`080 ! 0@ P`8 110@0 1 /2(KOVB 8 9V0=8VIp. $q$B D@P+0V oVPD  0@0 P4LH a|at\ ^d"dH0aXaPa4x0(t003|0B(ج̨\H -LMd`0@V,0  pܠK?PK@ + @060#0@@T z    C  + @@D0\0#0@@T ^    ' T, 0R(KܠK I@@K   p`匴h| -LhMD` VZ, P@ , 0Re(K0Cs e*P  /VW 00p0 0  @x t l@ | TpK@PK|l <0 ( p@ t |x0  0pRZ h@K  0@B0D0  00#0Q Q V@1@# 1/`V |  | d +J$0T0 P0 L0 H0 D0 h0 d0 `0 \0 X0 @0 <0 80 40 00 zh -LE -0L 4$tHp -LM@P #sD!~pt1` fRAP !0000CH!0?A1cS @PQ.Q00A   S$K.Q 0 U0S,K,P ( LP ꜀`0`( ?Vᘠ*Ac 0VpS0C P0V0C0pS0 C RZ00Jl gfffA 0-,@,PL( n j㫳H$t -LM  \P: K 㓗p* 0#4 MP; K ㄗp 0#4 K߁pd@dd d0TD @,8 ,0Dܭl@L -LMp D F`P= -FPr "P< @ 5R ϙ0S㘂 @P *p2DmT `  VPUa a(KH0 0(P@@D套< @ da@0SO ᏙPG00L ᳓P4$, x1ϠA/ 0(@@lN#b 8K80 4 0@ , JP aP  o ja cDP D[ Vꪑ0-SL0S K Gꛑ<@@  l0 R \9D,4r <08343@MbP<3\ -LnMxoKH0H`,0 p~dP%L3Q ^P03 R;$3 RAP, 0R(KI0S  6: Sl KAAHdP 6: S lPPv6: Sm n]P, ("]P KAAߤP;Kc2 [1 R |A@ga Px+a0: KP`렑0SQA00CS0P0P0 Pp 0S0P!0CS030 Pp0yUYUw {aNK@D@D P! KhaPKOPc g^VYTP|G~pJL@TPqPh<3D3@3Ю@P<HJk -GML Mp2 P@, X"|p fP. iP% ,"|p 2 PbaU52IKpJQAA(P4: S X>1 11 1tBKAA +\ P: D\d -$ `0V/S /004`04 X p5 p@/ᩗPP 0PST @T 0/S 0/S @TP,0 S`WpHX  (lPpհh@3<3D3 @-0@S00-\Q\ 0 00L S0 ^!00 000C\0LQ0c0 -LI\L -LM0@S K( ~p 0 _: -LM0@SKP g  00  -0LS@0s30 RP 0s3 -0LS@ h? =  -L@%P 0=_ 0-LP%@P P 000)_ 0- L0@T) 0P0Q 0S =S 0S <Q >Q !Q0 0l0 \0 0XPP <0 e 0,0 00 0 0 0L3P3H3\ 0-\PL0S S0@ S 00@0)P3H3 -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPR0P Sv` OQP V?KXrP 4P=@hF@( 0R$KP.@JOK <V [hP3J@D -Lp` Q( T (@T TT$PP P T0 (ZZP3l -Lp` T0 0 00b00@T TPP P ZP3l -LM넃`p@T T T TT T$KPPc (KP^ 0D S4 4 H H H H H H H H h $ (0Rpprp{`$ (0Rppecn`$ (0RppXVa`$ (0pRpLJU`$ (0Rpp?=H`$ (0Rpp20;`0D S񟗯 ` H H H H H H H H , E `dDPpp `VDpPp`IDPpp`;D`/Dppp3`" KP3 p-L|`P0S @PP 0PS pP3 p-LT`@0S PwP 0@S pP3 0-@PLTliPX0H0@ R0S(峑F뵭9JlL3P3x! -0L a㢭$tH-0 CR 0R0 S|00 -PTL8Mp`@MPP NP@"xpp3&@pK0K`< , K00 @` '@P,00,0 #PPY , $0< ,0 0 @@'P \B\XK (pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PP?40[S  5[0Sl|{t `@L0VU D00S8 W ${(K(įܯ@ -0L ݬ$tH  -0LAM @Pp  uwp sPp  kwp0` fRAT (EP㯬NKFPP W+.3PP[[hdS@L -LMp@# 04 4x8#Ȱ, ච @ P0P#00 0P00S 0P@T*0 "4b*4# < 0  Bf 0t@P?P; @0,K,3Kz 0$4R SR8 P 0S@P{Pw 4#0SP *`4# (83 0` 0# 0# <0#0bSJU:YU @34S00 @#RFl1@  >P1KoKK˟K0p`P 8 1@ P,K@T00L S 0r03.\0SRU   P,U0p `!PX\0 T 000  ,0  ,0 S(X(Kh0X77T3U77X -|1LAMt.0pd( AP"p{W@CBNK@D @D  -4[S2  -bS fS! !PP Ƞ 0(PU  @MTFW@P`V 0S@BKJ H J` (0 S$Kh8h -BML M2.0x, ?APp V@BNK@D @D  14[Sr FmbS fS`ZZ  Z0 B1!QR& !84g!<!84_!<@lt!84U! <@DDH!84I!z PP& Ƞ 0P -@T  00P00S  V@PpW H$0S@ B>K0CCK`I 0C I`FpH4  ,0 S,<(Kh8̰x 0-LPSR Q LP.T 0.S @PTa DA0D0D00L -LM @K0  0 S0 0 0 K  p-0LSP`! 0S0@00 0 @00c b0R00p000000Sp -LM0.0@|B0SllRP  XXbp<,KP 42 , (00S S0B,0 , 0BS $,0@p0#S #{Pp/0P p!P_P!YP0 0,0  pg, 0 S S R ,0R0!(1000,0 0P0 S S`` 0@P@PP `P ` S S@@  U 4 P @Rp 0S@@0  8080KL 00 1(0 @(K8P$980(=78%= 0 00D8 0-(PLP 0@T@0谥 0-4@PLP 0P0谥Pt0 -pL P` 0S  0S0 &yP @P8 -`Lp0SqP @lP 0S@PP -LEMƟPp4 l 0., ?px@Qh @ !\60Sl4 p04"48Sl Ɵ & Pl 0  D `PDDP5  ep4SS00d4 H DD@$00D4 HD 0CNK şh4@D't@D`tD T$ ` \ Xt L P$  D  0ll @PDP @ T*]P P*X P*S ` Vp*.UU Xd$R, U*`4DS*xğl  t4PPtP DD`@` E$@@DD t@$4` dPUt}D$C0D4 p \UCl  t4@YPPtP t$D4xß@ cT`vtZD0L D4 p$Uv U U3 U}0DDLoPH$0%20dl  &@PD{PbT$`RD4Ÿ0 `"QW*D40` tR DD#@DD KH2DD<P L 0% x0B 0W,U <K "<0S80S40s T\DD@#@@DD D4!00SD :\4AS:P\P `\4  \4 D4`0D4 ZTD@TD XL|X  V0#03Z0STQ% P`$0``S\4`Hj#D4@ cTHD$0D4 h0  CKA AX T0`D0  ,0 S@(Kh88$9%=087 9|8 -BMLM3@0|., K=8 p  XZp0S00SS & 0S0S 0s S 0S S pX X0/00 S 00 p2 X X(BNK@D@D`,KBK@@0(("@P@O Pd0 , !EPP@`Fv, K dBNK8$@D @D  424[S B>K0C P㈑ 0C B`<4 @$ Cl bS fS93I@P4 Ƞ@ 0啾P@$ 0PP!}   0 X 8$0  0 0 p0   *P`VU<$0S ,0 S4(Kh80\d(=7  -tL M.0p`Y<p`X X   #005`/00 2 .PጽPp@00D S/0PU0 E&0S.S'  Pt2 ` ՔlB,4PbX"X<,0 @P P0 ,K("2P{.U R0t 2000D :mP 1 0:T,PU0R.S%  IlP0`0Q`A,D1L!L`P@P P@u  0D:U .U 0@K  00[S `P0K$ bS fS4@P Ƞ 0EP  0{`lT`PUV 0S(K808(=$978%=t 0-.L0@\n;Pp0h,0  P0h08G-M  T 0 (0@,@ P 0P`p4`08@T` $0<@P<0  0(,@4g0  .,@P(8P 0 0<fP \  .,0 "f.,@ 0 @P<4( 080@ `p(0, 48D`(P,`4Lp8pHPX`P@0 @! 0@!0Q1@`P@!@0`!!LP0hH. .pI$HPD0&E$ H`D0#j0 0 0#j 0P%@@X@ @^0LP@D PpX` DHL@PPTP00 `0 00D0 00H000 000@000 PL`000$P0 00Ѝp -LM@ D1>?  08^P0Q8 n< ?^Q@ n< <P@ < 8 <P8 < <0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko 0-PL@U  0#<00#800#400 R0 0h0 -RL`? D@A1>?0( @PcXPp: @0!0@@0D@e@0!0@@0D@~@00 @@0D@@H@?X X  Pu@0!0@@0D@ 0-PPL 80P A@0@0D@0p P$S0Sᔳ -L0MpQ`N 0S SI0SSSD CA$K0P $0S("(04"48#H^0"S* 0' R@ R@@HPK 4 K0p ,@X 0S S00@ K -0L@ `pPP P   0 0 00000   -0L"@ iP  -L4Mp! 00`( <0 PP0C@P, 8 KNP 0R R@8 KP<   7@P <@PX0K0S<0@0 @<P 0@ (0 S G$Kh -PL M.4 080 /pP 1` _ p@ @>l1@h`QP0000,0 8 p0 0"`P(00 ػ`P0  D., 0P 0 04"48#80@T4ZYT0 Y  Y  00 ` `(K80 p-ML M0@P0`. #8p0$ AK@T@  3 PP 0@ K4P.SD@ 0pp @a PT0  AK@@J 0 S Kph80 -LMZK0MH$ KP(@, @@ ThZ Z ZuK p04"48S- K [K K(PEPE: `4e 0@P P ZZ:K Z [K(PEPEnP 2KTTZKK K(L(NCKA 04'ăPN 4@@4 A$$0B40TKK i 0fPP P:K4P:KT@ ` PUp @ZKTUZ3V+K4ß =`PKP K KKPUU@*K$0*K4:K  0KⰔ ~ZVV Q VOV VlK DP ZKŸ%4"7V00W0S0V00W0S)V <K <0S80S40s :K4S ZK0ⰔKPV P@$*K w:K4PZKTZKK\ K0S K4K@Q j*K$0*K4:K4PCu:KT T0#03\0SK^  KP K0  =K(0C*K0C$=K(0CZK0C$S=K(0C0C H0 <0K   ,0 S(Kh0 -!ML0Md KJKZK(@(@, @,1 K(K(N.(N0 (K0000 0000Pp[ T: 0S?0S<0S90S6075"0"S2 `V &@>0Sp(@\ 0S V Q R \S  R]K(PE(PE0s3SS S00S K(LL@^00K(pPK(LLKK](N(LJKN(LPMK(@DK$A K(LZKL`JK$ZK(PEPQ@LK$A LApPDLQ PQ @ EPP@(`F@ZKL P 0 PK R 0 R QK R 0 R Q0P@S K0S0 0SK 0S 0Y3*K$! WP9~0SN:K(PP JK0  @Pg ZK( pPK$@q Tm jK(pPbpP^ 0 K$S@0JK(!  %PPZK(!0 pF \P0 0ipK(!0 pPK$P, -0S'0@S 0S 00SS  00S SPKP0 7*K40S &PU pW:K$1S JK$A0SZK$1KK K@T =K(0C0C0SYpl8(K0ppZK400Q\_K P 0V P RR:KJK01@   Q 0G Q \CPRK0 K0 0S K 0S 0.0xN4*K(0PppZK8D KK 8 㚹$7(K0SK8  N+4P*K QbS fS?@ :K< ZK @`PƟ0P0 KP *KpFQ00ZK0Q R* R. RK0`S 00 0:KL?1 0 @?Rp0@`P@Pl@  @@P?0S@@:  eo -0L M0P@ 0 (`K  !X$@Tx ~op` 0 P Qn/B(K 0 SKh|pt 0-PL@U !1 1 !320Q\ 0hc 0 -@LP 00dD -@L*h*`D -4@LP ѾPdD 0-L@(*P0P@ P*0`DxD -LM8 Y< pP rsp4 2n zP!P20S002 (sPP 20S00#30#0sp3Pq Hs0k,`  P00CS00 Ӥ0 R r ,Kpx80SWS P<,Kw0,Kw@P 0K Lc00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 00r04  0(KdD p-LM@d`P)P@ 0  =,0@0S )TKp`DxD rS-@L`P"@3:rp 0P@r@rp p-LM@d`P)P@  0  ,0@0S )TKp`DxD rS-@L`P"@3:hrp 0P@]r@[rp 0-@LP 00]),@r.0 W) 0hshD`D@=<= 0-@LP 00E),@r.0 ?) 0hhD`D@=<= p-LM 0`|,)0tr.@l&)PX!)\00SiP  0`P@)KphD`D@=<=dD 0- H KD+@0 @ 'P,@@ 'KDDHHDD -L  -LM<`00P,0 pKA8 < 4 p 1S01 R rP h 0000 0C 0SP q \000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qv OQg XQl LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ MlQ1tQ6 qQ1 sQ xQF zQ. uQ?PP0SP 0S0 0C sK@@0hS@@0lS@@L@@ 000C@P  P4# z@KP0pKp"KP4 n0^S  0K_C0 S RJ!- KK0P-S ]S S@Q00]Q0SK_K0 RLP9"K @P3 0p0p@  0p p @p p 0Oq (000 @P 043 P 4 0SkP  00CS000]P r p000U񟗱PE E F H J X  PT*00<PP'd 0hP Q 0tP 8p8 X P0P CU00  RP U.( K001SSU$@P0X0C000  0SP Th (K001SSPTc 8#p 8# BX @ 0@ B0T0  RP 0 r ,U000 !P@ 0C00X0  0SP 0 r 000 8 0d p8 |T0HˏKSPU  ?K0CUU>|UXPxPPE7| ;-0 <4#{<4#   0p@  0p 0p @pp8# 8# < 0`Z H?K<RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000PX   _K@PEt{T-xePEP {x{;0 <t0p@ <t0p<s0p8# 8# P,`LH(KLpW g ( $ G 8 0 Pl lPl (K0@|0@00i^K@PEPE FKDF Lv `V XF \F bKAe.K  Bm>K' 0C'cKKI7 A7嘗  B 0C⌗' '7 7I L@A BlG tW 北   ' D7 hG TG p$DGFoK46@%S@D  0PPD T `TOJl10lVJt`\&X6 R0X6 \& t |)P2jKt l' l' U]K0@ PE@7 DG p7 < -6K.6KDD @G 0IZS ] (p (p ] (p (p (p [ (p (p p] ^ (p t^ ^ (p _ _ _ _ _ _ _ _ _ _ (p (p (p (p (p (p (p tb (p (p a c d] c (p (p (p (p 4` (p (p i (p (p (p (p (p k (p (p @m (p (p (p (p (p (p (p (p tb (p ` $a c d] c D` $a p` (p |` (p g i k ` (p dk ` l (p (p |] (p ` d Dg@L -6[S -&Kp704P Tʔ1cR@`00C Q$SD6SL'0D D6`SAp@G @ Dg S @ @  p@'R[R} b@' p70p7 S+-KPD0*SD `@ D7@5< Tfʔ1cRb@`00C Q$SD6SL'0D D6`S !pDg S!   p/<' ȟ T;ʔ1iDR05S@0I QD7 $Y @Q@dB40K-0C+0S T30Ks>K0C` "00 0f7 P@s>K0C0 F2K F00LQ : dw4 KEWeW0020K000 <40K cY`' Pp0P7 ; PP 7<'QPPRp7 pp p' p7  D6S1 `> `:pp p  D6S!p@ D6S 18#X `P `p'D6  SQ`P`  S 1P` 0 P` D6S10P`P`,3L7 x0  .6KDP㊡H H   Hx3<\QH <' 'PH' `:pp p'  D6S!p7@ D6S 18#X `P `pD6  SQ`P`  S 1P` 0 P` V(L p p  D6S1 `> `:p'p7 p  D6S!p@ D6S 18#X `P `pD6  SQ`P`  S 1P` 0 P`pw 0  .K 0-6K<<Yp0̣p 0Q04 KH' I R 4K2H 5 :R3 6A0  `P`H p+ 0R000`H & 0"0 0dP`V U00 DH' 0D40KH7 Lw %2 H>&B lP`H H40KP`dU<P ڂY 0 K☐K-6KP7 H' P-6[PYS.6[Sp70x7 1@w@iTpx`*tH\&X6 R0X6 \& t |PjKt @DT0tp@\&X6 R0X6 \& t |Pj.Kt' -6[S b>Ktw0C0C000\& X6R0pX6 \& tw |PjKt .6[S b>Kt0C0C0 /&K000\&X6 R0X6 \& t |PjKt x'R1@7@iT z`*tH\&X6 R0X6 \& t |cPljKt @DT0tp@\&X6 R0X6 \& t |KPTj.Kt' P7@eTz`*tH\&X6 R0X6 \& t |1P:jKt @DT0tp@\&X6 R0X6 \& t |P"j.Kt' p7 twHP\&X6 R0pX6 \& tw ջ-hQ,Dh d'R,<6Sjtw <000\& X6R0pX6 \& tw |PjKt <Pp t'00h70\&X6 Rtw0pX6 \& tw |PjKt <6@cTlP+t(\&X6 R0X6 \& t |PjKt @DT0t'`@\&X6 0RX6 t7\& 0t7 |Pj~Ktw <<6< m@6H\G0`T@Tt\&X6 R0X6 \& t |uP~j.Kt' \w?@cTDnP*t(\&X6 R0X6 \& t |ZPcjKt @DT0t`@\&X6 R0X6 \& t |BPKj.Kt' Hw<7\S pHw p t00h' \& X6R0X6 \& t |"P+j>Kt7 @6HwK0C0CP H:0$ ,0 lS(K̥ܥhL -DpL0`S@PP 0@SP船QRP000S0 -LM0p (0 PPUoK0K/sKP@'L1[S  Q0P,KKL1 H1 D1 @1 <1 81 41 01 ,K[0 d: 7:K/rKP@ .( 0R$K h -aMLM䢟0(0 P|P: p@4 [nK=K`F0C0`F+ -K$0K B B0T5 u\e E 0p 4o/K*Ps.2$ K0SPd20S.cKAA~rPb06: S"  S XH( 0R\$K}P[nK`F`Fl!l1o$0K@@uTaD[nK`F`F+^$ K@@uTaD&@Pj^0S L$ K0uC@PX dMX |MX !.X @c8~0ch,wd edAе<8@Dxĵ\ -L@P p Z1W1T1T-at -LMPp^00!1 /8 儼@P +"`Y10(KyP`" +XTp` 0,@ ,0 Z,0 04 K4@ 0@ ,0 4 0 5p@-]0`0]0Sv]0S8 0p P*xb` a8Td \0p P*4P`]?00]?00JH,wd 8 -LM@  K K0K  @@PK 0-LP@OP P 00.S0a C00C SRQ0 -MLM, P* P@:?]?000!eN, 0Rf(KA»`P0B~KpG@DpG (K0 dABT`PH qP1 @4娻P $壻P 00+4L P*:]?00 0(N6P  H+P \0S 0x NmS\0S `H 0N 000 M$n}h̶ضHܶ -LM8 < @ pPP4K;  t@P1 4 D0 S 0C0 BPP) 4 `40  @#!P000S ,K( `P  㲤P@ 0 M B@PUaݽ(K @P& 00S0 KtP 0 R ;;R d @P 8P0< @00 zP@̶Ě8D -LM< ~ 4  0 `~ 0  -^00+^   Sc P`X-^00+^  P00N.^  .^ Sp4 8 4 R;040 P 00E.U  .U SR40EQ7 Q  A1!O  4  4 P P 0O(,  p^#< [00 (KR P`800S80 o A1!O p p1  0^0 QQ \["00`_p L1  0@!100 , 0 K @ QP` /  06V4A4 ,00 R2"40`S S  0P4Z`000,0 <0   U7["00zp4 Z0 -L M4 0 0?O4K#$XY8  0OO$ !5BE;t  ["0 0(Kr \B 1W2\ , ~  0   @P04K 4 0 0@aQP#o` P`0OO${p' YHZ0 Rr04K@4 0 , 4 00@G ,00|03P 1 0 Z@0\A04K@4 0 ,H!4004!8 V0 r/, 40 0 8 t4cQ4K 0=4 0  8 _Y04K@ 4 0 40ds04K@ 4 0 0h -LMȠ0`p  (0 PPqK*P *( 0R$KUOK 3 SK3,KK3,KXK/95KP cK0*zh -LM@  K K0K  @@9PKR-A ^ QQ 0SL\* -L@ßSM 08@ p040 < @ 0@ Z0,K00<傤PP3 ,QW 0U*@@0S 0S Pa ,@0SQ  E04 SA, QP 0 ST 8 `q`3R`V2 X 00Y00S! 80S  P 8@ R 8Y=   0R Y5   R008E0 @\08(K00q@P@ 0 ,  0,08@ 0 `8eQ\,  IP,,A, \ W04@ T@0 Y@0 W 40 S Y@Q  R88@ 꾷 p-LM`0`@K KKK`KTPP +0 000KpL -0L: TPL -$0LM KUTPL -ML M␢0匒`,0 ZPplpP 0/Sg T Pk BNK@D@D+BNK@D@D+J^KPEPE D 0S :S S000S S:S  0SA0W0 0S /SIBK@@P 0T 8X@PV00SV00S040 t, 0R=(K0P H0+:_P 0SPBNK@D@D+wP 0S BNK@D@Dt+hTP೰BNK@DD@D04  P: xhL̷Է9ķ P-L 3 c@pP 0S %S@ ß V *00SS@f| (Tt0%0CMS   ȝ t d X 0PUUwWx 2 Q PP U W1 } PP U V*PpgWP Pm Ux cUh Vz*p!?A1c000 Vr*P!?A1c!000c000 Vd*!?2c!  000Pb`*`(P;/".000bPE4p P10/A!b000c"P&0 U0@@P@ V0*%00" U,0 R@ELLM8gfffQ p-PL`( 00@ SP$.P1 *PP @PU 0B8 S8 7-@PڈP@Tp1  0B00@ S!0.PP00@ S 00@ S00EP" L"-L@Ÿ  RP`@ j QuN:R^0Cʠ &   B b< 0`C46H&0/p0/Ơ@ Q a@ p Ђ0T/`P@^0SR S PP n B2c `@0 T/ 0:56!ǠP `Uv00p   0j 0P`10 Q 0 0P` -QąL@P$ML@ HP @PD SUp`=TKTA*T 006P%0\! 0aa9s&1x'x )8HR@J*RJ@@bP 8#8R0PE*RPE 0U0D L H0 RLK p(KT`V:4V006$0\0@f(&x80 2 *j 0j7C93&x40 < < 4@($8HRR[R0:4R005%0\, 0l\9c%)x'x )8HR@J*RJ@@b` 8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KRPU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 < < (4!8HR<0@0C<0 :@b`48#8R`F:@b< h8`  )8HR@J*RJ@@b`l 8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00 U @ Ax@ 'x0!8H,0RS@@A@ >:@b = `)0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 F갍R0@-@P l^0,00 nSBS\N_0 0- L@0@PP $0F00A -@`p0 0V@TL A 0@P 07BsP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& < bX%X L)8HX@*X@@h P < 8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT`VW:4V006T#0\@f< (&x( <0 0& @-/@d4xB 02d @-M)Ѝ@4=> 0 #*@ -L 0KM# " -LMK  KP K -LMK  KP K -QL M@ K0 0#0  90p03T0S00#0K -@@L0MP 0 0 D 03000 K( KP(KN00 881* -RL p@@@pT `v%  P DP 0AS2 0SQ0S 0S .P 0S0 .SQ00Q0S 2 0S .PQ00áP2@-@T   0000S  0P0S  0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠ ZP2`P8@KE X`PEenhP -PRL@`pP@ P00PPPPPP p- @0PSL`R p0S 00   10 0pQ)03 0 00  PD L T \ d l t | xtplhd`\XTPLHD@<္d tغlT4* M0-LM0 0 0@ P5K0\Q0@-P0@  % < ^9  $ @ H d ^@7!10# ^00S10# ^00S3 @\^` 000  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^: :!20# ^00S  0D ^Sp 1  0~ ?^*^ #^[^\00!0 !@00 00 0000@@000[^#^ s @1  0y0\  @  0\  @  }\00 L0 R,0C@000ĕ@p0\  @  i0\  @  b0\  @  [0\  @  T0\  @  M0\  @  F0-  @@ p-0LQ`P @0 Qf`00p R-Lp`P@@D 0T0C 000jR -LM8  Bp`4 -PK 0e@YX: yp`WGQ< L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @80S00Y*<Q @-PK0 B0eS`40c(K@* -@LP 00U p-LpMP@T ᠖ KpdK^`P P L0  0: S KO0 0J P U -AMLM0唣,0  @P |<`PW B^KPE PE` XsP 0#S 8 (  P @ @@P BnK`F`F0 PK0DT P 0 P;04SBNK@D@D +ٹD @P PO B^KPE PE  qP 0#S   P@ P~  @1P Po BnK`F`F0 `0DT`  PZ 0 Pܙ04SQ%`P& `ݨP `רP `ѨP `˨PX `?@P00, 0R(KT` <jhUQĚUZ8<Tp$, 0-L@P0PP 哨P0U 0-L@P0PP ~P0U -80L R PP UUP@- ^ 0S^@0 S 0SS00@0DP0 4U -QLM@<0 zR| 6P8  h0 p 0Q `pY:%o$<0P  0Q0` pY*0@0 0Q"0h 4 ,0 @ 4 080 R@4 0 R0PI@Y :&D! 0 R0P@Y*U p P8 @<0P  0 R0U p 800 R4, Y4 8 (KI0 0@< PpPp< P@`**yy*QQ*vv* 0J -0PLM 0 K0K0 P  Kk* p-L`HPPp@ @ xIP T  0RpH0S p( ;===*ii9* P-L `hJH00::(*))$* -0L MK , K0 0 0 P 0S$$$  K*SS* -LM KPwt@G-Q M 0@90P@Pe1A 00.b q($?P @RJ: 02!!b?P J$0  \0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00 Ѝ =00ꫪ@ -LPp@Q qP <2  0=QK bKP T W6Q@T W@W @W@ X*0f1@0 Z0 fB10# @  Z0 fB2"0 Z0 f00T P =QQ q 0  0s 0 0SW 0S Q q D0  0q 0 0PS@ 0-LM4P [[@[0[ P@K08U* 0-@PL PU0. @ 0 @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ 000/U$0 @P F@?00JU -L M0 0. K @b2b 90GϠF*""B*jj>*++:* - LMK0 @ @ pK..!* -p-LMP0U0  @ 0 0Q a0 `PU 0  Kp` 0Pd  ,K K$0K@( $@ P, PP 00LY$t6La@77** ** p-LMP4K@1 K70! K,@ 6Fp`( P  K,0 4KOPK$K@ J ` K>;v$Kp K ؼ,pX 000 P@ 00ӑP 00ӑ0 S000Pa p-`L^P%*00@ S!@ T  00@ S00S !000V0@CT  \00S p@ p@-0p@T` P 0 0  00a^0200C S  00C 00S 1>3 01 -L@ X 1:%\" \0PS0]S0phPU ` mP0S PUW kf萦 0-L @\*0S:00[S.QPQ*0R0.S :06 \:00]S p-0LSP@p `P @ `p p p-0LS@`P\ 0  !p0P  -L M@ 0S-: @0 0 T4 `4\ Q| ?>   cP"T001 X   R!*0^SE ]S6 -S000 -00-0 -  R%*0]S PU-S [SY < PR*0-S' @ 000 T   R: 0Sk 4 0u 40@^Zq9  0$@TfJP0` t4 ]040 4@  @00 @(KoL-S G P0:S% =S0S0* 0-S]S =  000  R*0S*0=S  0S0*p0-S]S P r dǟ00   r 00  PPg7@T ` P0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<0 㭋P  㧋P  000(K0P  000   P`0S  @  e=0 `R 6P h@P@ P) @ q mpZ hQ d 0-S]S* \& X R|*u P R,*%PP1P 0!0'P 0T ^001  ^0 f 040 >00  0 R (KoI & 000Y 4 Y& ^J 0@ @ 000`000^Z040 40 0 0  0 0C0 4 40^ @ 0@QT 4 0@2000  T, 0*0,S  T R# ^x p0`P  R00!S  00 R0#SP0^V 0 @R4   bB"(Kor 4 $00 ]00]0 ]   R !*0P0]S Q*-P0@0 @P#:T0]S/00 0]Sp'P 000   PD u040 0 p-LM0K KP` 0 ^00K K0C B@0K K"P`x -LM0` @8P pw 0  0  0S04  4pP 0KP00K@ 0]0pK0K K@P -`RL@PpP  0!R000 p-L`\P p@  A$0S0$0L0U0L0 P  1 e! B 0Ap -LP`@p0 S#T TW0 W000S l 0 L hf`  f00   fB  f" 9 B a  h/@0 fy  f$  f"  B a   BpG`@  f0T  fh/@DpG`u(@D`o -LMP\@, *0^S) `.U ^*U Q*0*S  ^\S $U`\?* RP%*P U5 \U $ 4U* 4Uy p>E0CS<0pC!`H0S   H   0H0^p0 0D4\U0 SP,0X [UG JU0D  D D` V1 0  j R *0Q0\S \) j V1 0H  S@R*0^0\S0)Sn Ti3UbLa G\NXVR #Rc [R R @0^@@R@P(@a P<@ @Q  >3S \00QP(@F40 00 4 Q 0眀MQ @00BaVP 0R 0R0\000XyR R RL>310>#R R "R (@@(@0>3S  S S 0>3S +R@(@7\ BK.8K K K 0R:K PPSEe -t0 LR  @T P0R000PPP<PheEQ*M*I* -QL0 M4 0 0R000(K00* 4u@PP- 0 P0S p`@!P `@ P$ pW21C0 R4Q  000W |G@PP(KY  0W0021C0 R 4 R 4 0W00 p- LP@P` x`P T,03040S000 R   R0 \00p** -LMpxf`P 0SLXQ0LL!PmP00P00@$K(K BP (0 RP@Pʐ TH*LP0SMR kR mR gRPAx1*GR KR R P&*L(P8PK,PF@JZaCdL,t@*<*uu8* 4*0* -LM Q00    K ` K  10BS)000C 00S 0 0S0 00Q:  -0L)S@P 010CSQ   1 0Q:`pV`` W0S P`P```00 p-0L)S@ p010CSQ   1 0Q:P`UV P pP 00p P  Q10C 0   Q-L@pRPPX`VP V V P `0 B  d00GPP00 Q-LPpR`@@, P 0S @V000 B  e00 0-PL @D0 0-PL @90 -LR0L0@@PT@ lR0  0 R B0 0  -LXpP`@@ R0DTST0S: 0 ^P` @UTW YPP Y I00 P0 0 0QQ00 A00  -PBRU`L@0R Vp Wp00j d00``p P j0@0@@b00P0PjQ0PE0P -pBRWL@`0R XP UP00j d00`@000 R0pp00P  X j0@@@b00uP0PjQ0PE0Pbb* 0-LM 0@0 @Pu K0** -L8M4\( p& < R R S @-WP  l( 0R'$KR Z@K2 ^|PU`@ PU ḖPZ@K024 Z@K2 @Xh:99* R  #R , R R R  R "R, \\R0 0 R00A0"S0 0D0  0 S S S0 0 0APb -,@LP &00Tb -4@LP #PTb - TL0S D 姀P  P q 3  00 qQ#Q cs0 0n0@S0000 0PU L P q 3  0 00 0y |P q 2  0 00 0g jP q 2  0 00 0U XP q H2  0 00 0C< FP q 2  0 00 01 4P q 1  0 00 0 "P q p1  0 0 0 0 p P =Q hPP@Um0#S+ #U) @0PS0 RP  000 0 R r 00CS0 Q#Q 0P  0 S S 0@S0+ @(Tbpa8bPbT%p 0-LP@P P0 -LKM䡟0TK(0 p@ںP4K@P/0j VXW"( 0RV$Kx l 0@PP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR8"66T-@P JP 0R 0GR SKIPP L1R H1R,,,,V\h8 0-TLPA/H0P@ @A/kPP05@P\bXb0@-0PgS6 -S@ XS4 +S6 0oS6 uS= # @ @030 010 000 T 0301000gS80 400S 0 00 I@@-gQ@ oQ uQ =Q! /+Q -Q"\00  00  00 0 +T -T =T000`0R0- 0+\ 00XQ000000 -L$M@`T750 0(K4@K00K 00 B6P6 :P8 P00H S 8P p0P< 30D0 a0H@SX*'''''*'''''''*'''''*Z@ =XR@0=X0 W@0 :<⌑ < `P 0e0 F pP8 0D FpH R W:<00⃁<0 `P 0e0 FpP8H0XD *pX ,X +X -X=X>@ =X @ D0H0 @D 0X0C S񟗦*&&&&&&&&&&&&&& )&&&&&&& )&&)(( )&)(I@D0S 0 Ď@D D R  @꒠@I@Z W:<  ₑ < t`Po 0e0 F pP8 0D p=X @ " H+X00\0S W:<  ₑ < N`PI 0e0 F pP8D H0X pH W:<00⃑ <0 3`P. 0e0 F pP8D 0w@p_I @H [D '-D DD D0C>0D0 DΌD `   ,K$,0P R>0SK 3"0 0`0+S -SXS S P0`+S0 -S0   +S0   XS00P^ -0 0 `Q +0 0 `\ X0 0 ` W@1 :`@Ppc C808 =0 08Tj30 01 4!!* --LM0 0 -H0@L`P8 4T   "2T$tH6\\*;;* -Hp`LP1@P 0S 0S0S $ -|pPL@P a{P 0P `X{P P@P0S $ -LMr0Sm (K }Pm ( 0 S RL0L(  S*A (0`` #RᘁP X0P`PP`ŅpP @`0 S S0 S S 0`P< 0P0t!0U 9 P@` 3P 00@T P P PPP@ 0V*@qPPąlPX00XX}P:( 0` ``cdchgxgh -(@LP ē00 0 `c$ 0-LP@LP }4 0000$$|} 0000`c$E-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0 -PLM@` 10 0$KP0K(K 00 , PPp VT(0 (`pP  0 PPp  1@1 @?* p-0LM@P0 ' 0S$ =S" 0 S =SSRPd`K P X0 ! 0S0 P xs1 00x -LM0@ =SS=S$  0=SS=SP$Pd$`K sP! q$0 A$  gP $0 1 0S0 YP 010 0p R`  0S0a`L;PP  0(pS PP@0 0 h -L M0`S=S00, p@P 0S=SPf, KPA ,0T00@K00 (K P 00 1 0S0 P,@PdP 1 ,0Q! =Q =S 0S0=000S0ꐀ R4   0S0aC140 P @P < 0S L 0@ @4 ,  h -L@$h@P0 @ h\ -pLPr@Tx` *P00 @ƥT? R<`",\N0 T\ hh 0-`L! 0THP80!@PP@T 0*0P00hh* *- 0-Y+ ̌!00@  0 --LM0 0 -L@Pp/\0` TT奃T  88 $0c̓  唃P$tH6|Q -LM0  K ?0-Pp1@ LR` 0S `P P@ ޞ0S@D0S00Z0 HhDh4h$ ?0-Pp1@ LR` 0S ᆾP P@ ᦞ0S@D0S㉽00Z0 \qXqHq$]]*F\z3*3IϠ$*0 !{ -LMşR!  ,   e! e 0@A0!S1S UK  xş@K0 K0 X0 T0 P0 H0 D0 @0 <0 80 40 00 0 0 |0 t0 p0 l0 h0 d0 `0 \0 0 x L | Kx Kt,K p Kl Kh Kd K` K\QX0K1   @0PC⅀K  BPp0[ Q- Q+ T*00K[q 3  0  Q#00ӑK[ Q #00 ӑ K[  xBPp 00.L0l XKK, PHK K K K K K K K K Y=P@@!T 1S Z0T04@P!TU!X}w Q (Ÿ, 0 R(K  KpG.0SX0S p !RK   U X K!  L ?0KK1 劲PXK L00L0 60[X KS060KI0@K0 1 K0 0 q Km Ki,K e Ka K] KY KU KQ-~-0 A 0{-0  0u nNh{h=6 0t\{ p-L0M`0@0 P HK@00@0 H KQ Q Q -00 0R Kp0$*Nht,t,t,: Sb00 ^ Sl00  Ss00  Sv ?00 r0-000w0-000!=@Sx00 > SS00 ! SS r0-0t!00w0-0 00Rx00 # RS00 ,1R8 r0-0!00w0-0 00Rx00 - RT00 0R 0 0 R-00S-00 Sc00  Sd00  Sp00t00 00 s00s00R-00 00 -00dd*KK**%*%ooz* u*zzq*R0S 0S0S0  R00ZZY*''U* -0CLMs,0 @ Q* 1 RPIf 0R) 10CR 0YS!Z0s3(KZ 0S  T1R@Z TK  ,0PD0PSpYW P0`U00S00 P0@U 0U 0R W`P0@U00VW:0S`#@ P0 S@T 10P`@0YS?*!]:-`0P P000P R* -`LP p0W 1@PPP@U00Q R @1@S ޼ Rؼ00 -LM`qpP r 0@r   t00 ( pDW PAbRP P  0  R 0S 0禼 U@R ូ00P=  t!, Pc 0Sa 0 0 0S0 g@00/PP  dPk0 0Q 0@0A   0, 0STU Z0 0 ,P% 0S4 U, 0p 0  R=*@0p@P  00p  001 0  g0S S1J0 R0(Z0 0Q0S S1J0 R0)Z + @m i+0 0d -ML M,  @  pT2 /T ` 0 @C@T/TPP  0 W*Plğ, 0R(KRs/T ` 0 W:/@/T W: 0@ 0  0 S00:*P/@@BNK@D@D+PA 0@ ^KPEPE(P5 0 0Z/S 8: S S 000 0(PNK@D@D+bP( 0S B^KPEPE+VP@y*P 0PZ~Pj*P0SNK@D@DD+㋙ 0@x $ Q 0P@ 2( 8 P. 0  0 S00b* .R2 Z4* @R  W.0S0T(*  @0lP  D0@ PP 0@6 $ J^KPEPE_0.S @P+P^ 0@" ,PU8: SQ0S /0 0IP! f )P0/00=hHlM -LM M:K0P~UK4  >KK0C*K080K₎KU, @H ?U@B [U4 *U00! PU5P(K R*K, Q 0 ` I/*K, 0b5 (K*K 08 <R 0 XT5R L50PP!U00S !U[ @DP 0 %< 0 P`].P 4!Up0:0C0Pp00-S@= ]SH P`[U8#80@0:S0@ : P 0]SLğ0i@T 4Q:0 RR0SF @T 0 8#8000 @-S@]Q 3 00p]S@ 0#< 0 PUKLK*KA KKA(@4 0 Pa*K, QJ 0x :KK0 4 0Q"0a1 0 0P[Up`]0:S  0  nK`F*PK*KV8`@*0S /S  *K/S 0 R@ 0S00 R *P* 륷P*K0 P;P" U R^ 0*K S C  0R0S0 U L1 (KP\˿PK0P ]U@Nc< S *K, 0pb@P@ W(Q@00 \  0z 0 0P@P  00b\^**?[`-]:9P^ -LM0@{SD {P T႞KI p KI0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  0(KV `F0}S0SU0[\ 4,\ T:P[\0]SS   0]SSST0*0VU  S:0S0  uPp00{\ }\V`F` -ML Mx@,K`pPKF P K0 000  <R 0p Qr q 10bQ KK @ @ 0 S L \S0N0|S BL.0K^: X0 Q  R00   K\@奅墅p 00 p 00  P Pp 00  p 00 p 00 p 00 p 00 p 00 p 00 p 00 p 00 DP @ 80 R00CS000=]ꈹRR*R0S0  RR B0 0Q0 0Q*__**A*//*aa*P0Ȫ -$0L! 0-$@LPP$P0h p-LM$`0PK@.0}}P }P 8c,00SKp,00 -L8M$@ 0PR 0`00\pK@` 0` 0DK} *P 0 \0 *X00S$K,K,0D0 \` X0 *P  -LMpPW $K$`3S Sh 3S\ S S WS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSu0S qXn 0P0A >Q>30Q,  0P,  0,0 ES @J`@` 0p3PT 0Q @0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @b|zQ& .Qu,  0@,  0,0 DSP`J  0`tP 0 `7Q 0>#" 0c OHQ QD 0>#" 0c O0 @9G-Q` $P @>3 S Sw 1S S S @XSO <S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sv @USQ0 S @MZI0   @h80Z @=3S` Sf NS >3Sp SC S S =S S0^Q>3S V + >320 " `0^j&S@ S0S  R r 0 _R 0S* Vr 0_R `(KS S V `0Sg 0 S0 0^20Sj 0S0V S ` RZ Q0V Sa R* Vr 0_R V* r V 0R`!>3!>3 S0^yS SZ Sh @>32@d00 _ 0 0 ,P `0~x00^N0r `|0 00^<00 V0C 0 >3 a 0c  P A>30 @C  1>3 SA 1>3@!>#"R@D 0  @P `+> 28 0qH D i @ < H  R4 V 4 0lS:@   LP 80P 1 0P 4 10 ` @>32@d,0 _ @ P 0 wPJ0,`0  0cP6>3d 0dS0 000`0r` V` -L,Mp P@6Q >3S` Sf NS >3Sp SC S S =S S0^Q>3S V + >320 " `0^j&S@ S0S  R r 0 _R 0S* Vr 0_R `(KS S V `0Sg 0 S0 0^20Sj 0S0V S ` RZ Q0V Sa R* Vr 0_R V* r V 0R`!>3!>3 S0^yS SZ Sh @>32@d00 _ 0 0 ,P `0~x00^N0r `|0 00^<00 V0C 0 >3 a 0c  P A>30 @C  1>3 SA 1>3@!>#"R@D 0  @P `+> 28 0qH D i @ < H  R4 V 4 0lS:@   ᖶP 80P 1 0P 4 10 ` @>32@d,0 _ @ P 0 wPJ0,`0  0cP6>3d 0dS0 000`0r` V` -LM`< 004 (@40 0P8 Q p0 0 AϠ0 @0 S0 0,, ,0  XPy  X| , p R@ ,0 S T  0  Ppg@TP2W  X* x| p00 00_X00So 000_X0S 2WX ,0 S sS 0 , 00_R00SHA?G0CSE@ 00S 80 寵< ZP]  4D0 8?, 40 P0 S,0,, ,0  XP00, ,@ Rp0 0 0Wpp@vp 0  PpP,  R r h  0, 00_R0P Sp X x $v0O0(K -LMp S, TQR Q0 Q Q Q Q  \>0A >Q>30Q,  0P,  0,0 ES @J`@` 0p3PT 0Q @0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @zV 0 @b|zQ& .Qu,  0b@,  0Z,0 DSP`J  0`NP 0 `7Q 0>#" 0c OHQ QD 0>#" 0c O0 @9 -LM 40 \  ?R(00 Sh 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0p`  ` p(K x0`  `p`d \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0tH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0aH E U 0 \PP 0 R HJP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VDP|<z" t u$D L0SPXf H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` lSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ᕵ ` \0  H 0XXpWDP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0HeE`0DP`X M<> D L0SaP_X0@O`0DݮPpX # X D<XD@0`0 R T`0 CR` X0 X0(p0R RXꈹH`0 CR` X0 X0p0R RX꘹* -L$Mp0`QP 0 " @@KД0#" 00 P 0@0$0 @0 <0 80 40 00 ,0 (0 0RKAbP `b8h -LMX0@K`P$0 p ᵔ$ 0R KC8h -MLMK@ , p p`CPB@F XN 0QMOKHHV !+ D+pP#  xV'0OPU`d@ <`@ ph, 0R%(K U  +pPL@ $HW@UVKAAp X4U0eʶW$7  h 0-@MPL 00}K0 -pa`LP @3`P` 0`*P0i>V1P Uj!0\1 X -LM ßß0 4 , =80 p\uP `hy @TT PPBT  ^PᤳPV 0Q0V0SyOPBTy3 2@ ZR00S0BSmRJ 80S R 0 0(K1 R 40:S  04S11    0:S:? RUp1 R 4 0:S XL1 ? (1 R 4 0:S  :`0 R0 R 40:S 0S 00   040C0 :R:?Q R,0 1X 000 <0 , 0L08(` -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  `uPu` P@t  00 e00b 0 000$0S0 R#, `4V ]0 4A@-QPpU4,tP @t x$0s`U h$-Up 80Sb L 01S[ -Q V :Qr 4 tPm 048 0pPF 3#0Ĭ40P -Ru44 v+Rs44 o-U30S5P(KLsL3PHu0 , @00*#@d00d00P00"0P@0̂0s02`p@P:U@30S0002 R 40:S x|p2P?P0Sv,r,"P(2u a  000 d0b01 s-U0S4rsP 8 0R0WU0S0 0;S7 :S 0S000|D00 R@!0:S 0, 0R01 !1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 x0h  Q 4 0:S010048 0P ,(J -LM@@\K -LM@@QK -LM 0F K*7*7tt**$$*6*6PP**33*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 * -LDM\\`, 0 \ /00@, 0R(K^PK2 1PY@(00P0Qp I00A SFs@Jrg P!00@T8Q 00A S`V:/QQ@ .Q(%00A S"P00A S  Z R r@rg P!00@ TQy 00A SP~@00/r@P00 ZPT@ 0@dK bd0S@} ^@00x0XSxS r 00 D~ V pp QP. ,q* !000D$  Qx!00ӑhAqdPG0W02p0 `VI:00p3v ! 1DW`F/Qm Q@Z t 0h1 T!V00h!( 0T 0Q 0S SS 0h1P@@8e4 80$ 0 h -LM 0wf맩0H -LM0 kf뛩Hl -LMdOKPp` <, 'P @, 0R2(KၯY  ὁP 0S S) 0KK P00?@T00V: KK 3 %0 0 X 3 00SKKLP G@ 00S Sh$ -CMLM`P@, pP, 0R(KQ#T$  Q  2 P@T$ T0S 0RU@X4 & aKII (3$C.K B B 0P L pK 0S 040. S  @P P,g P #$0:, $0 Pp0( 0 0H7T,P303 D $@ 0@0 <0 $D0 T0 P80S$$0BP> P0$0:, $0=,(Ko; P 00T0S0,0 - PᰜP T0 P X RP0 0P, 0P,  Q Q-L@PP` 00p P$0 S U U P T$0@:$080@S0 /R $0P P (pP P>:H 0-0LSP@ 90T@1S00 -`LVp$0*-0Q4X Q#( R> 0`VR 80Se 4S S 0$  0R/S@/00(  HE`$0  `# 0B8S P$0 ᴿP 303Q $@O 0 0RK 3P 003P80s 0$ `8QC$0 0`S003P$0@P( H$  /KP XW @ᓧP ע(P00 00 `\P  % :$02P| `e34 $0 PX Z HP6 04N 0P k 3 03 P 0  Q 3nI0S  0zP} $0P:$0dPt $0 P 303$0`:$0+ ``' @ # @$0P:$0 0 #0 0 #0H -0LM@p`  00 00(K(㺞PP0P  0P `00$@0 0$0 P aPW jPO 080@T . AT% Ḧ P5 T@PH 2 080 $  P03VY`, @, ,@ ATVX# .P  03$0 X ၚ 00 ywu 0 *   6P$00$0JH -PL0@S0( 00Cp0N L0SGh6,,`0S ꈹ -LpMpK`P 0: S < 0P0$KP@ПP P(L0@0şP  0 ( `(0@`( 0 `0`0@,``$`v pP 0-LPp" 00 R00S 0p  @P  0@ 000q@0 0-L⎽p@P  PP 00 -L,M0 P 0"pT0 4 rpP W ZH oP0@P0PC$@0P(P@Z%0`)T0PcT0P`@HQ000 00 00嗊(< , @D <D PTu*Y ,0j 0lS0P`S& HQc0X 0\0 0h@dgQ!Q H\a= 0Q0 W:WF*|`d0` 0P  P0ZH0 0 ) R@100*0 Tg`g $ 00 `0 0R*@PT0PHP HQj 0P0 `0 0R:  0gY@(K0T0Pg`g " 00 g `0S @t:0T P0H\ HQI 0\0 HQO,0D< , 00 ,, DD CHP0 0Q0 .HP D0<D 0 0 @gHQ 0Q0 4 0P0 4 0Q0 ỡ T003HQ,ł 0P0 P01 T  `00PL0 T P0i@0 T P T PL0i0c80 T PT PPT0PT PPT PP@4000 0P 0 ! 0^0 #000 0\ 0 T P`h4,0, 0Q 0 $P0 <0)) S@10*00Tg`g $ 00 `00Q*@PT PH\ HP 0P0 `00Q:  0gY@4 0P0 4 0P0 tT P\8T08PPST P(0T00`P`T P)@T0@@P@ 8T 8PP)@T @@P@ 0T 0`P`11* M0-LM0 0 0@ PJK0 p-LM`PQ @Q NP0fCKp000C S0 U -L(Mğ PK<KP0 L@ Pe/h孝`< @ 0S0  @ 0|S :S 4 R@ :00$$<: <P#DKX00X0< ZpD0ß<(0 <QD0ß00 <JD0dß,0 <CD0Hß<l@ K40P@Tv3 D<1p3D00 ,0Ÿ  80<%2p8 40D0Ÿ<0 <pD0Ÿ:0 <pD0xŸ:+K0 t .Kt 1Kt 4Kt| 7Kt hb'aP`@HK<  6PK3PK0PK-PK*PKp00% D04K <0H0<1K 0p H@T<<7K p3 H0[S0F <7K@ K'P@F@0PqU``0D p 8]tdQ0@ < *@K0pH @ 5T P(1<00(K00F<.K PpH:pF @@ A@F`< ypD080#80;@ t||| |l`D!T̿ $(,0}X4|WEV 0 ᴫ@-@T' :T@0@S S S 0S@ S@^ :R ^0@S :R^:^-^  0R R0:S|S S |S 0R:SS  0-LP# P 0Q @ ..0 A0 SaA\A0AW AS7 AT0XQxQ@@0 -Lp= @P@dP`d 0@:SS   P0PfdVP `d P@f IP` D`V  -Lp= G@P@d㭚P`dP 0:SSo ^S \S0@ PUPfdPl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SD00U@f ᮘP`VD`0T0 00} 00z 00w:00t00q 00n00kS -8@LP d000 0~~~~ 0-@PLpPP2d0@@0*LP00ܙ40P (0@ @00 ~~~ -MLM@d  ^, ` h8 l p( @0S`WP loPm  㩙P 0pS LH T hL(Q\(  h 7PT80T8 X 傎KHH`YP 0 S 0Z@PY+h8 P `0 SU0U@E\S 00 HX #RR l%Pp^ 0:SP P0:S0@0pGaP@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@ဗP H0g gg0 0H( `pPH @ e|40(x /HDH ;Pg\P: 0g@pPPX(RhcH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL T(R@@WX\K@ 00BNK@D@D"X P)*2 R% h 0壑P l^K< PE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L LPh TT X hchy@hc@ 00TT a 80P  pT000\H H8 X Ph H*"X\!j@Zg@WWbX(R2 ]s@ 00JፖPp@Wn OkL@D00phH 0-@PQPLTP Sp 0w@00 P @PR@ 0S S*||* --LM0 0 ̌ K -L`P , !0S*0 R r 1S0C1@pT0@ `0@V 000ZPp`d x 0S f D ̓  0f ( 00S ꈹ 0-L M0KK \0PS@H80 H@$@ AK0"000@@@ 0$0%Kī -LM< t<0D @  Pu 0-U +U 0P8 80 D@ t 3TT0U RUD0 ?4 00 8 RX 4 K 74 K `fV0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cD^mR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K ޥ4 K ,   W# 8 V0& ,@^00S0040 ` `Pp X"00P`q V"00P`q W0 W0@Q RJ< <0@ 0(KP8 A0XSxSEP D 4 0 C -L@'T`p@P  @00#:k0cS:UV@ 0r`p -LxMXOP0 U80   0@D0 @@ 4 40 -SX !T!T!T!T!T!T!T!T!#####T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!T!#T!T!T!T!T!T!T!T!T!T!#T!0#p@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp { /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S H0SE0 RT4 | r 0@ Q  |040|0 R! |0S  P 0BSpچ0R`|PU 0 CR:ʇ!00 p0|0 04 0t0 4 0So 00Spxp 0XS xS 04 00S S`  x s4 @t@ |x 0 O 44 0+Q -Q,A    00@ S4 30P404 0P 10@S&40P@p p 4 /P 04 0@!00/PP9PpH*0aUS RaY T @l@ P 奥 Z@PD@ @P @:H A }q@Pᓥ 0 pD @ YPP` 0j@T 9 DKbqD @ 07 MSp`p dp \p Xp )0@ D0 `\ 8QsdOs\Ms`KsXIs#"00 4 s dPⲋP`  7dPt8M `8 0WcP` d \ X  0X0 \0 `@6sPd  ! ⦐DK, K00KjsP8 tP\ P`, VPpPPg00ࠡ࠱Rb  B alR 6cT PbP @0"00C`T0 T @0` @T00 S 0S p pc@c`cU \tP\ d 8sPP` 8r8P T8sP8 U XdtPd M VdsPd E W\sP\ = d8@sPX 7 0 0\;rPK X\b 1@PdPKYe u` l h @5 Z 0Q0jZ0S lKx%x5dP lK苢P ul h Y l0K`pk6pjDKt 0Jp 0DKnD @ P@`\050Zp 8;rd9r\7rX5r 4,pl h Ylph@@PQe_P`p 4n`p@D0SH@ 46SE 3=dPA44 pl h l`A0`p | _I0@%Sh- ! ! ! !- ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !- ! ! ! !-S@  2r` l h0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | y\2 l h0 BCbVD@K0@1 ` o@PVD@ @P @05&C@ ! DKzoD @ @"1 R6CR0!0 5&0C@@ D0 @ @ @4@K+aP 40 (R D @ 4@KLaP 40C44 aP40\!04 @ D0 Qt80K4K< K^0S@t 4  S S 8 RL`K L`Ka8(q0DK< a^PP\ ~\cʄ0 DKoD @ L~NH~?A||?5?55P9?hث5&HDK@PD`K@ ` p  0n 0DKpmD @ @h0 0S56@0 0pW @0 0D0 lKgZh 0lKCmY@PD0S46S !(1bPu8pdp\p`pXp!h!h1bP|!p1aP\l`hp0A;i@d 1 DK-mD @ DB[ T3`j`T` DPK`2 @ nnP`TDP @` \ @820#:kcQ Q4Q0 AD0 0"7&@ @ DK 0P'` d \ X 0@D0 @@ Ry|nY| @#46S TpW  Y DKD@K0 0lD @ 8!pdp\p`pXpQ #0 0 K DK nD @ 3@ 0SYD0S@ 46S30kSX 0S0SXp0PX0 \oP@ ڌ`V L40kS7S8odo\o`oXoY0ц!0М `0| |0 D0l0 h@ D0@ 46SD0SPiP0Q< E DKmP e mD @ D0y jP0s%|DKL 7lD @ DKD@K0 0l @P0D@ @P P2 XL K`PH0$L0&@ D0 @DT (60jS#:k0c&B# P)X6Q `60&0@ D0 2|606C#**0@ D0 )D0 1D0 p 0-P0@LS 6666d6666000 0100"000 00 1 000 0  010000 00100C.0 6:0 0100 -RtL$M@K@P`p0D 0@ K,@K$0K4P @TP$ 0 K T00 5CS0cC*R7S0BS c020 -LM< h ?4 00 U4 K ʛ, P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 U1"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL pP- @ ᇋ0 @p000CC000 R0@ <08 000B 0C B0S \cqP, 0S0K."0 0R0 R*0\SL P 00π0;0B #A03@ #0000 ,0@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hK  ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Koc@, _ I,0!pc?WP -L(M< 1>?0@0c@ S80 D ,Π0￶* -P 0R@L`Tx5 * R00""000 T .00400$po&0S:00P~4 -0PL@ Cp⏁00@T 0 A0 S`a0A RW`AA0A0S7`AQ PRS \@:0 e0 0c R0 Ņ PtSTSST4T4TS$TTTTtS\@:2 0g00QSA P Q 000qS 000 0 -LM$PK%%[à` @P,UXU(U|U(U(U(UV(U(U(U(U(U(U(UWA 10  @$K 10 x @0 #2>;?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T4>2":c& :460V0) Vp0pS.Z0p0GT0  AT,K 0 e, ( 0 #2>;bp.p>dl.l>b@ P]X.X>d 0b@P\ 06XP,\ࠃ|  >  'XP0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x Ps \00S ^ -01NB0H D    ̟ Pb0`p@0 T P< HKP cH D  @H K 3bX T |^ XK0< WP00Q00S ROXK; qc0X T 0L0 8 4 \X K bc; a40@S UA ;XKa 0`psVP 1WP ` \   pd \?e`0S d\\`6eh4e 0S00 p` p0 0?\0Sn ^00ӡ!  ^ `:  c 0VRP ` \ p100 d Q @ B¤ Ť0@S[[`___ x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCAіJ Al  4 8 Ex\@` 0tS\t0tS0ct @cc Rx0S `fP` \ hePPX hdhP 2fP\ P pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` kd@P `0  ! ہ7eP `` pd ` ` L <hcP+d Q U00S 0S X^00S \W UbL 0`R h  ePh d`\u d  ePd `  eP` LL \hdhc`\d@P 00`S cP Q  0 cc p d[0 _P00C0 x\ 4@5 (c` 0<`@ < XKZ@G[ 0XK0`0@ pP`@@K 0TP< 0` 0@KTPv4Q j`@ K U4 P 0jW` @K 04a $4@ < {a`PXZ@ [ 0_0@@@ K `PUP 08 -P0@ pP0 Za@P 0_2Z`Z 0Ma 0_000 0@PP 3 P\P  0_@P  0aUP  0P 8  w9R W8008  000800 hePh 40 820`  XKY`Z 0XKs_ 0@P~PP 400 p\00W 1`P@Y`jZ 0S_ 0P@^4P00 000 <1KT_ 0TP K 8_ 0SP0w0S 8p u408`0 \0 @nT/X T   ba 0cS0Ct @4S2+  AdP` T d 'TH?aCoc?`(?yPD??$@@@?h0  g`Db 0@P0 pH0 p W`@P `X@ TP p@dPh  \h0`h`h0  \0Sڈ T@d h,cPh \aP0w9S{ W p100  h\aPh  cPh UvN  \010a 0`l^,0CN@6@ccP` t @t E0SS\ cP\ \h\aPʕcP\ W\bP\ x{hbPh ms`bP` rkh0S0SU%`rd p9V00l90000fz0w0S p^ X T p`  KcP` <hbPh V \6aP `:V `?9V X1``9`4 -LVp3 -LVp3 -L0MP T 0 R` BTL X 0X@P0T 00D0 W}PPH , 0 ITP`PAH0H 0,@p, pP0 `PU`,0D  PU `@R P 0*L@P 0 R000 CZ *0S 0SL0 B@^L :L P H(KH @ <  8 4 8 14pN$P @0`PU`@KPU`D @R @ < P*XP0 R0 0BP *0S 0SL00 A0CRL0 :LP@i 02@ ` P-L@ @ 0S@`P@ 0-L@PP 0S0   0S0U 03P񟗀0r@rPr`rprprrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrss(s8sHsr41 01L P 1 1 1 0  10 10 104 10 10Hl0 \0 P0 @0 00  0 (JdĻT 0-@LPP[@P@0 080 0,P@P$0 00 0,40QRP000S p-`PPL . US@  0PP@ @00\ \ @UR!000p0r@T00p00pU  RR@PP @T@@-@P RS 0P 0 R! Q\00000@ P- L Q $T0 0Q 0S0S QbP0s3 -0LS 0 0P  0  >0S@  ?0< B<R0LA0 0!88S@  ::S T0 0@ -L@\`0P0Q`  RP \  P p|3U 1R 0 S 0 S?0 ^^/0nP  VPPPPT00p0 P 0S 0Sp0CP 0Sp0CPp0 PXH06+@P00 R ! 3R$0P VPP J -LPp SR 0S40S1<`T000` 00R` 0SJ0S`@S @Z`0 d 0Fp> p P` P@ 0 0R @`ZWP0  d 0%p p P @`ZW0P  0 0`` -LM`P4 8  0P0(KZA 8\S00P0P 3 P S0M 80P SV#4pe00 0@SW p@40 0P00,K@p,K W:C{ 0 40 0008 RP P @Q 80@TP 4 0Q,K ZpP4 0 0-0LPM@ dK P6@Kp { 0<K <0 Yv0 dKk00 HKD0 @0 H0 婘뙤&h 0-LMtP@T K0 % K 0K  @@|p 0 S 00 0@0@h -@L2bᑑ -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0Ā{ 0P0 0    0@:vpV@@, 0R(K00 <MpW00 Xh Dl( -0L@H $0㰕P H h~~ Q *0S00S0 Q -LMTp,@KP` 0  u  0RKh -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQT -LtM` \, Pp *: 0 0 xtp*l: 0 p l 0 U 00\ %\z^꜅̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂ȅ4@L8̂̂̂|̂̂̂ȈԈLLX|̂̂̂̂̂̂ĉ,L̂Lĉ̂l̂0̂`̋ 8H  , 0R(K 0So$@ T@d Ϡ0l" 0S` 00P0SP@?0/0U40 4P T4@ 4K  KP" KP- 40S% T UP4@4P0P0 P,:P`00 ;0`0 40S0DT@40 PS4P @Ql0Q4 ? R0#S4K  0 4 P004L1XH1H1000 0 ^ 0 S J"10^=0P\ 0PE0S0 J@0S J"10^=0@0  S K0K 04 n0 PK XPl @0R @D R J@0040 ꫪ*lQnP~~ -LM@P`pJ0S 0@-H01=0\J 10S1 0~- -MLMPP8 <( 0S` `,0K,0 S (K `V 08 2Q22Y PBKAA 01 R0SJK=0 0( Q(@K1$0HR1(@KA 08008 04 PZ0HTڂK `LLD 4 480H0S48 48DH! !H( 0!L 0QHL8DH @( 1"10 p 縀^8<(,0K @@`v`3d `G,0 S@0 ` 0`v3 c` 0(Z0 0nP~~ P0 0 PX P0 0 IX -0~03?LQ00Ӣ?Q 1!0 @0S d0 R0 R0 R, =0(3p3 -LM|0@`l,0 ?ipP@ 0T00 VPP P:U /U .2P JP, Ke, 0R(K:UP/U 0 >Sp@ dn(6p@ P1!@,  "pP00PUJ <Ua l@ d0S,Sl,0>C00 0q03W0Sh;Q,Qe QpWx5x%0  00@T H50D%  00Q ^ W ş^ @0^M^͆0@, 04 a$0` B0P0 P Z00 P 0 0 Sv p k@Z o l b@g;S 0KP_DKPY 0,SVXKPQ Pt Mß^ @0^M^͆0@K=`0 |30 h0 h3, btp \#0l0 BP0Pt03 p`  0 ` dp \0 0h dh@X Kd00T\0` 0B0C@0B0hpp0h h0Ϡ"2l10!0h R0 3l20!h0Q008"1$#Bb20ad Q\0\KS`00`0 \ Sh0,0h0 d 0!0Ta !0!100QP0@D0M0 >Sl@ dn\0@`00A\ 00A[4@~Q -L@ P  h4  -LpP` 0S@ t@ 0V X0(0T=H00(0(0000d@P ~ /  - @L - 3LMPU$ @ 0S" 0^( 0^N010 2 b B/#b0Ca"`0c(0 (0Sf%0S$\>^- 0 SP 0Q^M@  0$K @' 0 !0 1( K 10 ^( 0^!0n0C?t3c Ba`1"`( 0^\  0! 0^ QA!01"1,010 Q(K ^X $0R0@0@!. B2!Nc0@0@!. B2!N~Q"Y` -<1<`8!VL C 0S^͆®]P !0"100 !0S X @pPe-P_0@0XZ]PpZ0^=0 @kPpDS-P00Z$000~+P  -tL0Sd@0 0R  Ph,0pNcP~/ -@Lፅh芅 0-8Le@PA (Q0S-P2 QkPP+P0S. \0   B,{=0hE PxP 0:S  `P 0,0a=0h,bP8~ / 0-4PL@'  @ 0P P0 0 p-8`LP@ *@p -@Lth 0-LM KJ0PK@@%D0@`TK0@@@ 70@`T0C@@D@ *0@`T0 -LM K@0` -L,M@<KK -,L@, 0㬄P h~ -,L@, 0㛄P h|~ -Lh -PLU@`Zjp@P P P@D -xpLtj0SdPd@]n`T00@XPC/00dUEO$%P00hO,<pZO 2-C PbLcPp 0@`U0p(@J0e1PDX h00P00P0C/d`VX@E_Z@ -L\L 0cP R@P $ 0@@h蠺Ę -0L R7  SZ RX@J0S0 000000D0000PH00C/gdQ<ȃ ~@P $$ 0@@@I,Ę 0-*LdM0@0 P_lPH0ttt|,,,,,,,,,,,,,,,,,,,,,,,,,,|,,,,,,,,,,,,,,,,|,,,,,,,,,,,,,,<44"K0 @K⁏P 0 00 ,  K0K0Kep  ! ++ A/,000 = 0, (0 0 00 , !P@p K00K0K,  @0P @epD @0 0K$ K0K,  @@ep $@K0?N ?t =0 0 r.0 00 ,  * @أ #@P w t0 00 , d l@KPq@ e0 00 , p0K K0K$@0 ,@ Aep[ PX L , 0,0 -0L80 -AQ`x 0$0( ( $00  00  00  M-LHM@0 l p D`Ph o   p0`d8`PPhM `00X04KE0Slp 0a"PnZE04,"401(0($0\` Tpbl0p `d X0 T `` \ 8@ X0!dKq P <0P 0S`+0h0P (K 0@I 00@00h%Z@ 00600 |0|@|I 00*h00 @,@ Ӣ P! 0, K y@ 0꼺H~f M0-LM(0 00 PJK0`" 0-@L0PS <00S8Y0hY -LME ` , (~   0  0$H0 @08 4K@ 嬐 080P<0X0K00< P   0P  P <00 0 @X@ 0 PX^, 3唠K 0PK 0 1 x3#A!B La! HKP 0 43Q0=A0 AS  R0 0,0B, 0R(KP p$ 0S :0#S 60 0 ,04[ W *00'0SXKճL0T X RP0=)Bc -B1 ABR=)B -BQ. 00S0  PX0` QpPK 0@KIPL ,,P0 ^   0 P# A @R00S0,0| 00Q  l0 0 ,0l0,0hc,d  0P0 ,00 0S 080 ,N@pPp@ pP ,@DhMb?B -MLMQ0@., ~0  , 0RB(K^`[pPV P BKII 0P% 0 0 SL1 RL L0 RBKJJ c04( K0 $C,[Q 0 pq` 0Q(00 P0  rR 0S0S s 0 08 04G6($h8$Ș -AMLMP`0p., ~000} pX1, BNK@D@D  0k @`P)0  0 iP0 0 P0 P" P0  , 0R(K 0,P\0 04"$ 40  0  Bh80 -MLM` P,  p0 U NK@D@D 0 `P] 0c|, 0R(KLcpP: \0W.R NK@D@D ( K0XCh00 -LMP< .0G}pp2 9 0 0 00S`@g @ .S@0SU`!*0R.S``TW l10S 08 ,0 ZT Vk 0 4 ,0Si 8q1 4QU 08 0(K0 LL0Q 0 `4 @ <0I P0=SK D!0S S40040  S @0 @0Q0T0S00S00 #P <  0(Ko <0 P| , 8 0 R\8 000   <0 Pʌ;0C 080 -pP@L.0|@e T`@)@MX E@@0  = @9 04"408#8 $#$g * @8 -pLTMP.0J|@p2 P Q``(K0`0```````````  0 $x0 $10 0 0? 0 Ux t` @% U U dR(K Bx0KP@  8@#x,PU@ -0c d 0R `  0    0S@,  @ d Rz(K Bx0K=Pq@P vsvm @80! ( -L"x@P`^ H ^ hP@-\0^ 4@3 A3200 Q0#@غ -LMr0K 2R00 Sp^ll]dd" 89 0]L08 #H "@(2( 000c8 08#H4 000c8 @]a X@&^@E T!sAQ0SK ":]tA8K㢯 80 R$0) 0 0 #,!01  B`43C!00 c Ƞ,Ƞ00 !0=0  W0(K0 B'61C0b10c!X<SX40W ] 4 `T0bs4JP.U \UPn@kP 0D R0 0<? 4 X0S8 <0c\40@ QL L4=a4 #=0 p0S .S` < R(K0S 0D R0 r<0S D00L@P*00L b@ R$ .0A Aa0ARS00A-Q S_Q\0 .Q .S \.\A Aa0ARS00A S0*S 0.S S R!0B]S,.R00S \\R R.R0S! C ]R00 <8 < 0 <0 Ƞ 40P 00<(4"4 <SQ1 S -LM@0.u0pS80 S S  `P/P K - P Q |` X1  010S0 Pl1l1 0 0l!l10S S S S 0S SS P  P0:0  P0;0 | P0;0 \ P010 < P0008r`r -H/LOM@0P.0, wt($/$0qtU 0>NK A A'p/ U $!0S000 S000 =0005< 1l100  l1h< R,PP    0 0 PP  >,E.K B0 B4 % 5 \4KP `$ R*E~KpGpGX`4(K 0@4DCx5 P@\4[S \ PV4[ S Sx 8 P7V4[ S S3Q S S0 S S SSPP h@,+ PT  P1Q$k$1RgH̟, 0R(KATIH PV4[ S Sh $ PV4[ S S\ S S0 S S SSPPw h@,+ PPh0L@SP  dR *R* S S0000 Q@0S0 00Nl1Q 0 2l1h0Sd Qh0hSLPP@T T .SP0SX`V.VPEU00P0:0O 00kU1Sf1S b kSP h@,;+h0L@SP4  dQT %>* ST  Q7* S0 S S000 0 R 0@4 0S0 00ENK@D@DqP.cP ,h+ 'SP0 0 S S 0S S PR4[ S S%R S S P P0 S S SS Q `8  q 0Q@\@K0[S\pK  (50RG.K B B@@@@@E>K@0C@ 0C | dD D ><PddddQ Vd a@|`Pl   0S @0 S S S 0R0Z0S@`  lP0P0  cP0P0 5 %0,S \Q 0 SS S S\ bRyR00 fR0! 0PT4[ S S \@ Q Q QQ ;Q PU`p |5`  ;U  u 0PU TaPp GKI0 I0 tPr D pAKP PQ;Qp` p`4`  p q 0Q;Qp00 EP 5 4t1"10%0 #$p $ t!# \x@ PpU4[ S Slvh 10   r 0R00 S 0S S00 00   R5Ud4 R U%dd % I%5,YQ0" 0000\pK (Ph8<h4dh&Ě$`rdx  0-L@PP\JZJU@0 -LM@   K0K  @@TpKE-M00L SJ20\ p` P0 @ 00L @  S4$ 00L @ UQ | 0D A0a00cB.\! 0W @00L S0\p PX\x\PPT*0S R<8@%Ѝ\ Q| 0 0hC10SHXT0SQ R<84@Z,<$!$$, T*0SL -LMKnP@ -0LMp,`K,0K@PT ;Pe 0!00P XZ@`PTZ .T00X0S Z  ,K IT  -LMdŸ0P,0 PD P w/000, 0Rx(KD@0:T<0 80 40 00 # @P L0 M-AL(MLKP 0`Pi0H0 f0 V0 P,KJ,0P pR) 0S&PQ+ V$! w, X!P UpP 0S( KA0$  0A 8( K0U p (KPUP P#0"SPx0"S WPh -LM< t<0D @  Pu 0-U +U 0P8 80 D@ t 3TT0U RUD0 ?4 00 8 RX 4 K }^4 K `YV0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cDPmR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K $^4 K , SY W# 8 V0& ,@^00S0040 ` `Pp Xc"00P`q VY"00P`q W0 W0@Q RJ< <0@ 0(KP8 A0XSxSEP D 4 0 C -@L 0 0  -LpM؀0 s`$ Q $ 0R' Kj@PK Fph K@KpK. yvp@p~@ 㤈p  {0sh P-RL@  ?  000 -- LM 0  M K -ML M@H,  P, PL, H$\4#0$@K$K0 S2d, 0R(K蚮D 0KN@N0,$P E 4HPP,Qk`p H<VF``p  @ R@ 0#EVF ``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSL %S00T0S0 @D P R@@ L<V 0FP `aC0S: P 0P`pm 0j , bpPdP > PPKn@1AlA 8 4< <\ 0L d}NH^6 D 0!REPD@`P  0@,d0a0cK8< 00< @<AA 4 << d.s0!.EVF``pY 0 S0GQ D<E갭07S^KPEpPE p }00@ ~^KPEpPE<< 8L XgP 0&@P07S v8+hJ@D4$t 0-LM@00 P>P8 -LM]d K -L]M@NK`Pp KC/$@ d @8 4 DVN_KPEFh0 @KX 0KO@eKQ Q D1 $0Q K h P0 p-LMP` P P |P0l wD`0 0 Kp@4P0( @dD@0 -LhH -L  h|QH 0-LM0@ K Q0!5Dp@\ Pڔ!+D|K0@\` 0S-0H0H0HLHLH0HHH0HH0H0H0H0H0H0H0H0H0! DpP,P{0 CpP0  Cp0 P0 R@` p01S ` CpT0< CpTl$H`@ -Lrh H --LM0 0 L K p-LM PI|` 0 S 0K,0 ( $ 0 R r 1S0C1,K,0@S֜KpΜꈹ -@L   R-L" 0S 0S \ @`R 0S  ^00NSa00H@0$0 -0LL0 -Q Q Q0  0  00  0-@L0PS P00SL<0h<z{ -LDMP p2BP d.B`Pd p 0S, R00U@ @@0K/DLP` 00 X T P \@ `K~P0S ?{K<I<0d0 *0  0@P04,"408<d6<d@ P0P H0S00A0@1HP! d(K ބP rP00  0@+ 0000@ 00 00d@ 0000p 000@0v+ 000d 0xRRH -LTMp \ 0Qt x0 | 0d@ `0 0 @ L`Ro  l 0h0 $ L |00C,̠Č| 0("ČP@|H # P] P0\KPV p0  0PM xt PF l&PN l0SO `Pd RA 0A尡L0LPK0<0 8 XpKP P$P (KX0Y$7$P) h00Csh0 p  0 P$`0SdPl $0S0$0$0$00$0p0 0P0 $0(  H0S 0L0$ P$0S0$0@u -RLp`PU ?p@`P` 0$0(  -LMpRP(K !31C0Ϡ @l1@8K00 2K᠕@K 0K{q` ᕕ4 <08R@0= Bc 0 B ABS=ɌBa!@B ͌B31C0/A#b1@TV0p$0V v  剽p@ P06 p$0( 2[   00天0S 0p($0ꛩ 00ꗩ 0$0( pMb -40LQ < 0(  p-LM@PU% <\ Kp00`K0 @ 0 0(,0<,00S @>P P0S \\ 4VVlVVVVS 00  0S S S00   \00 \ 000 S00 0000  00000 0 00 00 000000 0-0 0 0LS@P 0 P P P  P 0h 0-LP@P 0SP0S0h0h 0-LMP@P8P 0S 08,  0-LP@P0 >0h 0-LP@P0 P 0S S 00P 0h-  @ Dh@-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 C 00 00 0-0@SLP*00b0 C 00 00 -LM0@S0C0K< 4("4 <0!  C 00 0 0-LM0@SP0C0  KpC <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< ^@P! M?K^@P8!\@lTK?KS N/KAwP_8!G@, 0R(K081 4A 0p 0^P>@.00<K_K<N/K81 wp 8!+A[>h -L,Mo,0nD 0Kp0 ``0 庒KPZ`P 0@p 00< 8 4 * K0 @ P @0K P2[Sl0  00pvD0 [(K,000`x@_ 0-L@PP0P P  0h-0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$:P $(0lH0 (0, P$8`:P, 6<P:P$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (Ko$ @08$o4 0z$4o4ꌻH 0- @LP 0]p 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %* -LIM0 P$0  0SQKO_K`ᙣNK@D @w@ gl0! Z$ 0R  KD! e@,0 MoKK_KQK@ <1 8! h8 -L@TP`pJ 0 /T #R70! W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z HW@ <"@@ 0-LMP40@ L0 @K0H -LM`p@P0PP@0  pt@TPPK谻\ p-L@ P  }3 Ȣ 0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ PPe ,00i \0 , 0h5Y9 Q> Qj LQ; R00@$  ,p, W``T0U0S&a Y00 ;0S8 w 3JX00S\00Sl @(K0S @T,0S%@ QB4 @8  T 000lnPP 0@0  0` P00 R \`0p@APPE 0@10 @dP0 ` W0p 0 `0 000  "00 0`210 2!@m210@ B  0T0W0P`0 p p 3q 0@0uPP0`` 0@0j -LMNPpU 0  0@P0 L@  D 4 @p @0 -SN|` @ 0S@0D@ 40 @p @T@00\40<40 ^  q D4(K 00S    /Q 9Q@`9Qʈ!000T0Cچ!000T0`C@@ /QP  EPeP9 Y0@0\uI0@%Sq4t4t@ >00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ J W@PP@ LP 9H A @PJ 02P L 5RYO\0Sk \\JP 09R QH } HK5@`\D9 PK@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 x PD @p \ 0g@T ,8 PK9P L 0 PK< K80KPD T 80<@cT< <8 <  0 @n0TiT @  (7  0<P| ( | P ! |0  ! 5D0P  D  ! 58P<@Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ xPx  @P @ iQڄP  WڀP  VڀP  XxPx  4 Pt  0St0@ p @x+`\`P`V 0 03 0 4  W !0@ 40 X T 倔 <\` 8+  , K00KpP{ ,QJpPt D`R, 010DPD d 0@S20@DT@ T D)PD Q <0C< %A D/PD < 0 0CSu R 80@0T80 Q6` <08 @ STQu "2  @P2XKf 1`p P 0 P[ 0@S 0XK PO40040 Q80 @cT DPD < d< 0x|t@<0 R 00SM SG S D00 @021T0D 40 * 00Q   0 b320PW vtxrtpnP tx 1@PPW 0` 0 ` p 0^0Z0S.   R 0S Nt?V瞯<A?@h0S0 RT@   0 @ R0 0 @ Q! R  P 0BSچ0R`Ф0PU 0 CR.ʈ!00 0@ D@T[0DPD0C< @8 PD @P4I.P` 4 P410S90P40 Z RD0SS@ 0 SK @DTʳ |2W @@"2@ P i  @P  0X T ^ ^ ^ 3P 0 00c 0 @P@@  CbVڄ3@ h d L 46 56,ʠL0 LLPKh K @C`FVP L L0# "*/B B V L pP@K0@4 ` "@PVpP@ LP XK 08P40 040 H0P@  @ 0@ 00P00 10@S @0@  ` X T ` @@K@P 0 40 0@ 0(S@@  000 Rf 0SD40 0R  04  @040 垖"00D@@KP @0C@ zP@0@ 0 40 D0 4 }"00@`0A0.@P*U~U@d 6 PK(P L 0G CbV6@ p l L 46 56,ʠL0 LLPKp K @b`FVP L L0p' "*/B B V L pP@K07 p` @@PVD<0 < +a P@jD#PD K <0d8 < A0@PU <0P 4 "00D_  PbU+DP80D 8  \< ! 0\D0D 0@@P040 Pw XK 0PfoQl1aJ- Y!ц00 `Ф Ť W!0040 W R 8D210 R*0s  R*0 s 040 @ T00\0SD0 W }PD 08@10!@d@P80!08 40 W040 !0Z40 ʘ\00P0StfPt xP040 řژPv <0Db< 8 x^\ 80C 8 APi\0\K PK9\e 3P L 0PK4K 0PKD00 P0< 40 TZ!040 t4  I 4 2L0HK6H0 }@`}\|\PKL  0 1SO  @ 0CD0  !08 < 40 !D!040  R0S0 DdOQ8 eDFZ 040 qD08  -L00̻ 0-@PL0 t@0 -LMIPU8 < @0  00ST @  00R@`0`@ `0R 0S)\ 0 \,0 0p00  60S20 R 0S/ 0R@@ 0R 00s03p`00 0 00 l8`pQ  0S\P P0d1 , ,0  PR pR 4  V0G000S@Z)0g0CS  0SEP/ 0S  0S W @!`#*`P @ |0S ` Q` `00a W:`@iDA@80BP`Q @a P ,00d,0 8 p0, R80, R@I,0`cU-8  0S; S S- 롓P@"00F R0 0S 0S0 R@0Sd  0S@\W@FpT p2 02 p80Pf0@,0 W 8  0S S S @@0,0< 0(K0+S- -S 04 40 ) Q! Q 4AP P\ 0>!0L0P40, Sa ,  4 0Y000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 @"00 0,0 4 R 8  0S S2 R/ P000.@r`/a)PPPG / P?W 00S `P T@ 0VP @F R 000@0b@8 0< 0唒"00:1 0J 0eP #8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. 0\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R:pI 0m $K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 BSPP P 0 BJ0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 ḻĻR0Sa@ R 0S0a@000-@P 00W b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 000S  0 S  -4@L,    h,Ⱦ -L` -LI`Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@-H h$H! Q. &.ȌV2UXP`pP1#3P1 <2PQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0  Q)лȻ -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@P̻л p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`̻A-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vpл;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000л -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^1@^ @T@0X0@@` Ѝ& Z Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P -LXMt p p`| x0 x&Jᄪ.J`p E媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^  ^P 0 0p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < P< Ƞ,Ƞ"h @0#H!\0 8ᑃ.\ d  D X S.D@ᑜ$&.(40D V 20gUXP,8C T0C28T0CR0CVbP0C X`SfH ZH\X 03#Z # 30d  B\H0 d X H ;#;S` N<0P0 @@.#P` $8 " q(Ƞ,ȠT@ a$8P^%L0 !$(H Q 2LV 0ch`(8C U0C2U0CZ0C2Q bP0CWxp`Sa `ZP0T 3# 3 # `0`0CV`0 `@0 0@`@ d``:ʠ5lh%p ` ^ l 0O/@0pl p 0O჏00 T030"S* ! Fpl /O p -LlM  ` 0 &J,JJJ@ 倠D `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40KY0^ <@ xP0O@K0 K<0KF0`` @<0 *6D0 D4086!#((*Ƞd |0 `  (|`"( XDpu'l0 `0*h.6#h@ F$H X0 t HP@ d@,p X\@ P@ ȠH ទ)L@ A$pH 垥*'Q2dT l P XR,8| ^,dx&"L`p 0T02T0P`h@*T蠃ࠓ`@\2XP\`T0蠃ࠓ VT%(  Y 2Y 8 S 030#p,0 Q@@0\C)*DPt`|x 0003<0S00S0 0-@PL  QXP0SL 10A00h4 (10 AR 0hꈹLػ -pL0PS U AT01 0S0 00 U e102P@ @Tԇ0eD!<0 0c1S10@0`ꈹLػԻt -LM@Pp`P# 46 Z(0 6(0 T$@ (K(0 0 @UC>E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP" T  0R0100@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lq P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K=PP0P  00  ! 00P 0-L@ODa TAPU/ ` @T P /@P/ `p0S @T 0S PP@ 00p0S |PU 0S \LgPP 00, 10 ePtܻq  -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`@$K pUpꈹ -LM0 0pSV  0S 0 0P60,0 K U& , R  Z `1`!@P00V0S V ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ <  ) U@1  `!`1!10 0f @`0 0 00jS0 PdUPPx ~ 0 00PUb UR:,PG @ `@U0@`` 0@T:P3  00b0 @@0 >0 @0f Z0 c6P, ]  P0h0,0 8 !000PF 0 @00j 0 0e `@0  0 00P `t p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@Snpnꈹ p-@PL ``0S0 P0Snp}P 00nphꈹH -PLp`PS J0SX@`PUZX蠺 0-1L @R 0P  Q-   0 0c0 00000C  0P @0P 0P $000  8#8 0B< S /0, p-LpM@PP`0+0 KpKNP0@: S  Q;  0  SL ( 0R    p-LM0@C 00   KpK K`PP h 0 SPP P 0000C0  0|PP -L MpP`0S=@T@0S P" 0S$K$Km 0@P0sDp x0 F@l0!0 0@S000 p 0S ꈹ -LMp`18 R P!0L!0 0 1P0  @0 @, @' Y$0 S ಐR 0SP | 0Px  p Pg  1S0C1, 0R00001p0q =W0 pU 80x03 PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 P Qq -L 0  -LHM쀟0P@$0 qs0p8`Kh R0d ` M0 \ X0 T P@ EUL H` DP  0|  9D h0 hK@0 < M*HsH0p R$ 0R K! ޓh$tpx@ -P LQ @@0  BQ ?"s 0000 -0L`Cp@1 00 a 0Qᅁ  00 @0N""(30b >P0 U  ^00U#3   0 P\ p-0L@,  0$RP`@$ J2#($b!.@1QS QS 0N!QR QR\Pp80\ -L M 0`^J~^r@P p10鎠:p@PJ PL0 00 Q 1p\ ""(30b,>0A!0 S00QzMP% 01C0 0 @0 0 2#8# cN(. 0B 0S   00C 0(K  -LPMܤ0d(0  @0P (0 U  U UXh@K? z)P$ K0DPCM0SJ @<0C>S񟗵@5|5\5|5|5P5|5|5|5|545(55|55|5|5|53|5P6|5D6$6|5|5|5|56|53|5|5|5|5|5|5 6|5|5|5|5655|55|5|5|53|55|555|5|5|5|55|550 0t 0SPU 0S$3  . P, Pp 2P"9P@    tj *@< 00 2P 9P0   R@0X, 0Z $%Z: U0 @ |( 0Ry$K000 0:$000(00(000(00 S(01,( 1 mL0 000 @0$ (0  x00u00r00o0 0l0$0i00f00c00`0*0$ (0X00U00R0PPURrPLY|00l0 R0Sp 00 8p,卑h X2L ->0>0L MS`4 0  (KoO24( !Q, p0B0c, R,c0 S*0r 0P#R R * 0000#20Y1 ("(0S* px 0t0 R!p00b b0 p0x 00h0Yp (0S0C 0Q@t0S x0KP t`1( R B0 A0t0SP Pt0S P00AU00( p0S(K 0pS(0S 0 0t ,xp00p0( U S(Ko04XKPh 400a0ym40 5 04 ,C0  8P -sLP1`P *"*R@ R@  B0B Ts0STD3 R8C0 S*(3  0 ""! ttXPUV P 2@` 0 S Q00C:#:30#" 01#e3! Q1(1"(@0@R!o 1S$ R000 !R0S *|1S1100S00@@$ 0b SP1:U xiR>0N@ TK:X>0N@4 0$ 00b00!S 0S  |i?ic Vii$  b R 0@@. @0N$@a = P 80h -L`oVp P0S0 @0T  @00S0 h0 0CR0 np <0< @80T 0S$he ꈹ -LMX`, 0&P,  8M>0>0S Dp(K80\>0>0Sp0(VUeB0 Ss*0帢 0p#r R k* (0000#20P~ @ 00 1@tpW x t0R% U0QZi 0 0e6RpAC 0SJ ,0 e Sp00ep0<0S 0S  0|S7 0S=xtp0, 0eRp000S 0S  (1@P05pp{ !000v @  h 2A 1  Z $A h0@P05pD p000p (0RA$=$ 0 - PL M8 P6$0:CZ*`>0N&@8 ppd 0 5PP6$Qt0PSb $ a R^*0S88:b0Qp 0S(K, 0(RC /0JS1p00@`V 0R 1%S@ U0 S*5 00#2 @T0N@$20!0RPp"@^@Z p 0 #2 p0p080Q$0S 80Sa $0c f85#Ƞ@^@0000!1 B("(0,R1!Q000$$00c02!0QB !R 8p00Q00Sh Zf a# 2mp 00Ra  PxlP3$ 0000uj$  b= p4 p5 W:370#2000,0 < 0, <0 `00V00 u Q000, v0V 0a WI< !q114 4 P^  ,20 B0R ^ ,"   0 ^ @@Q@0`4@00@`0#4 0   a)$0 c:37 '8#8!1q14  slp 0044*p@ 0P03p@  0,00 P 000S0@00P@0,@0`a4*[Q0``x<`R@  -LM@8 `lpD00TPPU4 @#0SJ"0S2 좟00S0 k@k4  (K 0 T,0 r$0:CVJ*`>00`  Tn`^:TYY0TP0 07pP Be$Qk0"S, ,0SU $00 c bf!, p 0dPP ` < FP<]piFPS|!U00d0k 00D1 0R0C0U k4 @ 80P0S   k 00 V!1PNPum$  b gkP 00a qP`$ 000H< ,ꈹL 2d -LP`:kLq0S<<.0 N. @T, D *Q#Dp(0pdS@@p <@ 8 @0 (00@S|0<0 t@ Q0Px0640 dEPt8px p080bp0x040h0TpW'  2@P TUX0 0CR0T jH(K+<j@ 00 R !0S@iX$ R @@ rP@T0 e@OP (QD P4D h,P@@<@ 1p@<XH <T. t @DP P<T R*q0S,,P@t,ia P.0Dp$PL `P L 0@R00 @ ,P@PbD a e"@ X0p@0@4Lꈹ2 h -L`\ip0SP @0T * @00S0   P0 0CRP0U w00TY! Y Y K:P)Xg@00g0@0(K +P g0S @ X-0p@sg0S `@ig0S@@  -L @P  - L@}p -lLMd 0R,0 Tq Lq0   R8,B0 0 㬀K%@ 0K K @@e0P0C `?<   c00P 0@ T0 LD@ 0 0 T0`<, 0R( (0 (K劇hj  -0@L0S0Shꈹ -L1,<0 R00 R$ hy 0P  -L0pSP(U `@P0 000  000  eU 00CS0F0Siꈹ  -8qL0SH(!00C0p @ 00 P@0  0 0 ` @P 0  0P `0 P@0 0  Wp@@T Nꈹ  P0-LP `B@T<00 - LM0, S*0 R$ p00C00 0 %P, `@0@00  Z 0`,0 ,0Roꈹ@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@!*hf -L@\Pp`P h\bQC0S! R0 0% 0S! 00CS1h4ihhtidiTii$ihhhhhhhhDiiR<0 0 0;S < 3 0 01 00 0bd0 0p0 0d0 00 0; 0 0 00 0Ed0 0^, @-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R P0Sb22/*OO/*/* 0-LM 0 @0 @PJK0JJ/*2/*2NϠ8u/* -L` opP @H1B@A01 j P dd 020 0 0 崜8q -LBMcP< , @$ D4 y8 *|dPx BNK@D@D0" Pa*BnK`FBK `FA0A 04 .p h A/ yj  ,2R Pe 0CZBNK@D@D<p`004 0 ^ 0D\1 @<@PY@$00@_S c4R SQQC 0<8$Pp. 8\ 2bO00-b?00, 0R9(KvP@4<`%0BTD ,@ F@d : :<BK0NN@``0( K` 0T 0@@匂hT, -LMp`xQ@ 00 0 0C0``(KSL R ..., where is one of: instbin%s: %s not compiled in mount_cd9660dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksha256mknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostname̿̍4 m`@@,$ |@@Xconv option disabledunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qd%s: illegal numeric valuecbsconvfilesibsifobsofskip%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmain$s$,4usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s%s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmain$s$,4usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmisharmOpenBSDmainp@@t@h xp|p p ` @  $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880ȹ йԹܹ    4 :Ļ̻Իܻ  #3# 323$3,#4@<@7@D@LT\dpxȼм ؼ @@ (x08@HPX`hp|  \Ƚнؽ$,4<@D@P@X@d l x  @Ⱦ@оؾ  C$CC$C ,8@HPX`hpx  @@ȿпؿprintmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhns] source [target] %s [-fs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).Ffhnscmplabelduid_parsegetasciilabeleditqmpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor ,T \ @d l@@ x @(@ %-@,  `Nd@_,@d, ,(0<HPXhpx], JJJJJJJ(XJJJJJ,JJ ̝\s6㿂;{vtDZq{ "UN{$8;d"@g߿9~4x]u4FsUw-kUyPy=Nϓ>Or؛H Y2Ӊ~Zkӻ4:͍I*I 5er_@"xg4}JdpW4/tq,?RxNU^%Ub[{8W*Y_%:WWIF-/WßQ`)Wɫ?y2s"\a'.WIE̩¡vEE"{(ψ S>CcGuySsSyسs"$'02(%hM}iXSoSffLg:mӦJMiUT߫)4tUfIfd!ҪL6oDD/Ƭ*W1j0ޚ-UF6&ĚafɞDkaBm4MUM4VsY˫JjkJH-[ZX}n ƥ 2fB35.p'PۮUgnmfE6;M.vL׻)Y0g:nû+YmfҔ`vˍ584TT%M^xtR0 @PʪAY!q0px |r0\-Ψ*4y5 F 5pN8\Cީu4SM O+Na) 6 Zn`9˟n9Ν| 9[R{w̫rV9h *qRxA$c'YZ2u`;u {r5آU*J#?JNSzwy|@I||;Jt %_A:F65KVR`uD5-($D*3 80JHTsTCBKjQTd@ V3bckf K ϜZ,d`v7Xz6*QF (zm}-6:<"xΨPA̢p[P =jଓj}('~֚fɯBD!v/^ |Egi p{0[Uop/5D9xrE .G@6hVdv6yF3?x)&z4 u ^WySVw87AM6dF~<;,q^J^0Z,u*9 n׶h:wYҖP,"I,F`1zĤikJVײ`?:&+jEZVnW"pǬr}kb@sP^jܝ}!AO-Ei x 6¹U x@,U.XM ],,GyϩZZ]8 Qwq6(9R׹øa:E_(%oQjPx< 蓘YI4qyHBM\g@MKֿLb'BSZ{BcZ tnjۤg/%v dET>`| -@=~~ <69 ǁz8'aMVbR!ypJQ@Xȣ6[a"$c}D'f-tcX"ЁOAgiK 0UPO aF~T.bs'p?c*c}E35b%p.7aǁt0MCGOKgtaG8 Ou7%QW3 i6@gNnciW3 w\gUAyh?F-g%Og=kwȢEq;!k} ú XE,q !h p]3m-T0'xeBIЀjUM(=JpI?C{X-n5uh8W]˦EU.,=vZKڊ<Yi(Typwx9Y"(ZlL쌅Ӟ@`?4KS? ڽi\cx `b4Q ?'$YaX1 \(L0Nb8Vq?A[ hzWTDTY () 3鶫ŀ((̫O3-HJ5证0w1sY;~ڥ\d,pa`NQw^Ƿȹ4ܜ SUåt <\Zvʡy[_"lơy'4\``*nڂ4vƅ i{vx*h!唠X:gQDVw( I_E w8NQƝC]&19b}ސ X_qHە}ehq!?nFۍ)6\J9~nZ4W!ȍO#vtrJgXVB=#񩀂. `Q„n GB &10k*G6T7V֠fI`ƪ̀i҇Okʿyl>R*Q]+L;A:O2}'!Ck"J0vdX-Fl'j^b@ 4|ge8`;( vEcEa*|.Ɖuv(Ƭ\*Po`E3 g˂ WH8vx&(5(OؓSIlqLFYSY ON/F,®7*=30$%'4#&D[)4(?=`cI+rҶԗת֝"/408& x 8[e]3PdXVofK0Ȇ8xjNp^aқ TCkjܮl2Z:P=yQ^q Pe9OvzG {^."]Ĭ7))J;&=e\EܪŭFzL:%+!^c 4X)\w*.;9ªQ&8šq_G=DFʈA,TeqPmMn0Bag wv SJٮfۀVr)zؕxU\$ js ,4XLIQU;%qb-} !A. fj;\gh<ΓOp.5a1BfM)$j/,tg/c~pŤ?G&Aλ5xs+QYr<l0,#g;2o~8300Jbl’%HU uh!~Q˩+2 QFXnd|G R3fϵYֳT>\_ <x'!ǠHY0.$%=:X˜\CȤ`3cF쁧WlISzS;u]OBIb@Q͛!(C9j(0 ]np &-@-Q=/,R׷LJoBy sVLDAL>B8 MZ\ In["&Cfʮ_ebF+Z13r YUG+is3w+-X8%OīԿFq"wyW$6aֲh5mmOP]pvW_lt8l}tI؆pF _ ({iX[71* u[M]CAL;.A],Lf5BcLkx#٦4͛,u=uޯ\ON2~(B."I]zviB ȤPj}pefkí]8Jȓ lw l hTm.[w t]+mQTvNKIG {|Ֆ=>vHLx0lf<ֵ !'>'Q3?S:S b* >`L{(b+C]M9*u+Q]Õ¤u)AbGa81j#|DGd{mLJy(unV4"< "}^I0"hBblf֬9}zqIƔ}H?; 9l:{ `i0.[3~*ϕd d"Fc!ZүpfFxu?hﬔ5?:0d ΜΛ㚖rw4 &9<ߞ\$ܷ%6C9 lhXn#f AVª+ rpsCh!p\'[$'XAs'cC Kc`op%v. .;'IYoqG"5j< wE~N LP+΄a%'MY$</XQ4+) TY<;|Z1`)Iz20rcE@;da'*HPfծyŷ ч! 5PII0^/.nܨ-J!\4w*,x7J.p,HQ(]VcW%7%#a ߭aRj5{5l<ɢ("÷5i~c'ڮ7$h..}8OtO#gؕ^Uuti|P9<"*_F>~1:kje7uD怉?_ɅpgGC+D<>q0|֙p=rz|ZWːOyb_Oݗm?z_lK7߄y~0"u.=›W+v3*̝G!hAیn6NMM9^NdTvvO1B#S錄4:Q2?|wd?I1F !K:У)]u< f/=c?8K-x {`/m~ttx+Q)Oˊj6o >`i RLr%$ye 8bWz|M~,}77cA !.Ru;q :(clmkw D^&ݺfLThgQ+&E G= o(Ev|G@p& =67}v.Tl/%FJ589?0%K#I`M]mLum/uBgd\Aҝ x-˧0ꭰL]o4-mv.ܗ| L 9Bˠ_  XZzsC*iAB4wV. *>Y>FJb~,j$BIjgٍh&[NEB a(TVz;5CͲ%wk߭a_Ŏ;2!eb(W8#*Z- 3 Vƈo_9?(A͸ǵT7{&Z 1WTH' 0M#MYRogm ~y ݨF_KUOwvF?\p3YA(Ky}SƤ n{Dg=mٍu rtɋ@hk/kW=˫o?^ MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lld # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. %lluOpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. noneWhere to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sOriginal label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndar_revar_drainar_nextlistextractcopyarchiveappendbcpio_wrvcpio_wrcpio_wrcpio_endwrset_crcnode_creatls_ttyls_listabcdfiklnoprstuvwxBDEGHLPTUXYZ0rep_namemod_namerep_addsig_cleanupadd_dirchk_ftimeustar_wrtar_wrCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive filecould not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot chdir to %sCan't fchdir to starting directorydirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...User specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptCpio file name length %d is out of rangeCpio file name in header is corruptedFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070702070701070707TRAILER!!!File changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sUnable to obtain file stats %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %Y%b %e %H:%M%s%s %s %s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list usage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory These format options are not supported %s = %s Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEUnknown -H format: %scpio: Known -H formats are: abcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Destination directory was not suppliedProblem while reading stdinInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cbcpiosv4cpiosv4crcustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.LC_TIMEUnable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %swrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %ssummarypingermainusage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup(0<HPXhpx], catchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%u CONNECTED. PARENT WAS I=%u NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%uBAD STATE %d TO BLKERR cannot find inode %d bad inode number %d to nextinode Cannot allocate space for inode buffer bad inode number %d to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%uDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%u (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%uINODE I=%u HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%u (%d should be %d)UNKNOWN FILE TYPE I=%uROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUP%u: %2x BAD STATE %d FOR INODE I=%ld summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvsetifxflagssetifchansetifnwidsetifbssidin6_getaddrvlan_statusieee80211_listchansin_getaddrunsetvlandevsetvlantagsetifwpasetifflagssetvlandevinit_current_mediaieee80211_listnodessetifwpagroupciphersetifwpacipherssetifwpaakmssetifwpaprotosieee80211_statusstatussetifnwkeysetifwpakeyin6_aliasin_statuskT8TrTrTrTrTrtrtrtr}rrrs sstst$s(s0s@8sDs|Ts`sphspg؃ps؃gxs~g,sXsssx~sx~sx~sx~Pi̟HissāsāsLtL tLtLL tL(tL0tL8tL@tLLtLTtLXtLXrX`tThtTpt TxtTt@TtTtpttttt|}<~tXi i@#4#`rLi ix#X& t t`tttuuu#u#$u#,u#0u$8u$@u$Hu$Lu%Tu%\u%du%hu&pu&|u'u'u(u(u)u)u*u*u+u+u,u,u,u-v- v-v.v.$v/,v/8v0@v0Lv0Tv0`v1hv1tv2|v2v2v3v3v3v4v4v4v5v5v6v6v6w7w7wc$wc0wd4wd@we,ueDwLwPwTwXw\wdwhwpwxwwwwwwwwwwwwwwwwwwxxrandommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELmtu %s: %sSIOCSIFMTUprefix %s: %sbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xmedia mode %smediaopt instance %d"%.*s"0x vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%i%i: bad prefixlenSIOCGETVLANSIOCSETVLANvlan tag %s: %sSIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYinvalid vlan tag and device specificationSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_PRIVACYMPLSWOL rdomain %i metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: physical address inet%s %s --> %spersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATE%s: no such interface interface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacygrouppowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*u %*qd total %lu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_uplladdropt_fillinterface_statusinterface_upget_llflagdefrouter_probedefrouter_probesendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedlo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmain\l|9usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedmainusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsltget_envget_termraw_modeeditcharbin_fileplinenumopt_xopt_shiftopt_jinttoalinenumtoapostoaless_printfap_linenumap_intap_pos?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorread errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmain$s$,X4   @(04 <@D(4@usage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[S~UWf)_pvHv9!LRFݞV7[KRlLjc鋴7)ou89Z'/z%ߩD-tv`Pqkky/_w+b0A]Βs|et2K2]&U,\yiӕWi&2K%giYRe #`A Mr0L4]^y <&Nsӵ%Z< b5r腔MQfRqna=jr1 uE`Cn @JEgu—7w2NUhW 2ҫ4:Zu"uJ̆^DIENTzJ3Q)̶viİxz2O3/y:8h =0 TͶ`/^ UrDXp\ fB݊38 :OEfK6  zbbrJ"d4/bb\lluN >ԏnڛC"IzNx%Fyq5{0S㙧̅S:Hzg-U,![[hMmv i`mb窈.,4⠈Kuch/Nެ Jr ƪ!g`%͹h_rnT*Ѻx₝#T8ҦC` T+OpipL6l7gmQY+u|cNV] y$fKâ 7Wg`kw`T\MT˩x?גoz*^5[EAuoUӳYw)(aDq '}(ⴏ?,ڂ"725$!5; ;uq䑊! FdR[1KA5|H,aZE+FiBa_v׸SH֒Kc7 {'yG/K$ <> .< ī=% "h1k$ :ɣ̺n~ :g-%[/ sGBmE^CV*Q n]ϣ D֡W*^J{NfhXF `K+ HsLby֪H=e Yq-ya@- DoCeŸB#D ƺ\)[Xun>0.8BRŴ&yM;PrZxiD@o%d?Yņ2H3gUX9Ykw5E!fltqf=k ˗ eH`j)8XG)-0K/6MS6m? OT{c8I) dzjI WPxeֱ>5톟j/D J}/[VWx7Y ~'m4Ģ&$v,zv%ʟjvwO5;dBqF48xlhفeos!=;o6xNtG>P˷//~OB®s%;y,ݍ-?- 7Y郢J|AI 9Ga_~GHx|2wQ׷ []Z?|9vYXr8:9&9O'Cq]k*?_՛@t_&{;noillZi\(9Bgl&Khz-efeԝ%2:F0="_&GtQkfU`S zv_ŐlkW:]]?@: ̶0:DFRJ#]㱊\M᳉v=M^T}e/nLs mǤX +oʰL)uUB~GaF=}.eQҬ+D #Hfҗ)FY a>,J#Ӿ&Qٖ#L \*~Dxl/,wwDZp?3Oqp`[L8~xrs%&3훗΁i;Gv3—@sH,=W4@L-[naϨ[v)a9$2K*9G[-"Ò+GkvUߘϣ7jFYLQ,3E9]̋$^6qWot)3=u$=Pː >%_ȻNñjXk^߯7迺;9E"FMFz> Ǔd>tynzV/hcS^ˏd7`;@Tj|ts/jQ#HTpѰ^OW˱ZRolkB(e/[>Wvrn~Kgj~?? GD/4Q|29eJ0ӳdh8r#FITZ@if1249LItl8uf0>;φ%p|r20:I NN߃͢-Qh4:@.fyцRIat6[&h@L\)ݡ.'NM>/͵f2NAwK0<$iz0g rԱ<YTT޸hr' l9e pN#o;qZ蟕؝›*ٓ[m&^S~od({jMRƷᾙZ~d\ sS& vTW*w_|R=kh{+AߘN 2usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].ieuf:c:h:s:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.bin_fileinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches umountfsusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s Bad MNT RPCafh:t:vmain$s$,44@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%smainusage: sha256 outfile usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitor,yG8y,yDy4x4x4xLyLyLy8Tynetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sking bula sez: set_metric with invalid keyset_metric: %s is %sinvalid table id: %srouting table %ilabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; 128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %s (%s)entry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:v/dev/nulladdblackholechangecloningdstencapexpiregatewaygenmaskgethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:url_getauto_fetchldataconngetreplyabort_remoteinitconnhookupmaingetitmgetptransferprogressmeterfileindirremglob2ftp_login KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Extra `@' characters in usernames and passwords should be encoded as %%40Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): main$s$,4@4 X usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreloadget_ifnamepriv_script_write_paramssend_requestroutehandlerparse_reject_statementparse_option_declget_rdomaininterface_statusinterface_link_forceupgot_onesend_packetif_register_bpf5pretty_print_optionr8""@"P"X"`"l"%8t""" " "&t"|"#"$"`""""#  # #!$#,# subnet_numberbroadcast_addr#J##4H$$$$$,$$@$$L$$\$$h$$x$$$$$$$$$$d$d%(%,%D%T%l%%%%d%%d%d%d%&(%(&d@&T&dl&|&&d&&$&$&u&$'$','<'$L'$`'x''''''''(((<(T(ul(ux(u(($((($($($($)$)$ )$,)$@)$h)t)u)u)u)u)u)u)u)$)u)u)u)u*u*u *u,*u8*uD*uP*u\*uh*ut*u*u*u*u*u*u*u*u*u*u*u*u+u+u+u(+u4+u@+uL+uX+ud+up+u|+u+u+u+u+u+u+u+u+u+u+u,u ,u,u$,u0,u<,uH,uT,u`,ul,ux,u,u,u,u,u,u,u,u,u,u,u,u-u-u -u,-u8-uD-uP-u\-uh-ut-u-u-u-u-u-u-u-u-u-u-u-u.u.u.u(.u4.u@.uL.uX.ud.up.u|.u.u.u.u.u.u.u.u.u.u.u/u /u/u$/u0/u%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %ceof in string constantnumeric token larger than internal bufferstring constant larger than internal bufferappendbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareinitial-intervalleaselink-timeoutmediumprependrebindrenewrequireretryscriptselect-timeoutsendserver-namesupersedetimeouttoken-ring%s line %d: %s%*c^ %d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216opti 08`,P<  ,P3`[~ [~,P`@@<@TU ,P`b,P``?A,PYm,PZ3,PZ3 m^A,P Á,P Á,P Á A,Po8,P vL ,P* #9A,P,P,P PVA,P,P,P  5A,P-u~!,P-u~!,P-u~! A,P-u~!,P8,P8 K t,P ,PES!,PES! RZ.),PLF-,Px.,Px. `F,P(,P*,Pi{+H 8 @    ( 0 P PNBoA,P#),P*,Pi{+ X ` h p x Pm,P#),P*,Pi{+ ,P/,PC0,PC0 J,P&u1,P&u1,P&u1/tmp/fstab.shadowAY,P ʧ2,P ʧ2,P ʧ2/tmp/resolv.conf.shadow(̗ ,PZ3,PZ3,PZ3/tmp/hostsş%A,PO6,Pu%,Pu% 6QA,P',Pt,Pt RPA,P'?,P2,P2 A,Pn/ ,P/,P/ A,P&o0,P6,P6 \/SA,P8,P..),P..) KkOm,ɻ16[TH콲YTX`XĕD_=$(`.7X)uS_jћd ]~bK>cCrWT .D~+t1wi\+Y{a:Bzx)٪@-yFg~8o繒ce.~S+6D;FSr!I:knsD2Ae'^}UՂ. ]D+΂ DðJLx n]#F@c:3Y6@=d*=$F>=6h, Lm<B5_V':yC",]QiEIo6"ArEbd Oo=^w# z6{J&w}F\2#QFǫ@ hHbKysW|Ưw$ =VZVդ!Xƹ,- Xox*h#$,t'$s 8 n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs(K8KJDKPK`KlKKKJusage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzZgzz123456789ab:cdfghLlNnOo:qrS:tVvcfhlNno:qrtVvfghqr1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup(0<HPXhpx],  @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%ubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %d to nextinode %d cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:cannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%u (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %d/%dphase 1b, inode %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %d out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),single_user  delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't get %s for controlling terminal: %mcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsmainmkfssiginfousage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %lld sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %d out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d sectorsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %u): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:pcompileflush_appends\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvԄx ܄ 4 \8 X X x T  ` 8  X ,X 8 D Lh Ph @` T\c_umaskl$  3  ( 4 @T Hh Px X `x l t% | ( #  3   8    ԙt-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$@(t(f8cLd\sllmntpx_modex_search_histkb_addx_bindx_emacsU |h y Ԋ$y dy v v (v 4u Hp \f hh p8^ Dy hv `\ @Ig 

>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_printhtdoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }(t4$`gmatchgetoptionsacěԛeܛikl XxmCĥn$f,4|b<uDPXprq6sdhpvxxdo_phys_pathshf_vfprintflt|  8  u  ܠ4{}ğȟX ~~~~~]]<>!let||&&()str_valy 4,H    $0<DLT@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tainvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*ld.%02ld%s%s%*ldm%ld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %sexceeds allowable limitbad limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $() input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlcheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id\%c%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{}[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devliststr2locatorbio_changepassbio_deleteraidbio_createraidbio_blinkbio_setblinkbio_getvolbynamebio_setstatebio_alarmbio_inqhmac_sha1pkcs5_pbkdf2Invalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: invalid AOE dev list: use nic,dsteaddr,shelf,slottarget not specifiedunknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKTarget %s: %sBIOCINQBIOCVOLBIOCDISKDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuild%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s FailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %7s %-10s %14s %-7s %-6s '%s' usage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostnamegetnetanswergetnetbynamegetnetbyaddrIN-ADDR.ARPAbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetanswergethostbyaddrgethostby*.getanswer: asked for "%s", got "%s"-_//etc/hosts%x.%x.ip6.arpa/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[explore_numericres_querydomainNgetanswergetaddrinfo4DTXgethostby*.getanswer: asked for "%s", got "%s"# SHA1TransformSHA1Pad/etc/groupgetpwnam_r/etc/spwd.db/etc/pwd.dbether_hosttonether_ntohost/etc/ethers%02x:%02x:%02x:%02x:%02x:%02xsscanf__svfscanf  __find_arguments__vfprintf0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad baselogout/var/run/utmpreadlabelfsJJJJJJJ(XJJJJJ,JJ/dev/diskmap%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label%s%s%s%c%s%s%slogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s@BKMGTPE0B%lld%c%lld.%1lld%clogwtmp/var/log/wtmp\\#tgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) longjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/%u.%u.%u.%u $(,4<@DLPX\dlpx(ļ̼ԼSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THRq[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL,4 ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksregerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.db/etc/networksreadpassphrasetcsetattrglob2authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory ,8DPh|(@Th,8DPh|(@ThHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTSHA256EndSHA256DataSHA256FileChunk0123456789abcdefunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d ip6_parsenumericgetnameinfoasprintf%h %e %T b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityanMD5Padinet_ntop4inet_ntop%u.%u.%u.%u0123456789abcdefInfinityNaNhpx^[Yy]^[Nn]yes646NONEUTF8@DHLPTX\dlt  ,8<@XdpSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p__stack_smash_handlerstack overflow in function %sasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt  ,@DHLPTX\dltdX8<X-0%2d%Y-%m-%d%03d%H:%M%e-%b-%Y%04d%a %b %e %T %YtzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageclntudp_callclntudp_create: out of memory __hostaliasres_queryres_querydomainHOSTALIASES%.*s.%.*s __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_res_init/&ndots:insecure1insecure2edns0/etc/resolv.confLOCALDOMAIN;#inet4lookupsearchnameserversortlistRES_OPTIONSenvinet_pton01234567890123456789ABCDEF0123456789abcdef  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/etc/services,/"|"too small ((((( AAAAAABBBBBB connectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dvsnprintf(8Tp(Dh8TlRPC: (unknown error code)%s: %s - %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_sa<xdrrec_create: out of memory perrorlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANG(<Tp44HTlx$DTd|,,Ll $Dt8Tp0@Th|0L`|$8dxUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supported,8DPh|(@Thxdr_string: out of memory xdr_bytes: out of memory  !#&(*-/14JJJJJJJHJJABCDEF7yACnF?O8M20HwZ> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directoryHHaxyܟbx@py$$BxyDlcxxyĠĠdxAyexTy <PfxypFx\yСgxy@hxXytixPy$Ԣjx'$Jx!hy4TKxylLxyԣmxy nx"ty0DpxH%Px$dqxLypĤrx"yؤ sx!`y`xSx!yux"yVx#wx"y<pxx("XxAyyx|y zxyD\"xD!|~x!ly?x !#x&̧xAyxdy8xy\... (interrupt to abort) (press RETURN)s8444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUЛ4Pud( ,Н44|X u|ğТx H|dP,tC@tЛAB)CDEFGHUbV0ab mcefhi(L<lPn\qdqlrxsvwxur  $ , 4 8~DHܠt`rLT\dlxx r!4"r#$%&'g( t)*+,-./01234567J  <`x8X$ priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP ,\dlpt@J( 0(EHC P E(  0(EHDHC |9HtJ4E ... ...,N,N,N,O4 $s$,4@4X@@@%s: can't read disk label; disk type must be specified......Xmmmй$m  (m,m0m8m@mHmTm\mtm{}abcdDgGhHilnNpPqrs tw xy !:#=04 P(t0(<`49(H(H@LTrЙ(8L\lxrX4h`qxh^^Ĝ^̜^Ԝ^ܜ_D_l__f__ ` _ xx:xx:xx:xx:xx:xx0000000000000000 LYJ8JĜJ̜pJԜ,JܜJJJpJfJJJJоԾؾܾ    X   $ ( 4 8 HLPTX\`dhlptx||f !"#ȿ$Կ%&'()$*0+<,D-L-\.d. /0/0p1t2x3456789:;<=>?@[\(\8]P^\^p_|_`{{|}}~0<Xh9 0< P\ x 2 ,8J\h^^Ĝ^̜^Ԝ^ܜ_D_l__f__ `aacba?J (0<HPXhpx], kh455XRuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~|,Ĝ̜Ԝܜ f@X<PstLuu tlwdvTyv\{    P    P  H   P  $(tN\KK0KK`KT\TTTTX|W[,[ZZZ,ZZ`YdYYZZZ,Z`Z`Yg@aHghjHk_8i\tY@p}.shstrtab.init.text.fini.rodata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PPddpp]%$t$tG+5:;C;$H< O$<$V,<_-dkv44 . ..chowndhclient~ disklabeldmesgfdiskfsckm fsck_ext2fsfsck_ffs~ifconfig~initmmknodmount mount_cd9660} mount_ext2fs} mount_ffs mount_msdos mount_nfsnewfs newfs_msdospingmping6reboothaltmroutertsolumountsysctlbioctl*dhclient-script uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 R usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R bthub0 bthub1 bthub2 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 R sd4 sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio R bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 R diskmap vscsi0 nnpfs0 ch0 audio0 audio1 audio2 hotplug ptm R local wscons pci0 pci1 pci2 pci3 iop0 iop1 uall rmidi0 R rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 tuner0 R radio0 music0 video0 video1 uk0 random lkm tty00 tty01 tty02 R tty03 apm crypto pf systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; nnpfs*) M nnpfs$U c 51 $U 600 ;; music*) M music$U c 58 $U M sequencer$U c 58 $(($U+128)) MKlist[${#MKlist[*]}]=";[ -e music ] || ln -s music$U music" MKlist[${#MKlist[*]}]=";[ -e sequencer ] || ln -s sequencer$U sequencer" ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; hotplug) M hotplug c 37 $U 400 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; . ..MAKEDEVconsole tty memkmem֬null֭zero֮stdin֯stdoutְstderrֱksymsֲklogֳbpf0ִwd0aֵrwd0aֶwd0bַrwd0bָwd0cֹrwd0cֺwd0dֻrwd0dּwd0eֽrwd0e־wd0fֿrwd0fwd0grwd0gwd0hrwd0hwd0irwd0iwd0jrwd0jwd0krwd0kwd0lrwd0lwd0mrwd0mwd0nrwd0nwd0orwd0owd0prwd0pwd1arwd1awd1brwd1bwd1crwd1cwd1drwd1dwd1erwd1ewd1frwd1fwd1grwd1gwd1hrwd1hwd1irwd1iwd1jrwd1jwd1krwd1kwd1lrwd1lwd1mrwd1mwd1nrwd1nwd1orwd1owd1prwd1psd0arsd0asd0brsd0bsd0crsd0csd0drsd0dsd0ersd0esd0frsd0fsd0grsd0gsd0hrsd0hsd0irsd0isd0jrsd0jsd0k rsd0k sd0l rsd0l sd0m rsd0msd0nrsd0nsd0orsd0osd0prsd0ptty00cua00rd0arrd0ard0crrd0cwsmousewskbd st0rst0nst0nrst0 est0!erst0"enst0#enrst0$ttyC0%wskbd0& apm'apmctl( bio)diskmapwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: dialer:*:117: nogroup:*:32766: nobody:*:32767: root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin bin*Binaries Commands and Source//sbin/nologin1bintrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binrrootdaemonCharlie &/root/bin/kshn2rootdaemonCharlie &/root/bin/kshn3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs 23855ab11f28c11bc4809fce92bab4bb42eb554864e9e0538b39a25370544fb7 85501d4d2657e00b79bc5f96741ae1a389bb746188f6f1f752551d4d1c1a1f1c 990f68cd18b68fec91edca580dac491afbe94aa1623de50744475d011beb3b47 f4534bd49c187f41cafcfd3f4ca2bc5bf1c22613e0668a3a8ec72b45b3fb8b23 ff0c41884b533cdd34fb24835c81a0054ca430a5d0b0241d80eefc907e7d2e03 d926f0abe55ef53b7bd0830f336e2441c65e5b7ee74bae37e96f029a03b96069 #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete route -q $rdomain delete "$old_ip_address" 127.0.0.1 fi } ip6_delete_old_address() { if [ -n "$old_ip6_address" ]; then ifconfig $interface inet6 $old_ip6_address delete fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address route -q $rdomain add $new_ip_address 127.0.0.1 } ip6_add_new_address() { ifconfig $interface \ inet6 $new_ip6_address \ prefixlen $new_ip6_prefixlen } delete_old_routes() { route -q $rdomain -n flush -inet -iface $interface arp -dan } add_new_routes() { route -q $rdomain -n flush -inet -iface $interface for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route -q $rdomain add default -iface $router else route -q $rdomain add default $router fi break done } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } ip6_add_new_resolv_conf() { rm -f /etc/resolv.conf.std6 if [ -n "$new_dhcp6_domain_search" ]; then echo "search $new_dhcp6_domain_search" >>/etc/resolv.conf.std6 fi if [ -n "$new_dhcp6_name_servers" ]; then for nameserver in $new_dhcp6_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std6 done fi if [ -f /etc/resolv.conf.std6 ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std6 fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std6 > /etc/resolv.conf rm -f /etc/resolv.conf.std6 chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ;; PREINIT) ;; PREINIT6) ;; ARPSEND) exit 1 ;; ARPCHECK) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi add_new_resolv_conf ;; BOUND6|RENEW6|REBIND6) if [ -n "$old_ip6_address" ]; then if [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_delete_old_address fi fi if [ "$reason" = BOUND6 ] || [ -z "$old_ip6_address" ] || [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_add_new_address fi ip6_add_new_resolv_conf ;; EXPIRE|FAIL) if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; EXPIRE6|RELEASE6|STOP6) if [ -n "$old_ip6_address" ]; then ip6_delete_old_address fi ;; TIMEOUT) add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete delete_old_routes exit 1 ;; esac exit 0 Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu  . ..archm catdatemchmodchgrp cp dd df edexprmhostname~ ksh sh ln lsmkdir mteject mv pax tarcpiom rmsha256sleepsttym|syncm ... ... .B.. .B ..misch:keymaps . ..termcap echo ${user} > /mnt/root/.forward mkdir -p /mnt/home/$user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | /mnt/bin/ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_rootpass"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: - $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig (( nifs != 0 )) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || \ { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == "none" ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || \ { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi _i=${#_fsent[*]} while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent[$_i]="$_mp!$_pp" : $(( _i += 1 )) done >/tmp/fstab munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF `tar cvf /dev/null [A-Za-y]*` >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && \ (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp $FTPOPTS -a -o - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) (dmesg; cat $SERVERLISTALL; sysctl; route -n show; df; ifconfig -A; hostname) >/mnt/dev/arandom 2>&1 echo -n "done.\nGenerating initial host.random file..." /mnt/bin/dd if=/mnt/dev/arandom of=/mnt/var/db/host.random \ bs=65536 count=1 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=`/mnt/usr/bin/encrypt -b 8 -- "$userpass"` uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group 08`,P<  ,P3`[~ [~,P`@@<@TU ,P`b,PA,PvO,P9%,P9% )tA,P Á,P Á,P Á c1C,Po8,Po8,Po8 ,tA,P,P,P vL bP_A,P vL ,P vL ,P* }A,P vL ,Pb55,Pb55 2,Pb55,P,PmJ)|.ҕNqRm@K4 bGO~WK?jeא.LQ4 :?}S2wUA=xet/KgLP;eT"?aHR蓈ޒvTrp`Z` 2@a6|pZN S0~T4vm19I&qgYI jk| 0v{V"wa|'{WzvT'`!kZ DTQeX;P01):t8S{Qqc@S`O13*l!Xe`M"Oj*I%B{_k0\ խ)R)#2˩] w6@(#^OL%7Ta5ةQmy"!lcRZb 0A=IP*FV4 <Yz8_Krl(2U4NqDRez0[ 2`BbQs56xB +/Zj+l]quHZL&A8UNc>L . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -ne "$1") IFS=$_oifs } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read -r resp?"$1 " stty echo set +o noglob echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _q=$1 _def=$2 _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" read resp lock; rm /tmp/update; unlock if (( _redo )); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap (( _int )) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _oifs=$IFS IFS= while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ "$resp" == "$_password" ]] && break echo "Passwords do not match, try again." done IFS=$_oifs } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) (( ${#resp} <= 31 )) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) (( ${#resp} <= 100 )) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (( $# < 1 )) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi [[ -z $(cd /dev && sh MAKEDEV "$_dev" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break : $(( _vl++ )) done _vd= while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while (( (_vi += 1) < 4096 )); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if (( _vi < 1 || _vi > 4095 )) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || \ echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && (( _vl += 1 )) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && \ ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn (( nifs += 1 )) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' > $WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" [[ $_haswpa == 1 ]] && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then set -- $(v4_info $_ifs) addhostent "$2" "$_name" echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then set -- $(v6_info $_ifs) addhostent "$2" "$_name" echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do (( nifs += 1 )) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ -z "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" local _bad_dir=/mnt/usr/X11R6/share/X11/xkb/symbols/srvr_ctrl isin xshare${VERSION}.tgz $_get_sets && [[ -d $_bad_dir ]] && rm -rf $_bad_dir for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd | tar zxphf - -C /mnt ;; *) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd > "/mnt/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/dev/null 2>&1 && \ SM_ARGS="-s /tmp/etc$VERSION.tgz" [[ $_f == xbase$VERSION.tgz ]] && \ ftp $FTPOPTS -o /mnt/tmp/xetc$VERSION.tgz \ -m "$_src/xetc$VERSION.tgz" >/dev/null 2>&1 && \ SM_ARGSX="-x /tmp/xetc$VERSION.tgz" done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { (( nifs < 1 )) && return set -m ( ftp $FTPOPTS -a -o - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { local _dot # XXX [[ -z $ftppid ]] && return while [[ -n $(jobs $ftppid 2>/dev/null) ]]; do echo -n . # XXX _dot=. # XXX sleep 0.2 # XXX done [[ -n $_dot ]] && echo # XXX } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (( $# > 1 )); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp $FTPOPTS "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp $FTPOPTS -o - "$_url_base/index.txt" | \ sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then package_path=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else package_path= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && \ _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } run_sysmerge() { echo "Please run sysmerge(8) after rebooting to repair your /etc configuration." #if [[ -n "$SM_ARGS" || -n "$SM_ARGSX" ]]; then #fi } update_firmware() { echo "/usr/sbin/fw_update -v" >> /mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed -e 's/, ctime=[^,)]*//' done 0 ]] || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp # if aperture was n, do not ask for xdm fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') [ COLUMNS -eq 0 ] && COLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -l% s%r%(?%?h%?<%?(j ?%?̀%Ā@%?%$?,%3@8%@ %@%,? %4?%ffs>ext2fs`=cd9660D=msdos2lockf@` L@T@\@d@l@t@|@@@@@@@@@@@@@@@@@@ ) ))(d2*1*1*(X*4* *****) ))*ܚ*X*))*******D)*****Ԡ***(**)***H**T*** ))|***(*((|*(*(<*|*D)|*****Ĩ***(|*|*|*|**x*|**. .. `+D+4+)T++L+)P + +|+d+x*++*@ ++$++++`"++*++ +h+++x+*+`++++<+ @5+3+jj j^^3333?++#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T56 T7 Tcde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ j@j H ,,+ ,4 ,+X, @+ j@jd, j.`.l-$-|-j.D..4..̼.jlhY.L...P.ԣ..j/.8+.).,.j-8+.).,.t--j.8+.).,..j).8+.).,.j-8+.).,.P---p-j/.8+.).,.82.t@jj+ dXjjjjj<8Q @X,xjjjjjjjjjHjtjLjPjTjXj\j`jhjdjljpj|jjLo(@AAA==(A* dd%(i @@@@@@@@@@jjp|pjjjjjj$jjj(@/ę/P/̙/ԙ/ܙ/0/@///T/@x/D/l/ /@8d/\///@ //// @ X////(@$///L/\/0@$///L/$/8@$D@ @///// L@ @,/0/ /(/T@ X@ ./P/`@ \@!//HH>H>H>^0hn0T!00$W04w0X0<0,0)1x00)0000000400d000000p0.0`00000)0`0 100T0x0X0<0,0*1X*))0*000**D)****00**`0**)** 1H**0*0(00000 ... ...X0<0,0),1q1$1)0q1o1H1P510,x1:11n1000$Q1E1r1$o1|s1y1du14t1ă10|r1L1)X0<0,0*,1X*))0*o1H1P51**D)****00**$o1**)**ă1H**0*11111111 j0jjG@133D+3#3 33#32j)43X33j.D.744.̼.jl.....jH4444x404j:43444x4333j<3j+Y4j,x3j).44x4.j.44x4jH444x4$4\P@jj+@C3B3@ X Xdjjtjxj|jjjjjjjjj@ E8(@AAA==(A*DjPjTj`j\jjhjljpjtjXjxj|jdjHjLjjjjjjQ jj  3>9>x8>9>:>k@xqk@|q k@q$k@q(k@q,k@q0k@q4k@q8k@q+(9+(h3+((((((((<66T6 66(((`&((((((((`&6666$6(((`&(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((x%z%p{%(8y%(({%(y%((((((((((((((((%%h%%%(((%((((((((((((((((((((((((((((((((((((((((((((((((//((X/(((((((((((((((((((((((((((((((((((8t%@t%((Xw%((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((( 7877(7(@7(7L77(7(7(77X7(h7(7(477((7(((Ԑ8|8 88 8(8(8((((((((((((((((PO8xN8J8J8I8A8>8x((((((((((((e8\d8c8\_8q8( V8(T8((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((`&(((((((((((((((((\%d%l%t%|%(((`&(((((((((ahGH@p?l?|@>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy@7777`7x7H7t7777?@@@@@\@D\>898D5868@`AU8DT8U8`T8U8L&A  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  AH88H8L&k>0AA A*8l888TAD A A# #  AD A<AdA{{A A9Ƞ9999 9|A9$9h99H99Ax99T9ĵ9$9A99(9p99Al9909x9T9AX99<9(99A9LAp99 99TA` :::99,9999h99<9AA :5hv1! !vvvvvvv3 P q q2vqqqqCW 2D k"{"{"3" dAdAW 2]\ \ ;   A0A@ATAQhA|AAAAAAA A8AA::8v:`t:TA:ȉ:8v:`t:pAԌ::8v:`t:A:,:8v:`t:A:D:8v:Ԓ:A:@:8v:`t:!A::8v:`t:X!A:,:8v:`t:!A:$:8v:`t:!A::8v:`t:!A0:\:8v:`t:!AH:t:8v:`t:4"A`::8v:`t:x"A@:T:8v:`t:"A`::8v:`t:#AX::8v:`t:#AX::8v:`t:#A::8v:`t:'A::8v:`t:d(A(:8:8v:`t:(A\::8v:`t:(AX::8v:`t:X)Ap;; ;;x@p+;8+;2;<3;H ' 4' X& & H:;:;H ' 4' X& & L=;=;>;' 4' X& & ,;l-;<|;,;l-;<|;BNeN3NQ"NQ!NQNQ&3NQ&!NQ&1NQ1NM1NI1Nm1NE1NE^ & b .,f,b,b܂bܚbܑb܎b܍bmb܁SB1 B 1 11111 e T C B ꂀ"T"B"TB BBBB0A@BPA B0B00B3B5B@@gAEBFBHhgAPZAQBRBUBXBaB0u@3B5B@BABEBFBHBPBQ aAR_AUDaA`Bb Bc Bd Be 4Af Bh  BX h< 9"%52*'h=$$z-P/j ;2Kr2X,Xp\g((xF:D`1P 5 +/D02D9ljȰj#P?='d8:lK-4T&_Ha,r(0<9Xl9 xj6,\h(r)8B',\ 4d#j*"$;9(JjVB9La,-j+x>z*D7|< $3p'`jh?<Hqpnqk`k(8(5(=Dԧ:PQ-|c:o|j}5,\"$\9Й&\x8Pp"!`T+<M3|T!0x/@$@ '/,a#0K-[8n I6Lx;p*|()W=Ԅ4*j9|88Xp-5"D80,v&66hBj$T@V-|lt$ ~ s!x tHoL 4!49tB3@,p j<8+;8Z70-h7(<P%8L&$X$z%jDjt,4/$84=w+X*8#L:h9P!3-F'85 k>!M("=@\jm_$v" p:hT lD>j =+hG<)o78n6` o *" 8G"(2 |oC jI 'XO BZ X)Db (7n $k H1l L& g6L i( B! P*h - k HA= 2 \B $/( 9@> <6S j] *'q 9&`{ |2l D1 N-\ 4j )L =*T 58 4= , ȁ%p+ 4`9 DoG #] /8i T%} pT/P 0,| 5h ,D "|   p6( k  $ \/0 u%8) -7= !K 89;_ >`{ D>  0j$ `1 j h!0 qq . X@= > Lq q-X. 7TD : S 4;hk t1X /| ز.  Lo г7 ) (4 q  ؕ, )l 7;8Z:|4*p*6do@h (lM"hhj o9$|o@'#%@8:20=YoB2<&P7x'j8>D4XRh3+|^(A)<h! w.5l($@t%8 *DT9o3T`& 0 &D0ܓ'@I6xIl7Tk;7~رj'd]=@\:| >ȀBTq'HX%h@8XS.&(p5 :0Bt6XKv-LV&i)'Pqkz;8#5(j|-t8L*${6 8t%1ć>8 (Ev%hR0^5 Z$&Pg(_;y$5$L(2@j4z83T~*D9(H$o'\?7x-68Ti(?$k$LH2]p!m4*z({6-j 2t0 8X;T Ĥ1R+DH&<&$-H/,lF8%W8`j[)t>~H6,DD2(&,&Nq% }`B4  >jȃqv)Э/<(<ث7( 5!#!dd'$/,==5; hEln1Q+Xx.'lP<z /(&,ZoPk87S5Ḑ1$j5<@C=h(d9,$+19pCF#OPr4Y',j@qs*p9 Pq,8pd4Xjh/H+d!8('p 97.) EBc9k09<z88 j :,ȋ97-Hا&di7$Do -o'`",7\1d@'dL#ct&l80{~4k28@8k+\7+$&l 9B@jH:'n6Lto,!4A >LU"8]5Xxxp-xy*@T$4:t؞%89=qh+p"oM"y:\"`'\k" \7H|"@""+";"d9"8"+4"j"p0#Zo #>#0j #9d*#j4#G=<#%xH#8$T#Tqk#ě'u#h'#,8#@7@#2#0o#:#A9#/T#<=@#G:$5,$,$1$4,I$8[$l%pt$%<$8B$h9$j$`l7T$7$'$Pk$&H$X&X$Գ&%l%D%0|$%xB8%!F%(z7Q%`'[%&i%DW'x%|'%h'%%#T%xj%-%8K*8%H:,%7=%(&)p%Zo%(z&&-0&j&"&5<5&_$dL&o(\&Ȋ $f&8v&p%<&#&\<;,&|!,&h0;h&+&9'K9'X!$'&8<'tnqO'&(U'#Dc')l'd.Dw'#'PH' '\c6'2'%'p7t'"='Xq($8=(p(9-(0j<(n` K(@pY(qf(ئ3|(|7(H.(;L(<[9(6*$(p=(>(5X(020)>.8)<&(%)j,),XB)'M)X7=_)5s)@.) +")0p)x9)D}6)O=)TS;)j)HX8* 8P*8')*(%:*`k:F*.4 P*D"c*"r*F+{*аj*'H*49t*L(\*3* -=@*H2l*0I+L*u%8*C(T*") +)+v'%+Io0+#A+<#|O+d90_+X'xo+.3z+o+`$+8$+/+ȱj+%+l"L+B+@7=+0 +@8L,T5!,+2,|k%DL,\5tb,/o, A,,8 8P,H"X,)l,(j,D%l,e(,W!,(7,,r1t,\+ -8-T: ,-"?-DjN-$8Z-8kb-69`l-Toz-5-9#h-| -9\-j-X%&-O.G.L.8( _.%$0y.o.%.(12."2.)d.\ k.B.:\.(48.%.L#P /("/!*/XL l`0l^&(1v71l11j21%'@1"R1\Y+o1)w1<:D18151.0189d1t"L 171C=1)02%2[82&T)2\@2d72"D2H6U2+Xc2:8y2272D+20o252j2Pk42&X2Ђ=02( .L2\93M6 3`q%3L`+l:31;hU39d`3*Lj3x;7}363$j33+X3%3X{$h3N$31x3h783q 4h/4<&4;14pj=4`f+XS44 `42,n4Dj{4C&X4$ 4@/ 4z&4H&@4p$46x4j42p5Вqh 5*5"\+5԰6>5<-W5t% j5>"52<5ęj5 <5.#54<5Xo5x@*,616S!H&6dq86D0C6 /\O67_6ܚqg6.#l6`o6#6,B6(*860t6h?669l6j6Po 6|)78#7#0!7 #17e8(:7(#XH7q4Y70d79@p7q8z74 2X7\*7)7'L7ȏB707dk76@7\"&,7}&88D+3T 8T,H#8 j-80;@8l2 R8o\88xj8#{8/08908 +8j8`%'d85;D87<8j 9xo9 !9D5 795@L98b9>8@p9R5492 9@*9L&'9@!9$*9)9<\9 j9 2<:,<(*: j5:X9$$J:P R:?3H^:d2*i:98w:1">8D1>4#<>F3J>)R>&`>%pj>`0,T}>8>7=>*>j>89\>P,0>,>+?j?# !?<4/?36?7=I?8W?h#%i?(0 r? 5Px?h'?(,=@?|9?t> ?4)d??:,?%t?@3`?9$0@$9t@lj@o1&@B?@d9I@X8X@hjh@0Ht@)@",@3%@00@*@4><@7h@?: @2>@)lA-(AI#08AI6AA,(8XA,cA*TlAH! uAqA -A *tA>;\A!9A'A"A44A98A@v6 Bؑ>BO/PBT8h,B0_)3B8$IBqTBD1vBoB7BoB!$lBB(BBB`1Bc/4B'Bd5XB  CF8 Cܵ+ )C'&,8CjIC"[C023dkCP){Cp2$C(1hC#C%CoCB)( C+ CF(CĀBC60C0s-$Db9DDl@-7D#$LD/(XDK8PfD4 rD25hzD`! DHjDd~34D(D7(Dw,,DH+PD*dDD+`D&< Ep%$E8<)E76E`jFE|oPE4']EY*8kEI%0rEȫ"E2,FE1F74 F*F> F FU=FX"F45F2pG4/ GoG4&x&Gq,,?G#"RG9iGD8lzG7lGJ,DG("dG2(G23dGD-\GXW!xG7lG(k HD8=Ho&Ho(7HX!T?H|!\PHH:;bHHh9lH}*<wH\'`Hh"HT/H)HjH)HW#H6;PHT>TIj"I(0/I4q!>IjEI2aI%oI`U=AtI, k}ID$$I)=pIjIH6(IxA$IjI06=I < I<;I mJxp~J"(Js9J0S"\J\jJ7J8pJ4 Jlg-JjK''K_"l7KjFKpp-XaKd1(nK$-{K(K*KjKjK̛jKjKl,6X K!K> K kLH/L'pL!/X'L7 6L #LL9^L`X9mLl[2LL;L7DL/LQ!LjL|%$L~!L8L@64L<7*MU9M|&\"M6,7M"hKM9pXM7kMh.uMj}M#DMb>xM4%4M@6M+HM,jM('M;9MjMx;Nd7@NXjHN$T*|'N&.Nxk8N+:(ANj PN~%cNk pN )|{N@E!HN,jN> Nq`N\5HNX0NZ!LNnNY*8N RjR5R20 S2(lSx'&S(/SX]&CS`19dTSD!djS@;wS,LS$Sxc>SI8pS8)pS4oS(#tS:hS8SH(S%0 TljTH#&TT61T8%>T|C;DNT $XdT(sT4oyTj$Tv+\T8jT(T`)Tg-T" TN%|Tg+ UdoUC:x+Upq 8Ul$<EU̵< WUx7fU5tUȁoUA2`U`)U)xUs*U(|%U9$U0F'\UV$UPG+Vh(` V5VD58%V!H9VT,,SV`R%l]V0`gVt7vV47Vj4V l$VO=V $Vl&XV8 Vh6pV"HV9V'@ W+*WPjW,.)W#P9W24KWT*4VW( dW(.;p|WjWjWxjW-Wy&4W$W8WqWxN8X6 XnXL.4p%X&X+Xp85X,9DX;|WX4eXV1uX|#0X *"tXO XR-HX.Xl%Xh<0XZoX\pY40 Yt%;"Yr8.Y0d7YjCYc9WY3$kYx(rY,*`xY ((tY&Y"Yi8Y%Y' lYܢqYT%( Y 6Z?,@Z6=-Zd5@DZ4DQZ@$H[Zl9gZ0HtZ4%Z\% ZT$Z09ZqZ *Z'Zo[%4[p9[6.[ز>lC[61LT[;g[h)u[D;[49[So[~!D[!4p[Tj[R%[d)[+[ Z',[pB \T/4\j%\J6L/\4>\4XI\ĭ6lX\8oa\@1z\6 \ػ)\: \' \>\)<\ 9\I4\ T ]lk>][9]!L-]j?]x0xL] ]-`_]$<`v]8D]\j]4p* ]j]4%8]!]88]tE3]b3]2 ^=^'\*^.'d9^&H^/;hY^8n$p^/^)X^E'^j^5^h+^d%`^z7^q_|d/L_X&x_ 2'_t(p6_x'>_),I_ [_؀6hj_ Q2~_._9d_`7l_$9H_ k_+_j_(8ePo?eX7&Te/xceT.8te`:,eje+eqqe|+e$'te)0eD `e8oqe"@ f4 ft(x&f-*3f`;JftjQfh4\f?.ljf g*Lsff?Hf>Hf*f%xf#f+xfPj&f@$ fA9hg`R/g1'g@=7g&>g 1Mg\j(igT;yg-(g!|g؛&`g4$8g# g=g` :gK=g9!gj  h&HhI9"h8&86h#DHh:xSh)Dch|v%trh>}h9*h8oxh?'hdw)h(h/h4*$h$hؤ: h8$i}*@ i> i- "idk+i#*2itjFi,-t]i1qiԔB~iK3iIoij$i ,piji4"@i 'iu%8i9i 7HjР7jhqjP}840j&,=j_+lRj԰jbj4#8vjt7 jjj@"|j*j%Dj@;=j&Xjk&@jBj.xj}8k7Tktj$*k#3k:DFk8x-<QkD%8ck0Tnk-&}kP,*k:kB*8kD$dk=k6kT'lkH Lk.hld.8$l4)4l$N.'lj1lg;Fl0,;\lĜqgl<`$ |l% ld!lT&@l&lmjKm-@`m@ +LnmXjmt2,m4;Lm>m5) mxe(tm)"Lmtx-mF2mx& n0* nk n2(n486>nP$Rn+lcnZ7,znT<n7tn؉2,nxB)nln(Dnknxy(nT&,n&\o8j"ot .p/o,"CotoNo,&To go, |o@qPo8loqod4oШ6\o;ho4)Ho)poErxT=Hr8Rr3\rl*jr%xra7PrvKov`0*vt*v '`vȀowl=Xw"4&w684wp/`Dw'(Uw5,aw0z3xw*<wX#wB@wU7 w\_8w'xw,@%w24w`, x*x0k(t-xDq>x|( Gx9@Qx1 ]xpI'(fx+vxn(xjxnx5xSC|\'TS|kp_|p>0s|P'8| 2Hr<B}<Z0r9eW7Tq$1}pTqxj$Pk&pt$`,#'dĂ0тX*0ڂ&L4!|':DH: %\:41@/ D@F(dQ'([jm8{jd,j8=4ƃP#,Dۃo ( o# 9d1T&j4) D(;YԽjiS)Dp`2$d<z*Dpli4qĄjЄ`T8H j[o/14!0606102Bx& W`jjX%Ds B ~51Dl$x(<0Bυ6Hޅ5)Xd&7@ |jB.X<`H>P7)l[XLof%mT L|<;t~6`(C:h/7Ɇ(B҆>:ކ8jP(T\"l# dB(,3`5o M@,Hd jmL T}jd%tm%HqH+Çj̇%4և2l@"@o;d d{:t2L/p 2<FoR*H_@%$dv L1|)x"5=͈2hPjl; t|9- 8|\j),-Bb%x[lqoh'p|7<9D|Xo7(p*0ˉC*ىȷ#"| 9  /`) "#t67pLj X9HeT9nP.}ܙjģ%, '@4;H(r6<Ίj݊.$h=)\>,=$ DK.i+$)t&6D1/ Bt-,PjiTjt# `(k7,'&l7ŏt=@nX#_8j).;,02>H*xVd&4fL'4w 08rq 5dj:Ɛl~2Ґo!4#$@Do $5.X/ %o/$l4:<*EoM04V)8]1(tl$# /8:-tL$4ő8$ޑD6JoxQ;p9(XxB- + /)D>H(dM`%& Yd7dl?=s/=y8`A=0204<ǒ&ϒ@2<(jpp8$L>H@6"M3p/+L:j?S6 IX3<T/H_D%8r k|>,0x ko|G81œ$xؓ)Hpq2X>@P+&+8;<*Ch1RT1'e{&x&) $@pX 8 \jŔ$^>הX-H,1l*@) P/)745Io=8xG&\(!@s%$ P&%*X s%> V8 ,̕:7 *0l&@;@p*+`c4l5qq=6DK'0UTN/Db0BsL#\k4pd'l+;d8Ė88Ԗē44W1}$D8q10'j-@CC8@jO2p$.(&/4ذ1TA'|L@5Y@2Lh4='lq( @y$XH8T\38&-˜+*ɘp!ژ#$ "PO7t`+h8-'8O'|/$#E<98UD*cX)xl F={4o lE;2+,4<\֙4|%t8@j .5<2&j-$"Do\MH<7P_p-Lx6X)"X+&88=ɚ;,( $Pk+S)8 1|D4%xLx^*<UA8Pbt1ṕoyt$D%l241<ȜH>ӜDjq!A=hot,'ԛj:#,N9Ww7Lc'<pow*,&8G#@`B=vP8t(*0/$>q+DҠH7ߠh-DA=8dk.,# #45T#J'`T"bT q@ 5Dy)'<2dl%@2l̡8+֡9y+'-+@ k%<\:5DV|1etj(sȋ/Dt,5<2+Dl )hP"89ˢpq֢,,&X m%4!#,o Xw,,<0(G&XJ:f7$s 5h!&H6+x(#J=ƣ@+DңЁoߣ#TW"C! Ȫ6 ,%%#d<8<IjRp9_7Pt"x70''8pkX,;ƤPY"֤;7j j +4,% $ X2(9&AD#Pp+8`P# oqj$% jB"DTz*DȥF!ҥHMoݥl#|?" c 4/8d1k6lF kOtk8x]h_1to$/E-nX:,,:æ :Ԧp004=MXBb,5g4w0t -<,=4r7X9Ũ\L'ͨtI%$Ԩ<4tl-j:$T<`-88;pB D(8$Q`a+cBkpq qإ>{(;y(xA#@jt$ũI=ݩ40<6*d0Hh/"&H(l4Mo= H=G$4Qqqa4&jz'v=+'%!4C3x(d̪,j$ߪa)&\%Hn!k27'̈680E[* Q2_>$f23Dt^+4> @7ԥqɫ50ѫ4+*ګ0)Dh;441 ]1G+P&&4,خ1;/I%<S4%h^4Bf7@r(\{`6$R p(&ģ8P98H*Dά+Lެxj Ĝ+,h k{0<$*/0l+P6Ԝq ? )Gh(P=;0e7r6`D/`5(Dr0!HI0 ƭD*\ѭ:,ޭk 88+5x/ 4%**\5x}:Bd6U*T`D+l43 x,oT(pBB0*%ͮT9ڮ #_,H`)$j"3/4+@|oL <X|8eܙ/rf9}J=X,P*Tz#,"ί% ݯ<: n(L8V*8 O7%؅2<;H1J+HZ])g8w3X<q7<)<Ȱ:4հ3&<a6R:: 1**7HP4=Xo_|jk;z,*%$@ }!(,Pб$kرV$4/)8G<06<5%7@4 K/=p@6$xjha+ 1L7Px;XͲ04Pٲo1Pj#C* 9(\+&%X;h<H%8X(!ko+Dr]=~hV;x1,(`Tu/8. :ʳ5۳@7̬7p-14.88 T`710BD)J+Z~*@d'pp%Px$lt+ k,+, d8̴,(8(<&(9,=+4<|5.0<E*(\%h`Doo92lP]8 7,ȵ|%0HjD((`'4,>'(f>h27+=*HDdO$NH,,b6Dk?60}dj\؆-@l&@j '&öpp%Xζ$) ֶj޶J='40j x}+P(=&\(4;: >B'DSS$^+"dp1, ):(t90B8<Xo:du5P·*@ͷlj&ܷt+)l7+|/;0'ȁ9d1!=XjKj*4T@%m% }> q68j48D:5Ҹ@+d&!@ԉ2h"\$76Lj@jPKQ7^,.,4uL801@4+ I:`8X6̹l%ݹ n@b+x#;0j%9HHB=ż>2׼+|%T`G"L?9&(X '%؏42\jBX*(Nг(,YԒ:h4%Lxx0h+o|+H8!B ƽxz58ӽ5H׽970l Ȑ<#t5(8P40Ml%Y,%lg.)PrS7d{ 5@0d/L*lxq 5 jǾj$Ӿ$&ty%X"h8T,8 p I0X4jgD5'v:D8A=LB=L<|ѿ8)<L -':X9 $]*' o.E>P: -hM<+X@T.HhL(t*o(P24$+l8$/8oH!|d+0 z5 -lԌ:,*87:3jB%N!eę+Pt$4(,|8Xj4ox#;px*\m7n*o3 ,#GM;XYz9d8rlj6}]1̒+0XjdDo0X"6L7tB\B$d[o pK=H9=_!%$> L7Q:AV9`K%Z#0q(8$HP+8=pp0/,/(Ȝ1Do(\18',jA0=GdA)Pj>X|> dZ2w"x(< doPpf(x[oLBT(j10 98c8`2p8 0*H)=@97 IjX,?=gjt70#P'B ,B=:,8= A3<k*<+:78 C3+R"H_/)@i<=2@01Pxg)`t~}p)!X8B:hK8*<R$,6'8 %0",><hG*`#h`91;B)Moqe$or820n,x"<̩ "= 7,pj 4,%{,8>84J/_(r+mP'wR*!6U'#x8 DK X7>l 2ذj+#0A:M-W;d~*Lpd)0x"@!X8d<H6\5/ *L#x90P'`.!DkK@(pU_t3t`$2;xPj# 7PB1W 2f%hzU9d`3r3d6<j(\6*,To.<p6d|p !%x8l+643xjDdjJt'TXP3(lg v38<2p`>x508@=ho> 4> A80=&\:,2pjFĜ:DTWo`Tjl8)7T+3(,m? I*<|2#x?HjO /\ *j> v0<H"(98%2}2"XHj?<,K=}0d ̼.lj*8 )*7==D> F7SВ9jTj{D%8Tn"0"̰j> 7;l9dĒqtj(,'8EoAx"U|e6HgT(o7$?2 jB4,HZ<`!B\+|D50<#t:t:|q1j? ,RV'Tad6$vj(X%p8To9888.$(!@$~%F:Dh5=$4j6 )+DD*@('<8B;L?8<DHB=WjeX;&t~C=|8\إqĬ1.t$k+|#dJ!X3;H6!/:=3 E8XT64[i& q}$$l!\4z!*$\$H8k07{)hjlj!8&,$969C,3QؔjWIod {$834%( ;@:I@,`u!n!|6P68)4.46p9-x:7d@T6X328*P+-p9la+C!|U*4Hd&0pp)h%j97Xx*5dPoX2@q 08.d{*D6pJ'@'xk3`/@^*TJ8Zqh$S&@y,)n$1jLk%0h#H:$j81<S60"*/@ ;H>$8pJjU*@f$<b4j59d50XUo08d8p"<6$ R2"H,)L+&5A=K(/X2<&(.34A:,L48_-n 5hv1%(h\7ؓBȠ9(88q1Lt&|74J$,e<N0a+0^jlP t~(9~3R!e; 5Dq/$-*|m)H,HQ#|,9=w9 5.t2xt+Aj<L])0[H'xcd1j4t%t,иj4jY#d"<BH6,h9xp85 P xJ7@Do,q7+BjOHn7k7Pv̽j|(h?\( 9(2lojL&4%$0<k*7' 71L)"FT"\YL<bTjiH9sTjD'5PG4@p )܏B#(',B=47\2L, j5<*@@L8I,7Sp #] pH,~*`l;>j`,"ht $#* q.X'%%$88TE6M0[о4n(10 T`N8-pMo(j )x0;Pj 9j(o N;v,<f)$Kh0)\!mt/${8$j8$ 5d/8o؝5T64*D 9x70*`80'w55H%Np<'X *LhjxoHu%88`q5+ljDo ,PF=j>0=!Xo0L8l>=3K8;.@Y*f3'ptl$ܸ*B p=/$j dM6(U3@q#2;Tq) '&H/;4,`j:g:Dp"R:D_'Tj >+s'@$#9p"Tl!P:D'u'8P (\8(;7*j)8D kD`jU#Lj48\||*@8p'ܖ(<oL6$j(K LhA=d*h p) D"& !/(9|:$8Hrq[oxc$huԐB|o >31`X*@=;x*@ )>  $jo:P%22#0J$+[_o ih,=4{O+88pq*&(x(DT9$"$:@)}6 0 V/)T,<*lG$9T\$`2po}`&N+2u6?p-Yx0l4${,)4i, P*\'(V15=&l(% %74&o.&9jEHkOP.Xqo؀o> B8h<*<Բ+Dj̑B;7dPD!4j:&t'41<*l<*H\1TXoat;7tqU;h@j9/):'V*x9-ĝ'87=5 x81(#PA8L6Z9k<[7}<.+l % ,g"17H%%&$`  xg!;$7T4j(P`,<i;w/=}T7pL7j9%970<5X&dp3 1U.  f*tX1!+\0j<8W! F W/ fF$v/H@5=,38,`4D3Lk4T2| 8T4_9 |u0tj.;:*9Ct3W+:<h)5ut58|87v7)8|9rq$, +& ԙj"p.l"?]!H/W%$bR5jG6 sР1t hr-p$o7 14D;! 5(L%=HjFl:4T9j@ ksl)Pt/L9l' T#TTo{*D #00|?3xo'''2r78CT7V_&cdH v4k~0 8`70!@|x)0P;%.0|j& E;$ )4 Лj, P8: 2J |9$_ 3.Pn %z J8 (3 D:L 88 j % 4't B =;X j lj %\ |6x* 52 \ -K -&PY $lc 08n $#| l'd @.X  t k j $1 g' ,{&x f7H tH%p @. \j '0& "8 qM <3H\ l2+h  jr 3 D, '  <;4 п0 9( 0:, ,H $+ ( )< $- le2PB ̙/O -$c f)Dl ')w 64 |4  3 j / ( p%H ! |n$0 `j $' < " >. TJ%= qQ jX Co`e < /9 T8$ 09(,-!d \/`]!@Bܑ'P)@!y7`)y65%4AD> N9PXTH7$id/u'P$.T'X|=p=pL`9 E7x/8j\!#H]:6 8I|r1X%gp3w a6@;\a%4$)DkA.$%#4 8Ȗjp&HJ=6`.>*8E5$Y #d::p&0H}/Y'`;ܪ6\-Xl#N:q6o#4$7@[<@9 P*Z{*Ddx'r$!D@FoDj+`.:40{+Xt%5&,M $#0H#"3T%@oI`+<Yx9 kl*Hy#(6+`6Hotd<@6;|R5Tjq2pj$$j13@&$OE=^l"XvD!D94o '~*Tj(6/4j*4d&%Lj+DFod (H-&o3Mo=jC9L0(|\ {!ooy8p5$*Bj< j4ܼj@j% p?!ty2 Xx;h"T,4;oGoT ;,e7<s ;:$f9e>P7\=0:,pZ9p*08P&p !31@<hoIC(S|0\d),ktE%|<;4 d651(8\|4,d4(2\+`po"A8"D,6@5+|F 5P9\3Lg#x7=52D@(t$5(K pz8Dм-H5(#;h|K+)HU=EqqQ MoYD9hf2xG=PE82!DD  pE4poP8'8#Dj l-m% .18P"G9 PX3\T+hHkt 9~po k|"g?x29(@ X/|*<> @r2L/ 7|f))(08j>"Qd;^x0u)(]$H7c?<9/=/t(l0 - h-p&&-#634Eh%,Xv9a7j%,v: X8Q3L/`L-!42hD7),O7$9%x'3pb&D88H> X>8`@#v+L8H:,'@"<@ %<ĵ9t%;tę1@ C:0p-(C,=.9G>!tS `K2q58;;7`p-H%j8=|9|2(4/j", 0*&,j&$8;|O9[p/c% o+t|$d6/j>s!+!ld5;9d0)80^4 8y% L=;\& 55 'B MoL *l` X!p #z TG# 1 n&X q H# \i#` t% # 8 Xo !,!<,d/!;7p@!1S!)b!l}$u!<+H! "!)\!8> !d%,!T99`!|?6!/,!@ !#=p! k!O; "1"|*&"p$#L;"@;M"9(`a"lg/q" 'x"[*,"T%@"5"8+"j"p6"4t10" 1\"HJ*"xy'"y9l#Љ2#&#q3#13$<#\5D#jP#{'X_#8=r#4T2#N9#6#'#Dh? #0$#:-4#,)#5 $V/H$X.*$ܕ9 8$g7N$6<V$8|b$Y9(m$|<(l{$Gop$E9$00 $>$ p$h$$X"$4m9$h 2L$$h%l 8%,*%L(83%4}#H%81Y%m?h%;X{%d0% l*%T58%TP7%)%X"#%N7t%"%=%D+%$:0 &) &>.&DV F&,9X&l8k&<3 y&j&$8@&%\&&T&,J:&/T&X)D&'D&lj'ܚ/T 'G('H' #'C=:'3E'/ S'*xd'2Xz's7x''!x''2D'x''@m%4'S6,'0='$('Ы#H'X5 ( .T(%*($6|3(h6=(du1J( $lT(H1d(\*,r(p:T(<k(~7(&X(/=(P> (ԇ&D(H7(h/0("<)+D)\Uo')x!:)̲4A)4D=W)e24a)Hjj)l38z)ܮ%)%)L@*,)7)W*)D`&,)98)t,)+)$' *!"*63*j?*!T*`/"pf*=7tv*P2|*:* 5d*"L*47=*9* 9*șj*,~8* -+D=4+08`#+<(0+!@+d0;R+3r+%<+9+2+>+q+4o+f%+>60++D,7d,o3($,h%5,q<,28L,-W,`(he,q%tm,4+w,o,j3,m*,T9(,>,9=,"),g-2\S-u& X-0:,d-`b/y-|7=---x*l-.;(-,5-l=-3-*. 4.T2#.-0.},4D.`t:U.~6Hb.$o1dq.h? .$W0D.@&l.H,.4^*D.Hj.9.4=.64 . /9/0/)'(/i&,>/:R/ܒB\/qd/jq/"T/*"x/؃:l/90/J9T/0/H>/b7/rq///P9 0ԓ90h7$'0l2500M0lo\0*'8k0!t0j017D0<}*D0"04|00j0o07h0X1l0*1P%&1M21|<4:12PQ1Ts)x^1%8e1n$lq1a;1'L14#o11T1)1.<1,T81'\1k1H) 10g 1\>;2Ȓ=%2@)p02|07@2V'PP2K=Y2jc27|o2lj2'2_7l2(@#2%"d2:2a)2P8T2 ! 3L h3j?63jL3y0_3p5,p3D-{3%)03j3h7,3/%37 3Xj3xj3,%83($84`,h 4844H3K4x=.x\4jm4X"4j47h4(0 4$y64x34D84(4'4#t4dV!52t5`)`!5n%)5l#l55`;G5.[5T%m5"{5$258'58=5958|5.5*75p,6\S#L6p9 *6\956|j>6 A)H6;XV6k>@f6$v6@(6Թ26ha7t6k(64*x6 8X6j6O-6%7f!7j)7D:67,'@7LO |Q7z)]7:7o7Ԑ8x7Ă*7j7:D7,507;*78d7$l7Xv,X717.X8,5 8$:0!8$;308o78k@8 kG8$2d8L'0v8> 8(E+\8|s08k%08HD885\848838p9z%h95!9d'-9 k49%TC9> O99(Z9p3 h9'xt9`1L9<'9(E9x9 58$9Xq9+9dr69>9(189$7:8z:t:N.+:Lo2:%\G:(,N:v-$[:,<n:):TC":p:1):4B:I#:P;:50:`04:\/;:;H,#;q7;XA=K; 5 O;$$4d;#{;4P;'x;\o;:;;8`;0>(;0p;0$;/";E7 < 2!<a/\6<|8X@<'dQ<j\<(e<C28v<0p<8T<Y2<, <t)T<5 >L*,>j!>v3->&$4>U7<:>;TP>(6X>Pj q>3X>xqL>(>,&,l>`17`>d6>J!L>E=>Ԃ*D>@ 8T ?2? )\#?@B-?>$??9K?0Q? X]?#3i?`+<?%!?&$?t @ ?e>?v:?4U2p?+?t&d?> ?j?Xj@H9X@Tj!@28D@y04T@x-8f@.\w@" X@j@U8T@xBl$,BL",CB|7(NB."aBg(<kBE7BIoBXD=B8%B,;Bt.BX5BI-xB%\B E!C)Cx'0CX$-CjECLB=YC7TiC(|yCd1dC jC`-=CD6C!XC[/CHt%DCP- Chv: D+< D\q?D)ID .HQD`$<|ZD`67pDpD5\DH>4D&DT!DqDl-D3Dt2E)20EȒqELj:E +HE&`E$#nE,|~E||8dEj&ET5E6 EnE !0E8i-pE6Fn4 FF!Fx:d!F8t%)F"?F: MFR3`FXb>dlFI60uFpF|D%F6Ft6tF2LF+HFs6(F5,FD: GT8=G[o,GHU$H6G;@GjMGl8dhG(6HwG-GP&GN0/lLNq`NDohND"xNjN'N*!N,]"|N܍ N)N"N),NM4P82PP510P(*PPoPm+8 Q>(HQ6)(Q54Qt1=Q^$0WQh#HqQL%Q <Q:Q!,Qd&Qh5Q:&QIoQ QB;QP + Rr%0RI(!Rp{%-Ră10UjTU"U467(V6VI%V\)(0V<|(AVk NV *SV-4bV7mVozV #0V\#TV<Y$*# Y-<Yg+Yd#YP,Yl&6PYz6| ZdjZX'27ZjJZlm-iZb;zZ*ZX8DZPkZDM8ZhS/ZD.\Z'0Z5Z2lZ'l[h6\[̪7 %[p5D,[0;[L$0U[B\[ ;Xl[:y[8L[h+[(+[t69t[x6<[o[D>[,[Io[h  \T4\)#\'7\kA\t9TP\=%j\x4=\j\o\0$=0\3*\/4\-0\j\+D\7l ]Pj|']8j.]x"l@]h)|I]>Q]t8_]jp],",]1H]}(`]Xo]#0];]0']ts8]'] ^a6<^|$^=4^4XE^%D^^> j^8^P3,,^ 7x^,^L9X^o^P6^:^p_+ _4=_ >/_m)8_ ;J_8dW_)@k_L%_5p_z9_3_9)d_PZ&|_%H_)_8t_H>_<9X_ %_,o`j`j`D &`D~:7`J3E`$>P`DoW`[o^`=(g`9{`7<`ȫ2@`+`$`Lj`~+`Ț1`V1(`j8`pG%@a:&-aT4=ajIa(Ta*,haj>pa -<|at,0apa,a+Lals2aD#a]=a%b2@b!H2bܐ>9bjIbjRb_&_b`Bvb&b|n;0b(*\b'Lb*'b$X#b(O"b+bt% cfeH kHeL;<|bexH7yeH4eTje*e<e,+|e(T"eP&9he/4e h)<fF6 fk+fB 3fhW;Ef6VfH66ff2xvfP;6f-(f8/lf"f$@.f(f@%f3 f6fqfB=gX-0gDt:?g9dLgnUg h,ohXF,L1hj&0Bh$0ZhjghY4 th7=hT6h})<h,%ph;dhjhp7hTq*|h2hDMohq ij#i%5i`qFi|$4Ri(8]i0; ui&i,i&Li@ji<i'9i2ijip;|j:,j97,.j$xBjBJjrqUjL.(hj7wj j,9j4j%$jpj|+Pj(j̀%j` 0j@2kT6@ kBk kkp9\)k j(Fk0x,|\k؇>ek9<vkx6=k )8kpa*kp(kh#Dk k,9#kjkle+|k& ljl%3l`?#Hl03, alL(xil Hrltjxl؂%l=l9*lLB<8lw6\ll>$Ll5`lİjl&Hm`88mx'$3mȉ:?m8Im,0dm[)`nmԱjxm8mn*In4"p[n+,hn;Lzn9=ndBnj nĹo$n/|n6*Ln(pn2"npA=o&ot-"o_o/o0#CoW Pod;_odA9Pmo % o5 oԒ7o,(ojo|2oA9Po8orqo2<pg)pp$>$p`j2pPn&=p%0UpL7=gp%,tpH=pK'8pн'p4s%pHkph=pL9pp/pT"q(qG7(qd/)5qd%$Eq0"`Rq#'t^q.jq<&uq\7qn*qH|vq v$5Hvov)vE=v6_>v*<v7Dvqv2\wp wD5$wPh?<'wk0wk9w DLw%Zw==twPQ(t}w8twqw'wĹ%Pw/Xw'w:w%TwD!9w#x<)d"xKo+x/5x7HExhoQxX)0Zxx$gxW:drx>~xx$'Tx 3xH'7hxox7=x((4x-x̴j xG6x$4,xd'dy "\y 3y 7&y4+ 7y)By# YyjnyB*4yyG%yqy0jyrqyjyr?y:Tyx:Py+Py\;yLB=z7h#zd6l8zd5 ?z0<MzpoWz2 jz5(xzQ#z`)8z`]$0z(t6lzPjzjzjz-9 zP'(z9tzX*{lo{){@&T${t-"8{kA{PA=R{qb{5s{|j {|2 {#{q{\$${P9${ |{(<{/|> |5l(|!9|)V|\67j|=z|o|e+L|9|-8|n-|;%4|\# |L1}o}5"}q-;}l%(M}$s![}:@o}( 8D}T)}`'d}2l}+},d}2l}{$h}(;}ܭ+, ~7l~* ,~7:8~,J~  pZ~ju~/~%~!~:~7~h6@~ *~5L# k(\[*,5G:\J(PUX+_0m?`s0(|& ;Xd"M!]3(<n%Ly#̙j6(jǀoрP/߀D!D2XC$ 1/P *j&:Q7dd8dqDT-))$/ę/`W99Ń>ۃT6*!| $j jj' /867/G'xX9c@D.@t,/(;;/<(Ȅ:Dׄ>8|j|$:H7) 45j?jP82P\Ж>fjuЀ%,j$0[o$g?xȅ@=Ӆ40S"9<{5x!/B! ,2(/@PU=J9U:7dg0*<s06< %34$)Л"ƆpjΆ, |/K=p$Io 5`|9'8x3 !A(Q,jZt(Th`$hzx0lt-4% ;qH3tŇ/χ*d؇,0HB )=; 2x,:BS+(b:v-LjD(%L58+`S#Έ09ۈ&('hdjp P l!,|5 *<ĺ#dR: `6j4jx&\b*B%*4o7ɉP6`ىLoj& 2 0V1| 4H4x4CHI*NT: [tS2l,=$}9j>xj(`Ŋ *Պ ۊ,o18 T8 *!(4,L#7@i5EP#R>=aD)t/dUoX5>(($kȋ+ً*L' p-P "8tp"q5poF@'T(&_9jjt*t:|'(890 ƌ;ٌ% <8^',%t!@0d8F(-Q(TY %,k:$)|h4Tj$*7Ѝ6#$/Q<,x4>k)K j Uнjd%t,080HK6oB %@?6<7*A6Q$^X<9Tjqx4%l$w(D0 DX:,Ȭ3<͐o֐R*t(k*'0pd6H:T"1p5ԣ.`BM=\4!j ks65.\) 3l/t`*ΑM&0ޑn),́"P!:7(to$?U$I5,l]jk0%Xu86t,.dPM+0hjp' \;Œ4j(8@82< X/8o&&tj0!@BM)S"(e^0drp8<~r:h>[#((0;p4 kГ:(h_ \ P8$T3!=+x#D:`7$F*dOd'|\H9tg$a9vt8B3`j 7`7 ĔT0\Δ$r,4ܛ)5)lj4djT'$S*|&%|3,#> PT"h]L/4m2@ou$x+6(j•(t(ҕ9DߕM6@=$% @>8v:0#5:H409`K7`Y|L6b4kjLj8k>l9j%>Ֆ kޖ0)9q @_>Pj ٘x70 m#L  #`%(@'h> 494B5=R5(gp 5(nd"zq5<$'tB'4ƙz,*98(70 7?=Xo0 l= jFjV(_!s<=:8Tdqp-[o#h̚C,ޚ5g1L:& '.0.- IF7^G=n0[*,xHU ܚ*4˛h)ڛ&,7q( 6l1,*@+6`& ALQ7`K0T#j;&\~x*x|+P#?"Ü{7@Ϝp؜4 # 0di<1<X* +@/;8` Fw?(Vh+8LdHX*8m!{8p-dpk-x%Dj@x+,Ν]*$ڝ3,)p`'|\q<k(7(K&U%@c8$\o 1H:p&Xoh"b,XΞk(0מ`t+}%DP4h pD32644B:,PoY(X!fԋ s$B|Hk(2X2 F3,nQ(Pğ5ٟ0jT962'9$3o7+PHjT'd`S<ii:H{&)(#` " !,`,s+4ɠH*lנy#0jh2" 47T@8D$Q1*(3,7\A19Lx2T\Voh\'tl54{|k Ds80j&@$6ˡqڡp k`;42, /!p.hk82U%_j(vj$j@l{'\ j4oP*ȢB Ӣkۢ`$C$j$ʣ3ѣ@4=T. ^4T6=x:(}26g-hNxoYD$e,#ytB.\t.*4B8,Ȥ+&TB\> j$#,Q"\??8<JK;$\X92tmb9:,rqȻ% H4=,5t4٥Ј$ 7l|,  m([&&:4H-<F;+R*@]5oP/'L9$(?.j,ͦ813ۦ$j@c%1$,H#$14h k=#oR84;Lg-u-<.;0C-|*@ŧ0|*TϧT"qjk~8X& l$hD431@@jHDA#S$ P]z*Dg"{18-x@*39HL"ʨ&ը q,>j8)T @r=h&ȫ$$8ޫp68u:p14 $*T,o/h&8'|36@>5XT1=b(y%!0~,po7Ԭ|3h8-p k48=*j9D#M$jdLjr7%@h8<L 78\jƭ/ӭ4oܭȟjP8( $*H *!j4$M'C<Z:4ojO*p%71Lj| k|%%TЮB Hk 81t%k+o6<8oG>8U|jb h;8x0c)l#%7D5 {4O/x˯ܕ( ٯ؁op' .4#!D$.87`6X7@@P1N *|^ī7l68zԙ/too68i:X(J7Lðh2dӰ4+X߰ 8T 2$ )2,p5@+\B#o O:b<\-x4 ,,*jXr,G% *0JB UdD b .`r$@}8P:)0%@,he;4ȳ 9=ڳ4H5x,h*@'t8=:oD+SxD dT5Ps,,4j&X<:Dv7Dq̴p %`/ #0v?\!.x+hY.%5,F('8NД1jjvHN,<9H-/.Ԑ h̏4 ȵ9Lص@7ؙjq:$7\$5.D.;^9M5(4_<>$x-)Xj0 Tp:TjȶĴ3Lݶ@jp&4S5 '@n$+0d4ؔB(BlE2\Qnf@%n!{H00&t$\8$L#(I(ķܓ6pзWoܷ3"d 0+X5  $$¸@L5Tиh';;4%@@"Ll64( I=9@t8F+Pd+`~%Dsj*)b6\$+q͹`<,ݹ|u30Du&#l:,$P~9.hJ=J&X&0a1l{ܐ:-:`"+|*:Tp7պjݺ7`((p3Dd-$Mo ^=&8:F7O-l$: { /T":p->0oȻ#׻x98p'`0'!@,$'$<7h,5<B{0HT,4j jt8;\/,k' # "Լ%Hg)(|}%dL0DD> \<488d68E5O܉$@c!x 64H$hjjt%($ʽLY'`ؽt #)3h^&d~$>#c? 8/Wxjjt$xh9y((@`*4#ƾ5D׾c1\&# 8" %0/m? Fe)RT-Pc؟&tit)t )D:,7H$&g7*7ÿ@*ο, ׿4BhW8t/0h3 q(Xo$&@#460Ax)l\xBsj&9`9p87h)50~!tl`9 86=-l )9jE,Z9S24ap<m (xd/j3 5p2kdk"r?  o%)U;,|=2CH];Ttkswap_onwi_set_nwkeyucom_unlockpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickre_disable_hw_imuaddr_bestfit_functionslongjmpwi_usb_rx_list_initsr_crypto_discipline_initkdb_trapvfs_allocate_syncvnodetc_setclockuhci_pci_attacharpresolvechrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnrtlabel_unrefHMAC_SHA1_Updateuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donecopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidieee80211_tkip_micdofilewritevwi_inquire_usbuftdi_matchdumpmagieee80211_derive_ptkttyflushsys_setsockoptcomdefaultrateclock_gettimeieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswbwi_rate2modtypewi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksem_k1_gig_workaround_hvip6_get_prevhdrscheduler_startdb_logpciide_triones_productspmap_alias_bitsuvm_maxkaddrehci_pci_cansphy_cdumass_io_putral_pci_detachicsphy_resetieee80211_getmgmtrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachsys_closeusbd_do_request_flagsbwi_mac_attachrt2560_set_rxantennartflushclone1in6_purgemkludgeffs_inode_allocdes_encrypt2sys_setsidbwi_rf_calc_nrssi_slope_11gieee80211_encapusbd_intr_transfer__ashldi3artisea_chip_mapvn_statunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchtcp_secretrti_find__mainbwi_rf_lo_writeaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrieee80211_eapol_timeoutsr_rebuild_threadrt2560_wakeup_expirewi_read_data_iomyip_ifpwdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachieee80211_get_authvtagssiop_pci_attachmtx_enter_trywskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventpcaled_caieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatohci_device_intr_closebrgphy_disable_early_dacurl_csr_read_2dest6_inputgsignalacphy_cart2560_suspendehci_pci_matchipport_firstautoehci_strbwi_mac_set_tpctl_11bgmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartscsi_xs_sync_donefc_lfcemptyvfs_export_lookuprt2860_set_ledsif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopsuaddr_free_rbtree_RB_NEXTfilt_seltruesc_print_addrlogcomspeedvn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIuvm_pmr_freepageqpdevnames_sizemichael_updateumsm_umass_changemodescsi_mode_select_bigroute_dstsingle_thread_clearinit_execuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdnamecache_rb_cache_RB_FINDsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszuhci_device_ctrl_doneblf_zerokeydb_force_whitespaceSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodesbwi_memobj_write_2setjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_inforicohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsre_ifmedia_stsvndxfer_pooltcp6_mtudisc_callbackcopyoutstratu_capte_l2_s_prot_uieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepciide_unmapregs_compatuaddr_stack_brk_selectswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeropdc20262_dma_startural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbwi_rf_init_hw_nrssi_tablebdevswumodem_matchbaddynamicportsworkq_initohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpduvm_pmr_addr_RB_REMOVElockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupre_ifmedia_updinflateCopyttyunblocksr_meta_opt_loadbioclosehidms_disableremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocallowpowerdownsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnameshidkbd_bell_fndisk_busydb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsqphy_statussddetacharprequesttfork_child_returnsiginituipaq_cdpci_mapreg_mapuhci_device_isoc_abortpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdums_casetdisklabelbio_registerdeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocsr_hotspare_rebuilduvm_mapent_addr_insertroutedomainhid_locateicmp6_errorVOP_MKDIRpool_large_freeip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVdb_map_print_cmdumass_init_shuttlesoqremquepci_class__adddi3uvm_map_inheritsys_getthridcd9660_syncem_enable_hw_vlansin6_ifawithscopebuf_page_offsetumodem_set_line_stateuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingsync_printvnopsieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readdb_read_tokenem_attach_miibusieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusuvm_map_setup_mdre_encapprintfehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandombwi_txeof_statussysctl_doprockcopysiop_modechangeext2fs_initrtfreesingle_thread_checkre_pci_detachcuio_getptrcd9660_linkhostnamelenupl_cdusb_needs_reattachdeflateTuneuaddr_hint_selectsched_cost_runnableem_flowstatusxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlockbwi_rxeof32nd6_ioctlsched_chooseprocphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachsys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrkqueue_registerpciaddr_resource_managecred0in_delmultibuf_nkvmsleeprt3090_rf_setupuvm_forkdisk_lookupuhci_device_intr_abortuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromumodem_closeehci_devdttydefcharssigexitscsi_link_openhidirtypagesrt2560_reset_tx_ringin6mask128rt3090_rf_wakeupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_meta_readbrgphy_loopdb_shift_exprbs_notimpl_bs_c_8physical_startifa_delpcred_poolenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputdes3_zerokeyre_miibus_statchgobio_matchacphy_cdcrypto_getfeatsched_cost_loadbwi_memobj_write_4bwi_phy_config_agcwsmux_attach_scusbd_pipe2device_handlecpu_do_powersavebwi_free_rx_ring32aue_rx_list_initi80321_bs_vaddruvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolpgrphashsys_setpgidpciide_jmb_caprofhzAES_GMAC_Updatesr_meta_init_completentp_update_secondcache_enterdb_watch_tablei80321intc_attachedsysctl_file2exec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listdb_trapip6_maxifprefixesieee80211_node_cache_timeoutthecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readcrypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestsrt3090_filter_calibwi_watchdogatu_start_scanipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnural_readscsi_xs_get_doneatu_external_firmwareipsec_exp_timeoutip_directedbcastbwi_free_rx_ring64i80321_pci_decompose_tag_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssiumct_activateticks_per_secondsd_buf_doneieee80211_get_rtsamap_initffs_flushfilesubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6stathotplugread_filtopsuplcom_set_line_statehidms_enableuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepi80321_i2c_matchbwi_mac_dummy_xmitether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1rn_searchugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consoleurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptbinuptimesys_seteuidhidms_attachwskbdpolluvm_map_checkprotmax_protohdratu_tx_list_initcdce_activatedes_is_weak_keyohci_pci_matchural_rf_writedb_access_irq_spieee80211_add_qos_capabilityieee80211_cipher_keylenumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesuipaq_attachusbrev_strpciaddr_resource_allocateiic_execsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_useuhci_device_bulk_methodsrt2560_attachwd_standbymi_switchcd9660_statfssysctl_sensorstsleepkern_sysctlbwi_dma_mbuf_creatend6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveigmp_fasttimobufq_disksort_queueatomic_setbits_intehci_device_ctrl_startuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortsvwsata_dmacmd_readrt2560_updateslotpiix_setup_idetim_timingsrt_mpath_matchgateubsa_stopbitscdce_startrt2661_reset_rx_ringusbd_port_disown_to_1_1uvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabelvm_map_unbusy_lndb_print_cmdusbd_clear_endpoint_stall_asyncehci_pci_shutdownvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstatdma_constraintdb_break_tableuvm_anon_pooli80321_softcicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistsata_chip_mapudav_newbufsys_umaskuhci_pci_attach_deferredpci_subclass_i2o_tr_flush_blockpow2dividesyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodecpuset_addbs_notimpl_bs_r_8pmap_alloc_specialstcp_setpersistrt2860_drain_stats_fifoufs_ihashlookupubsa_intrscsi_inquire_vpdmemmovesii3114_mapchanicmp_rediracceptugen_set_interfaceusbd_get_hub_statusworkq_create_threaddb_boot_halt_cmdural_attachip_outputbwi_init_rx_ring64bwi_bbp_attachbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencebwi_pci_detachuvm_pmr_addr_RB_PREVbpfreadbio_errorpool_putm_copym2buf_alloc_pagessysctl_structbufqs_stopohci_hash_rem_tduhci_poll_hubaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimesr_wu_putehci_freexcryptoclosesysctl_disklockcnkqfilterrt2860_alloc_tx_pooldesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinksr_concat_alloc_resourcespmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statusbwi_rf_init_sw_nrssi_tablenchinitexec_mapdb_qualifysnprintfcomcngetciicbus_printext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicebwi_free_txstats32ip6_forwardingsr_shutdownural_cdkue_resetarp_allocated_bus_dmamap_load_mbufbwi_plcp_headerwdc_print_capswi_watchdog_usbifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyalluvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferbuf_kva_endsr_raid1_intruvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzdcphy_mii_phy_autodefrouter_resetcd9660_ihashinsbwi_dma_allocrt2860_newassocrt2560_bbp_initsiop_script_writesched_exitcheckaliascue_activatettyretypestartuphook_listrt2860_detachre_tx_list_initpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachrn_mpath_countbwi_set_addr_filterwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutzlibVersionsr_raidp_assemblesdclosevop_generic_kqfilterpffasttimoinitsiginfosys_getuiddb_set_cmdcomconsunitcpuidsexec_setup_stackobio_bs_vaddruao_createdb_free_watchpointssensor_detachbwi_led_blink_endifaddr_items_RB_INSERT_COLORbuf_mapbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctsrt2860_initwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolcd9660_bufatoffugenintrgroupmemberuvmspace_initrt2661_ioctlscsi_plug_detachether_sprintfatu_calculate_paddingfintek_refreshmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptionsuvscom_reset__qdivrempmap_deadproc_cache_stateifaddr_items_RB_PREVpiix_setup_sidetim_timingsumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapswcr_sessionsfilt_bpfreaddb_watchpoint_freesr_disk_attachehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackcrypto_initem_k1_workaround_lvpci_resumevm_nphyssegifaddr_items_RB_NFINDip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkehci_freempmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamebwi_regwin_is_enableddvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctlrt3090_set_rx_antennauvm_pmr_addr_RB_MINMAXdb_history_prevem_read_pcie_cap_regbwi_rf_clear_stateem_setup_receive_structuresmyip_initializedsys_mkdiruao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbbwi_rf_set_nrssi_ofs_11grttrashohci_root_ctrl_abortmblowatgetnewvnodeufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessiop_intrsys_socketuhci_detachuhci_abort_xferbwi_mac_fw_loadugenopenohci_shutdowni80321intc_imaskffs_cgreadwi_init_usbugenioctlvm_map_lock_try_lnspec_close_clonevop_generic_bwritenanotimere_cdufsspec_writelxtphy_casd_read_cap_10iso_disklabelspooffdfreeuvn_detachieee80211_ccmp_set_keyfintek_capci_set_powerstateuvm_km_valloc_trytty_counthidkbd_detachbwi_phy_init_11gdeflate_globaluftdi_detachraw_disconnectipsec_ipcomp_default_levelsensor_task_registersis_south_matchusb_end_tasksip6_neighborgcthreshbufkvmKERNEL_BASE_virtremove_coproc_handleratomic_clearbits_intumass_polled_transferucom_to_tiocmdeflateSetHeaderuvm_pmr_extract_rangebrelvpsensor_attachre_intrmsdosfs_mountfsvfs_relookupem_oem_bits_config_pchlanpcibr_flagsuvm_map_addr_augment_getem_82547_update_fifo_headncpusfoundehci_root_intr_startwi_stopip6_sprintfsync_fsyncumsm_activatesetstatclockratecd9660_strategyohci_allocmem_iffuserconf_parseural_tx_bcntiocm_to_ucomip6_keepfaithext2fs_allocpmap_cachevivtusercryptowskbd_deliver_eventdb_eregscom_fifo_probeieee80211_delba_requestbread_cluster_callbackfdcopy_bwi_txeofatu_send_mibemul_findAES_GMAC_Finalb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapobio_bs_allocusb_blk_freelistudp_sendspaceuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updateehci_device_isoc_transfercue_tx_list_initbs_notimpl_bs_sr_2netintrcd9660_openrw_initi80321_bs_mmapAES_GMAC_Reinitixp_setup_channelsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FINDcmaskbrgphy_cd_bss_end__ext2fs_blkprefdb_pool_print_cmdbwi_encapwi_alloc_nicmem_ioicsphyattachdb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referenceusbd_kill_pipeuhci_freemin6_addrscopebuf_getsys___threxitdb_searchieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_nodeieee80211_node_leave_11graw_usrreqnblkdevuhci_find_prev_qhpciide_detachinitidbs_notimpl_bs_wm_2uhidev_detachsr_crypto_hotplugttyinputscanc__stack_smash_handlerbwi_pci_conf_writeumsm_matchukbd_consopsbiodoneural_activatedb_set_breakpointicmp6_rip6_inputehci_free_sqtdwi_usb_txfrmmaxslpext2fs_makeinodeehci_device_intr_methodscue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrbwi_bitswap4sr_crypto_assembleufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassoc_length_codenamecache_rb_cache_RB_PREVin_iawithaddrbwi_mac_fw_free__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_tasktimeout_add_tsbwi_phy_attachrip6_ctlinputubsa_activatescsi_link_shutdowncdce_caSHA384Initumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysuaddr_free_rbtree_RB_INSERT_COLORtcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocuvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusucom_status_changern_matchcd9660_symlinkautoconf_verbosebwi_memobj_read_4in6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoftraid_disk_attachsoreceivesiop_iwrpool_getuextralocscsibus_printlinkdb_show_radix_nodeudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_defersys_faccessatgf_mulbwi_mac_setup_tpctlem_check_for_link_bus_dmamem_allocm_tag_initbsearchif_attachsr_crypto_free_resourcespciaddr_ioaddrsys_setrtablem_reclaimsr_raid_read_capuvm_map_addr_RB_REMOVE_COLORnameibwi_disable_intrsem_read_pci_cfgbs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_polltqphy_funcswihap_initversionbwi_mac_opmode_init_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerrieee80211_bip_set_keybwi_mac_set_retry_limuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getciic_probe_sensorre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufcomsoftwihap_mgmt_inputpdc203xx_read_regudav_initVOP_REVOKEconfig_deactivatebwi_txeof_status64SHA256Finalclallocipsec_esp_trans_default_levelbiowaitbwi_led_blink_nextpdc268_config_readpci_subclass_inputprobe_addrs_sensorfilt_ufsreadrt2560_rx_intrunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccstqphy_caehci_check_intrral_pci_activateccpupmap_updateehci_device_setintrobio_cdgeneric_bs_sr_1em_setup_linkpci_vpd_readre_pci_activateacard_chip_maphidkbd_inputsr_raidp_recreate_wunexttickeventfdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksbwi_get_rf_loupl_stoprt2860_intr_coherentttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrt2860_bbp_initrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdcd9660_specvopsusb_cdrnd_event_headin6_maxmtupmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckbwi_phy_init_11b_rev6wi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcryptoopencomcnattachuserasymcryptodb_var_rw_intrt2560_set_bssidusbd_devinfo_freesdsizesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findbwi_rf_off_11g_rev5uplcom_breakusbd_iface_claimedtcp_closeicmpsrcohci_free_stdsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockswcr_idwdog_registerkue_attachif_indexlimpdcsata_chip_mapusbd_free_xferdb_varssys_utimensatfalloclxtphy_cdatu_joindeadproc_mutexdb_breakpoint_freeumsm_methodspfctlinputcomcnprobephys_mapumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statusuvm_swap_iouserconf_initbwi_phy_init_11art2560_ioctlkillpg1url_tx_list_inituhci_strwsmouse_mux_openi80321intc_attachvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsieee80211_findrateregyearem_update_stats_countersurl_ioctlpage0setrunnablepool_do_putuvm_pmr_getpageswi_set_ssidcue_ioctlnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopsumct_intrcue_attachelf32_read_fromosversionticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_initfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitrt2860_tbtt_intrudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollem_link_stall_workaround_hvrt2860_suspendmsdosfs_check_exportbwi_fwimage_is_validieee80211_up_to_aclf_setlocknbigpipecue_devsin_controlieee80211_get_addba_respbwi_regwin_inforlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapieee80211_tree_RB_FINDohci_freemi80321_bs_tag_templateucomioctlm_cldropmbstatuhci_remove_ls_ctrldcphy_statusuhidev_intrttyinfodb_flush_lexttyinohci_root_ctrl_donegetnulldevdb_dmesg_cmdpciide_dma_initsr_meta_save_callbackextent_destroydb_lpenc_xform_rijndael128if_group_egress_buildloop_clonerttsetwatergetcieee80211_addba_requestrt2860_gp_intrsr_raid6_intrifaddr_items_RB_INSERTdb_last_addrural_update_slotuvm_pseg_lcksr_ioctl_volem_clear_hw_cntrscom_obio_matchpmap_enter_pvmsgbufenableduvm_mapent_mkfreeunp_disconnectsys_listensys_mounthotplug_put_eventehci_root_ctrl_donepgsignalehci_waitintrbpf_mtap_etherfirstcdb_read_bytesuhub_detachrt2560_media_changeieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openfintek_attachinetdomainehci_abort_xfermemcpywdc_enable_intrkthread_exitaxe_activatescsi_req_detachbwi_nrssi_writecue_newbufdisk_constructvfs_unbusyip_nhopsrip_usrrequhci_setup_isocvm_map_upgrade_lnspec_writesiop_wdtr_msgpciide_unmapregs_nativecom_obio_cdipsec_esp_network_default_levelkq_timeoutmaxin_broadcastfd_getfilesr_sensors_deletehidkbd_set_ledsmsgbufaddrucomclosesdioctlutsnameip6_setmoptionsexit2aue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlrt2860_ampdu_rx_startsiop_scsifreeieee80211_send_4way_msg2tcp_update_rcvspacerddumpem_enable_intrcpu_setperfuaddr_rnd_poolufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregip6_randomflowlabelttpolldegetlogpollkthread_createbwi_mac_set_promiscugen_set_configdb_elf_sym_initwdc_default_read_raw_multi_2current_ipl_levellogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4install_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_disksr_put_blockohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assembleumct_opensd_ioctl_cachepci_subclass_networkext2fs_checkpathns_scx200_chip_mapsocantrcvmorepci_vpd_writeuipaq_rtsprocess_poolrt2560_update_ledip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesysctl_proc_argssiop_adapterdes1_zerokeypipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadipq_pooluaddr_kbootstrap_destroypmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcuaddr_stack_brk_functionsunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readswap_syscall_lockufs_kqfilterieee80211_newstateem_is_valid_ether_addrums_enablescsi_autoconfcheckdirsexecswsr_raid0_creatert2560_set_txantennaumass_atapi_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountpciide_dma_startehci_device_bulk_abortswcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachsiop_pci_cart_timer_initnd6_useloopbacksr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxsr_raid6_free_resourcestcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTsched_choosecpu_forki80321_pci_initsrv_ipohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabeldb_call_depthuaddr_pivot_randomdb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_freend6_optionscd9660_seekbwi_free_tx_ring64nd6_llinfo_settimersr_roam_chunksmsdosfs_unmountelf32_load_psectiondb_show_all_bufsuftdi_writern_mpath_nextnamecache_rb_cache_RB_MINMAXuhci_device_bulk_transferarm_pcache_unifieddb_add_symbol_tableuhci_remove_intruplcom_setm_tag_nextohci_intr1msdosfs_writebs_notimpl_bs_w_1cue_resetexec_script_makecmdsehci_rem_free_itd_chainiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrdb_unaryrgephy_statusiophyattachdisk_attach_callbackselrecordffs_validatert2860_intrcomstopatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputext2fs_accessbwi_ofdm_plcp_headerrt2560_read_eeprommld6_fasttimeouaddr_rnd_insertkthread_qimaxwsmouse_matchohci_free_seduserconf_pdevuvm_object_printitsr_detachinflate_fastiq80321_devmapmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockffs2_reallocblkswdc_get_xferuvm_vmspace_poolbwi_setup_rx_desc32stackgap_initpipe_createsysctl_vnodepdc202xx_setup_channeliodatand6_sysctlsyn_cache_putdoopenatpciide_amd_productspci_subclass_multimediavn_opensr_raid0_alloc_resourcesuhci_freexif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192apollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeuesr_discipline_inituhci_root_ctrl_startuhci_pci_activatewi_cmd_usb__udivsi3re_ifftcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKubsa_devsicmp_inputumass_cdvcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputwdog_ctl_cbbwi_nrssi_readsched_idlebio_warnuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginifaddr_items_RB_NEXTbuckstring_inituhci_free_std_chainiq80321_pci_init2icmp6_rediracceptbwi_set_gainsdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4bwi_stopbrgphy_5704_a0_bugarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsynctcp_mss_updateiopiic_cdphison_setup_channelpciide_lookup_productfree_pagesehci_root_ctrl_startdb_proc_print_cmdrt2560_initrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferuvm_map_pageable_wireroute_outputrti_deletesys_geteuiddb_output_positionem_clear_vfta_i350icmpmaskreplin6_pcblookup_listenmsdosfs_mknodip6_defmcasthlimsys_munmapsii3114_dmactl_writekp_nonefilt_solistenvsnprintfrt2860_node_leavearplookupuvm_map_pageableproftimer_trampolinechainallocuplcom_methodssw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tableip_mloopbackbwi_rf_get_tp_ctrl2bpf_iflistKQREFwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbuftodr_handlend6_rs_inputscsi_activate_buspciide_mapreg_dmasoabortm_free_unlockedem_82547_move_tail_lockedem_get_bufcast_encryptunp_inobwi_default_led_acthidkbd_attach_wskbdlogkqfilterbpf_mtap_pflogni6_dnsmatchdb_extent_print_cmdip6_init2uprintfdb_clear_single_stepsensordev_installrandomiduvm_page_printitmainbus_cai80321_local_dma_initcoredump_elf32rt2560_intrsoftdep_flushworklistsys_issetugidinitclocksbwi_rf_attachcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startpool_serialxscale_cache_flushD_SEuplcom_activatescsi_probe_lunirq_entryaue_ioctlni6_inputvfs_mountedondb_expressionboard_powerdowncputypert_lookupfc_lookup__bss_start__if_downndqbVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratebwi_get_pwron_delaysiop_add_reselswwihap_deauth_requsbd_fill_di_taskieee80211_node2reqwi_usb_matchelf32_check_headerrt2661_bbp_initdb_historygf_logeephy_cdinphy_cdttytstamprt2860_mcu_bbp_readural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillHMAC_SHA256_Inithw_serialehci_device_intr_abortauth_hash_hmac_md5_96autoconf_attdetufs_chmodsr_raidp_discipline_initcdattachuserconf_devicesr_raidp_alloc_resourcesbwi_rf_off_11ain_localaddrsys_sigaltstacki80321_i2c_casii3114_dmatbl_writeDES_versionbrgphy_resetsoisdisconnectingauth_hash_key_sha1Blowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_capcidetachucom_dtrrtredirectuvm_map_printitdb_read_variablesoftintr_initieee80211_setkeysdonedb_regsdb_stack_dumpsr_raidp_rwuvm_pmr_pnaddrttymodemdb_lbuf_endehci_free_itdmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionallcftablesem_lookup_gcubwi_rf_tssi2dbmuhub_activateAES_GMAC_Setkeysleep_queue_initpmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedtcr1_get_timecountugenwritesys_setresgidsr_crypto_encryptuvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctluvm_km_freesys_killrn_mpath_repriouserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirem_watchdoguvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepuvm_objtree_RB_FINDsw_reg_iodone_internalhidms_detachem_check_mng_modeserverworks_setup_channelumass_init_insystemfrag6_deletefraghdruaddr_destroyem_validate_eeprom_checksumdirchkifaddr_items_RB_FINDexphy_resetipip_outputpipecloseVOP_REMOVEpci_mapreg_typewi_usb_activateconsinituvm_pmr_isfreeurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printhidms_ioctlsc_pld_shminidatacleanrt_timer_queue_destroysr_meta_probewi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatem_read_eepromenc_xform_3desrgephyattachuserconf_enableext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetffs_alloccgbuf_object_storecryptodevallowsoftobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitsr_concat_discipline_initE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodescsi_xsh_delscsi_plug_probesys_unmountsr_meta_native_probeuvscom_dtruipaq_detachbootdvelf32_probesumct_detachin6ifa_ifpwithaddrvgonelpciide_jmicron_productssofreebwi_amrr_timeoutbwi_rf_lo_findnd6_dad_timerbwi_led_newstateuaddr_rnd_destroyinphyattachcpuset_unionbwi_init_tx_ring32uvscom_shutdowndb_del_symbol_tabledb_add_exprsiop_timeouteephy_matchpmap_removebpf_mtap_afrt2860_set_basicrateshidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroyehci_close_pipebwi_regwin_enablewdccommandmyipbpf_setfuserconf_historypciide_pci_cauvm_page_unbusyfilt_hotplugreadbwi_rf_lo_isusedtk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enableuvm_map_addr_RB_PREVdb_symformat_elfpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_deftstamphotplugkqfilteri80321intc_smaskzlibCompileFlagsip_randomidbrgphy_eth_wirespeedaue_tx_list_initnettxintrieee80211_recv_disassocnosuidcoredumpukphyattachsr_startwu_callbackcddumpdb_search_cmdastusbd_claim_ifacetcp_disconnectuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnamedb_print_llinfodisk_closepartcmd680_setup_channelpci_enumerate_busbrgphy_fiber_funcsem_set_eee_i350em_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfbufq_doneehci_detachsensordev_getufs_diremptyreinsertfinishduprt2661_newassocsleep_setup_timeoutbrgphy_crc_bugukphy_serviceqsphy_resetdeflate_decompresspool_destroylogwakeupshutdownhook_listhidkbd_attachip_dosourcerouteieee80211_node_join_rsnsoread_filtopsgcu_miibus_readregieee80211_media2ratedmapoolsbdevsw_lookupdisk_changebwi_mac_resetuplcom_matchamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinituvm_mapent_isjoinableem_get_speed_and_duplexVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrvirttimer_trampolineip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadsr_checksumem_rxeofuhci_root_intr_methodsscsi_probe_buslminm_leadingspacesys_fpathconfwsmuxpollarpt_pruneohci_device_bulk_methodsem_copper_link_postconfigkp_zerosoconnect2knote_poolcnopensiop_scsiprobenatsemi_setup_channelscsi_test_unit_readyural_set_bssidricohrtc_reg_writenmbclustural_get_rfsominconndma_freert2661_mcu_wakeupuhci_device_clear_togglesoftraid_cduvm_vnp_syncpool_allocator_large_niieee80211_get_disassociopxs_cdwihap_assoc_reqarpt_downsr_concat_intrrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsdb_lookupuvm_pmr_addr_RB_NEXTrt2860_tx_intrnumnegpciactivatemii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removemax_datalenmsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockbwi_rf_set_ant_modegeneric_armv4_bs_wr_2uvmpd_scan_inactivedb_lastsymsiop_resetbusurl_memip_srcrouteuhidioctlip6_accept_rtadvieee80211_recv_4way_msg4sr_raid6_alloc_resourcespte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startbwi_rf_map_txpowerubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishentropylockumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthdb_putncharstuagg_unlockedsii3114_dmactl_readscsi_sem_enternd6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssifa_addcache_purgeudav_stop_taskbpf_mcopycomconsrateauth_hash_hmac_sha1_96uaddr_pivot_insertfork1curpcbdb_activevfs_hang_addrlistpci_primary_vgacue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesrt2860_media_changeext2fs_blkfreeudp_outputfind_last_setsoftraid0rt2661_set_chansys_chmoducomreadprelist_removeuvm_objtree_RB_NFINDffs_vgetrt2661_tx_intraxe_encapinitprocip6_getpmtubcstats__umoddi3brgphy_fiber_statusarm_dcache_alignvm_map_downgrade_lnugenclosert2661_media_changeip6_log_intervalnull_encryptsched_idle_cpuswihap_auth_reqscsi_activate_lunuvm_page_physdumpuvm_atopgX_db_sym_initmaxprocesssyn_cache_timerieee80211_auth_opensolisten_filtopsatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachrt2560_tx_intrehci_alloc_itdrt_msg2suser_ucredsd_shutdownmem_noext2fs_buf_allochicleanpagesbufbackpagesral_pci_matchatu_xfer_list_freeuhci_free_stdwihap_sta_deletepciaddr_resource_reserveuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestmsdosfsreadwrite_filtopskernel_mapuhci_device_isoc_enterwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incrieee80211_mgt_subtype_namegf_powbwi_led_eventugen_do_readdb_not_taken_bkptm_printpciide_unmapreg_dmauvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecwi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsatu_tx_startuvm_objwirert2560_encryption_introhci_device_bulk_start__guardtcp_mss_advSHA512Update_intin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDbwi_mac_hostflags_initaes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolcmd_pci_intrpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencbadaddr_read_4bzeroumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcuvm_pmr_size_RB_REMOVEdb_show_all_cmdsehci_shutdownpci_subclass_daspscsi_devidin6_addmultirn_newpairbios__udivdi3sys_obreakblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addpciide_cdlastddateucom_do_ioctluvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internalrt2560_decryption_intrdb_page_print_cmdwi_intrrw_casvgetrd_attachkd_nowaitugenpollieee80211_create_ibssbrgphy_jumbo_settingswsmouseopenwinChksumbufq_requeueserverworks_chip_mapfreeclusterchainmld6_initswapmapscsi_get_linkdisk_initSHA256Updateohci_bus_methodsohci_hash_rem_itdatu_cdrip6_ctloutputdisk_readlabelpciide_pci_writeaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createieee80211_gtk_rekey_timeoutem_local_timerusbd_bulk_transfer_cbexec_aout_prep_oldomagicwi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachucomopensysctl_dopooluhub_matchpmtu_expireuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvprt2560_bbp_writeuhci_intrbwi_mac_balance_atten_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackpciide_dma_table_setupbpf_reset_dem_hv_phy_workarounds_ich8lannd6_dad_stopdiskmapioctlhid_start_parseuseloopbackinflateSyncPointuvm_waitnexecsbwi_init_rxdesc_ring32mclpoolsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdogloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt2560_free_tx_ringumct_initusb_abort_tasksbs_notimpl_bs_wr_2pmap_bootstrapblf_cbc_encryptipsec_auth_default_levelsys_mqueryarm_picache_line_sizekmeminit_nkmempagesbwi_rxeofusbd_new_deviceuvm_pmr_size_RB_REMOVE_COLORmcllivelocksscsi_io_putscsi_iopool_inituvm_pmemrange_findfillinusemaprecvitbmtphy_funcsums_cdfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpuaddr_free_rbtree_RB_MINMAXfragtbl124userconf_totdevi80321_bs_tagrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgrandomread_filtopsieee80211_plcp2rateumsm_setobio_bs_maprealitexpireipstatunix2dostimesr_raid6_recreate_wurt2860_delete_keydounlinkatscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_msffs_dinode2_poolcrfreecnputcuhid_do_writepte_l2_s_prot_wip6_lasthdrohci_device_isoc_abortuhub_uhub_capci_count_vgaugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimeuvm_pmr_addr_cmprt2560_tx_datapipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getpciide_serverworks_productsext2fs_reloadrt3090_rf_initurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetphysmemuvn_flushurl_cduvmfault_relockinferiorbwi_rf_calc_rssi_bcm2050xscale_cache_purgeD_Eukbd_attachclusteralloccryptof_readsr_raid_syncuplcom_capci_dopmrt_if_remove_rtdeletewskbd_attachin_pcbbindxscale_cache_flushIumass_cbi_statemtdphy_caudp_notifyuhci_timeout_taskuhci_root_ctrl_closeendtsleeprt2661_resumewihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilldb_set_watchpointuvm_map_addr_RB_NEXTbpfattachuftdi_openif_detach_queuesitimerdecrieee80211_get_delbaether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeuvm_addr_printauth_hash_md5crypto_kdoneinflateGetHeaderbpfilter_lookupm_copym0bwi_led_onoffaxe_miibus_readregvm_physmemiso_shipdirrdwritebwi_txeof_status32ieee80211_node_join_htrnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootbpf_allocbufsbwi_init_txstats32set_stackptrrt_gettablemsgbufmappedohci_device_setintrrt3090_set_chancomprobe1cdsizedb_symbol_valuesuhci_device_ctrl_startumass_lookupdb_evarsupl_activateiic_smbus_write_bytebwi_rf_get_latest_tssiwsmouse_mux_closewakeupgetnanotimeatu_devspciide_matchrt2860_rf_writei80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrbwi_bus_attachrtlabel_name2idbwi_node_allochidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfrt2860_free_tx_ringVOP_OPENcompwroffbuckstringuhci_device_bulk_startrt2860_enable_tsf_syncsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedbrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathpcbmapatu_newstate_tr_stored_blocknd6_option_initbufq_quiescebrgphy_servicepiix_setup_channelext2fs_setsizeffs2_ballocin6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgidrt2860_set_keyuserconf_common_attrfilt_ufswritert6_flushehci_timeout_taskgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffieee80211_add_ds_paramsem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespdohooksgf_invem_pci_set_mwiieee80211_rssadapt_choosenprocessesehci_free_sqtd_chainem_disable_intrukbd_activatesiop_sdpaue_setmultiif_detached_ioctllocnamppsegswi_usb_casch_chip_mapuserconf_showbwi_next_scanip_mtudisc_timeout_qsr_scsi_cmdaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridbwi_mac_updateslotpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulseltrue_filtopssys_sigprocmaskdb_commandrt2661_select_bandin6_if_upfilt_pipereadenc_xform_aes_gmacsoreservepidtakendb_formatrt2560_reset_rx_ringuvm_mmapusb_activatescsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyifaddr_items_RB_REMOVEbrgphy_5708s_funcsusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetpci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinodb_strlcpycfrootswsmousepollchrtoblkscsiprintsiop_get_lunswuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatrtalloc_noclonetimeout_mutexether_addmultiieee80211_recv_actioncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsums_activateinflateInit_SHA384Update_intdb_breakpoint_cmdvwaitforiomii_phy_tickcd_read_subchannelextendfilelortrequesticmp6_inputbuf_valistuserconf_addohci_device_intr_methodswi_func_iocreatedefilt_randomreaduvscom_closebwi_regwin_nameieee80211_michael_mic_failuresbreleasedb_history_sizein6_selectifmsdosfs_islockedmax_linkhdrem_dma_freeumass_attachcryptof_statudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimbwi_set_chanbwi_rf_calc_rssi_bcm2060wdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkati80321_intr_disestablishuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2namesbdroprecorduvisor_activateuvm_coredumpem_write_phy_regi80321_handlerwdsizenamecache_rb_cache_RB_REMOVEacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreefilt_randomwritesr_warnrt2560_beacon_expireieee80211_alloc_node_helperrootdevehci_device_isoc_startm_tag_firstem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogsys_nnpfspioctlusbd_ar_pipecy693_setup_channelrip6_sysctlext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writere_pci_probeusbd_reset_portrt2661_set_macaddrifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatetcp_timer_2mslaue_openpipesi80321_gpio_initffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointsr_ioctl_installbootif_addgroupciphy_cdieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppumodem_parambwi_pci_resumeem_rxfillffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTugen_do_writeieee80211_eapol_key_decryptsr_raid1_free_resourcesuserconf_maxlocnamespool_reclaiminitdisklabelpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_openieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitruaddsys___set_tcbrdstrategym_copymsystemsbcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32piixsata_chip_mapumsm_catimeout_add_nsecehci_intr1rt2860_enable_mrruvmfault_lookupm_extfreergephy_resetupl_intrucomprintural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createm_cluncountwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopno_constraintsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsscsi_sem_leaveinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletert2560_next_scanuvm_pageidlezerobwi_enable_intrswskbd_do_ioctl_scdead_vopsdb_symtabsi80321_irq_handlerieee80211_media_changeucom_detachuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdastpendingifnewlladdruhci_noopphison_chip_mapether_ip6multicast_maxpipe_pooluao_initifa_ifwithroutem_clinitifpspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyem_smartspeeddb_print_positionrtflushclonedb_radixgetblksr_raid_turem_tbi_adjust_statsxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectrt2860_txural_initvtypesuvm_map_fix_spacedata_abort_handler_address__lshrdi3rtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimuhci_openbwi_pci_activateem_realignifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidscsi_io_getsr_infokue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimrt2860_stopkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closeeephy_activatecd9660_inactivesoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsyncre_setup_sim_imcfdatadeflateInit_ffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdiskmapreaddb_elf_lookupm_tag_findinittodradler32blf_encvputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqcd9660_setattrfilt_hotplugrdetachbwi_rf_set_nrssi_thr_11busbd_get_configieee80211_node_leave_rsnuaddr_kbootstrapufs_quota_initkqread_filtopscoredump_writebrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbxscale_cache_cleanIDem_read_part_numaue_csr_read_1buf_acquireieee80211_beacon_allocatu_attachubsa_get_statusdolinkatbioopscpu_classesieee80211_add_htopbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intraes_gcm_reinitsyncerprocrt2560_set_macaddrifa_print_rbufs_ihashinszcfreein_setpeeraddrinphymatchatu_taskwindow_inflatedb_readlinert2661_enable_tsf_syncether_ifdetachsr_meta_native_readieee80211_recv_probe_requhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledcurrent_intr_depthpanicstrbwi_set_clock_delaypdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0bwi_power_offviscpywsmouse_do_ioctlE_abs_lunsw_return_Usedehci_abort_isoc_xferhw_ver__umodsi3copyincomparamsiop_common_resetural_stopudav_sendcd9660_defattrohci_device_bulk_closeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetswcr_combineddes_set_odd_parityuaddr_pivot_selectsigacts0uaddr_free_rbtree_RB_REMOVE_COLORfindblkmajormsdosfsvnode_filtopsntohlsorflushugen_caiophy_funcsuvm_mapent_tryjoinbwi_phy_config_11gttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmugenreaduvm_pagealloc_multihidkbd_enableffs_mountral_pci_resumewsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsusb_desc_iter_inituhci_add_intrconfig_process_deferred_childrenohci_ifcdieee80211_add_htcapsxscale_cache_purgeID_Eluphymatchbs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_roottqphyattachusbd_finishbpf_getdltlistrt2860_startm_tag_getuvm_map_freelist_updateuaddr_bestfit_insertsb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_polluaddr_bestfit_removert_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initatu_initem_activatebuf_rb_bufs_RB_NFINDbuflowpagesehci_activatert2661_set_basicratesswapdev_vpre_miibus_writereguipaq_methodsaes_xts_cryptieee80211_deliver_datadead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutbwi_setup_tx_desc32unputcbwi_rf_lo_measure_11gendluphyattachVOP_CREATEcpuset_firstSHA512Updatecdce_stopifai_cmpbwi_rf_set_nrssi_thr_11guvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupsys_mknodatem_setup_transmit_structureskp_dmare_eeprom_putbyteural_writeucom_cleanupVOP_ABORTOPehci_pcdcoredump_tradsr_raidp_free_resourcesbwi_power_onem_identify_hardwaredofchownatuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_poolbackoffpagesuvm_pagerealloc_multiieee80211_wep_decryptbwi_rf_calibvalwi_inquireehci_pci_takecontrolleradm1032cloneprobeuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimesrt2661_update_promiscsdgetdisklabelsysctl_proc_cwdbwi_intrwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessuvm_map_boundarymalloc_errintvlbwi_phy_init_11b_rev5ciphyattachin_losingsis_chip_mapVOP_SYMLINKgeteblkrt2661_suspendrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchinflateBackInit_crypto_kregistervn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readdb_show_calloutrt2661_set_txpreambleaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdcmd646_9_irqackip6_sendredirectsbwi_initcast_decryptddb_sysctlsr_get_blockbwi_startukphy_caitimerfixip_stripoptionsieee80211_node_join_11gbwi_init_statechgaxe_setmultisyn_cache_countuaddr_stack_brk_createieee80211_add_xratesnd6_timer_chuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbwi_mac_adjust_tpctlwsmouse_add_muxbdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapuaddr_bestfit_selectuvmspace_duseddb_watchpoint_allocudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatuihashrijndaelEncryptscsi_ioh_deltcp_keepintvlsr_raidp_createuvisor_detachcdwriteufswrite_filtopsttybgconfig_searchphtree_RB_PREVwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocaue_tick_taskcpufunc_faultaddressdb_preveephy_funcsinphy_funcsucom_hwiflowbswap32rgephymatchipsec_exp_first_userlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productssys_chownuvm_pagewirebwi_calibrateem_stoppci_vga_pciin6_joingroupsys_munlockhotplugattachinflateBackuvm_anfreeuhci_bus_methodsdofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlevfs_getcwd_commonset_cpufuncscttyioctlsys_lstatieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfilterurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapbwi_bbp_power_onicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocbwi_calc_rssiuvscom_activatenullcnpollcuvm_km_inituvm_objinitbwi_hostflags_readpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlsys_openatm_clcountbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolrt2860_alloc_tx_ringrt2860_updateedcankmempages_minukbd_accessopsusbclosesis96x_setup_channeludav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0bwi_phy_clear_statescsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtblieee80211_add_tieem_defer_attachetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barsysctl_cptime2scsi_mode_sense_pageboot_argspipelocksr_raidp_addioumass_scsi_setupproc_pooluplcom_dtraue_intrudp6_inputsys_writert2661_next_scandb_get_valueural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedemul_flags_translatesr_uuid_print__bss_end__ip6_insertfraghdrcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2em_phy_resetdb_inst_countdb_read_linesiop_productswd_get_paramsbread_clustersys_readlinkbwi_rf_writert2560_setup_tx_descext2fs_size__ashrdi3cpufunc_faultstatusbs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEcrc32ip6_auto_flowlabelsvwsata_mapchanuipaq_cafintek_worklistdevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzucom_rtsxscale_cache_syncIrip_sendspacecoredump_writenote_elf32xscale_cache_cleanID_rnguhidev_writeusb_generic_tasksamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authrt2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadbufq_disksort_requeuesr_check_io_collisionrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_starthidms_setupwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcrd_casoftclock_siem_82547_fifo_workaroundwi_usb_threadsr_ccb_putin6_pcbsetportalldevsbwi_vendor_led_actrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchi80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlbuf_acquire_unmappedX_db_sym_numargsnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxpmap_zero_page_xscalettyread_filtopsuvm_mapiic_printusbd_bulk_transfergetinoquotabrgphy_5708s_statusscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetX_db_foralluhci_pci_cascsi_ioh_addbwi_mac_reset_hwkeysscsi_detach_busudpstatroute_inputsetrootcd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopuvscom_detachifmedia_addatu_usb_requestfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenluphy_serviceieee80211_add_rsn_bodyrt2560_txtimert2661_rxratecd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83tcbtableieee80211_recv_4way_msg2i80321_mem_bs_init__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscre_disable_sim_imip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupricohrtc_cawi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRpmap_kremovesigactsinitohci_pci_caffs2_blkprefdomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttysr_concat_free_resourcesbwi_detachural_bbp_readsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredem_power_up_serdes_link_82575mld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocol_nrssi_thresholdpmap_l2dtable_ctoruvm_mapent_forksharedm_pullupenterpgrpxscale_tlb_flushID_SEnull_zerokeycrypto_freesessioncnbellm_copydatagetdirentries_internalatu_stopcd_setchanieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4ttymallocupl_attachums_intricmp6_notify_errorieee80211_recv_probe_respbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctluaddr_free_rbtree_RB_NFINDuvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigohci_device_ctrl_methodsbpf_ifnameehci_allocmohci_cdural_ioctlvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenpdc205xx_drv_probewskbd_compose_valuespec_getattrpciide_dmactl_readobio_bs_unmapiic_scanip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachieee80211_ibss_mergeboot_filefilt_sordetachpsignalieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadbwi_mac_unlockamap_pp_establishauth_hash_gmac_aes_192ieee80211_setkeysuvm_pmr_nextszatu_activateuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_exploreifaddr_items_RB_REMOVE_COLORxscale_cpufuncsif_link_state_changepmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micpage0_endusb_disconnect_portieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activateciphy_fixupbwi_mac_lockbmtphy_servicesched_kthreads_createuhci_device_bulk_closeuhid_cdwskbd_cnbellbintimesr_crypto_intrbwi_set_clock_modere_woluhci_intr1jmicron_chip_mappciide_print_channelswi_seekfilt_soreadpmap_remove_allrtable_addrt2860_mcu_bbp_writezeropageipsec_def_encbrgphy_bcm5401_dspcodeffs_nodealloccgbwi_mac_calibrate_txpowersoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityrt2560_set_slottimeenoioctlrt2860_watchdogwi_usb_start_threadbwi_dma_txstats_allocsigacts_poolpcaled_matchexecsigsconfig_initip_weadvertiseskip_fcicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macpciaddr_print_deviduvm_addr_destroyuvm_pmr_size_RB_MINMAXdb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypenduvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyuaddr_bestfit_destroyX_db_symbol_valuesiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descext2fs_advlockknote_fdcloseusbd_get_devcntehci_device_intr_doneem_get_pcs_speed_and_duplex_82575if_clone_detachpipe_rfiltopssiop_dmamem_allocubsa_openin6_cksumcomcninitpciide_print_modesstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbwi_newassocbs_notimpl_bs_c_4upl_startsyn_cache_respondif_creategroupllinfo_nd6sbcheckreservepreemptuvm_iobioattachieee80211_begin_scanunixdomaindb_next_free_breakpointbwi_led_attachbwi_tbl_write_2smdscsibusattachumct_rtssyn_hash1ulminwihap_data_inputi80321intc_do_pendingdb_last_symtabproc0paddrrn_addmaskifaddr_itemspciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_pollumodem_activateuvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2860_reset_rx_ringrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdbwi_mac_init_tpctl_11bgtimeout_adjust_ticksxscale_cache_cleanD_Ewskbd_do_ioctluvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_matchbwi_txeof__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonersrt2860_set_txpreamblewdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusageswcr_sesnumlf_getblockpciide_irqackautoconf_attdet_mtxumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainrt2661_bbp_writeohci_handoverusbd_intr_transfer_cbsowrite_filtopssr_chunks_unwindstrncpycseaddrevarp_in_progressdb_disasmsdreadupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stopvfs_vnode_printdb_history_lastrrticks_initbio_status_initusbd_set_port_featureusb_run_tasksbpfilter_createsysctl_locklockfpoolwihap_disassoc_reqieee80211_find_nodecpu_switchtoucom_cahtonlsched_all_cpususb_find_descin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donedeupdatehci_ifcdSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskbwi_set_bssidiophy_statusschedclockbpfioctlconfig_attachsr_sensors_createohci_alloc_sitdcue_rx_list_initbwi_hostflags_writert2661_attachhookbmtphy_statusdisk_unbusysysctl_fileusb_syncmemugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphysauth_hash_key_md5siop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofumct_paramuhidev_attachfrag6_nfragpacketsdb_linesr_raid0_assemblebwi_cdpool_allocator_largein6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlite_chip_mapVOP_READLINKbuf_mem_initumass_cbi_methodsdb_ed_stylemii_submatchuvmexp_printohci_root_intr_transfermsdosfs_pathconftimeout_wheelbwi_pci_conf_readbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleepehci_root_intr_donert2860_rx_intratu_get_opmodeunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closesr_hotspareuvm_km_pgremoveex_region_plfscaleffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachm_livelocksys_dupmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_topci_find_devicetimeout_todoswcr_initdb_lcbwi_updateslotcpu_read_cache_configumsm_truinstall_changemodeumsm_detachwdc_sii3114_vtblsr_ioctl_createraidpanicget_pc_str_offsetL_cksumdataciphy_resetural_rxeofcue_rxeofmsdosfs_lockseltruepci_subclass_systembpf_m_xwordscsi_xs_syncieee80211_recv_group_msg2softdep_initializestackgap_allocunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initsr_raid1_recreate_wuwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpte_l2_s_cache_mode_ptdeferred_config_queueciphy_funcsucomreadcbbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautouhci_endpdsis_setup_channelwsmux_detach_sccom_raisedtrdb_last_commandicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stoleni80321_io_bs_unmappte_l2_s_prot_maskpciide_intr_flagudav_ioctlcrypto_registercache_purgevfspostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readdb_object_print_cmdieee80211_notify_dtimrt2860_select_chan_groupfintek_write_regsr_crypto_finish_ioohci_initcomopensata_setup_channelusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXpiix_chip_mapbcopyiic_attachwsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applygeneric_bs_rr_1ni6_addrsaxe_resetdefrouter_addreqin6_clearscopebwi_pci_cand6_dad_ns_inputuvmpd_tuneusbd_set_addressudav_openpipesffs_setblockipsec_expire_acquirepci_suspendkue_stopicmp6_mtudisc_cloneatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionnamecache_rb_cache_RB_REMOVE_COLORumct_dtrip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startdb_output_linebwi_get_card_flagsbwi_rf_get_gainscomstartaes_xts_reinitdb_examinecfroots_sizedb_end_linebwi_mac_gpio_finitickadjpool_alloc_item_headeriq80321_irq_mapip6_splithdruvm_map_addr_augmentsiop_clearfifotcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchextent_printieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listsysctl_stringsys_rebootuvm_unmap_kill_entryext2fs_specvopsbufpoolproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffercpu_forkuaddr_kbootstrap_selectwi_write_data_iodb_print_ifattylistwdopenuvm_vslockre_initdeflateResetuvmfault_update_statscast5_setkeypci_ndomainsttyoutputkue_caexplicit_bzerocd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdcopyaddroutcryptodev_cbumodem_detachcpuset_add_alluhci_root_intr_abortrn_mkfreelistVOP_READbwi_phy_calibrateufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2re_stopsenditsr_crypto_decryptudp_detachbufq_fifo_destroyacer_dma_initcluster_writernd_event_tailhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timersr_raid1_rwucomwritein6_recoverscopensphy_serviceaue_ticki80321intc_cdsr_raidp_set_vol_statetimeout_add_tvticksvwsata_write_regmclpool_warnmsgi80321intc_cadb_termscsi_preventmmcloseieee80211_get_assoc_respcd9660_accesssr_wu_getffs_statfsuhci_shutdowncpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacekm_allocfill_file2fdropi80321_mainbus_matchgf_initsyn_cache_unreachuserconf_histszsys_getrlimitrt2860_attachhooki80321_mainbus_foundicmp6_errcountbpf_attachdfintek_cdicmp6_ctloutputieee80211_ba_move_windowcpuset_issetsvwsata_dmactl_writeufs_dirremoveumct_setrgephy_serviceieee80211_add_timif_attachsetuppipe_writem_clsetwmssr_set_chunk_stateuvm_map_addr_RB_FINDcryptof_pollin_pcblookup_listensbappendm_copybackscsi_remove_linknd6_rtmsguvm_swap_puticmpbmcastechoHMAC_SHA1_Initextent_print1db_continue_cmdrt2661_mcu_beacon_expireehci_timeoutbufheadconfig_scanwi_get_nwkeykp_pageablesr_raid6_addiopmap_copy_page_funcripsrciso_nchstatsem_update_eeprom_checksumkue_txeofugenkqfilterural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachusbd_devinfo_allocinflateSyncsr_raidp_xor__wdccommand_doneumass_adjust_transfersignal_initfill_drlistffs_updatedb_print_formatrt2560_tx_bcnwsmuxcloseunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getX_db_lookupmtdphy_funcsuipaq_seti80321intc_matchblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachudav_activatei80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemext2fs_symlinkdb_skip_to_eolip6_savecontroldevice_registerpciide_chan_candisablesr_raid6_set_chunk_statend6_dad_stoptimerq_to_bmountrootsyn_cache_resetdb_inputcharuhci_device_intr_doneuhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_sensein_mask2lenbwi_ack_rateural_eeprom_readscsi_iopool_destroylodirtypagessr_ioctl_disciplineem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execifa_update_broadaddratu_detachnd6_addr_addifa_ifwithaddrsr_dumpclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferbwi_dma_freebwi_phy_init_11b_rev2db_write_cmdrootduidif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrem_config_collision_distnatsemi_irqackdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthip6_pullexthdrmalloc_printitcpu_idle_enterbwi_regwin_disable_bitscomwriteuvscom_intrbuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosecast5_zerokeysys_fchdirsr_crypto_readsysctl_ifqprocess0ieee80211_send_eapol_key_reqm_cltick_tmorandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdre_ioctlsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVElastsecondswdog_timeoutpci_probe_devicewsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strsusbd_sync_transferlun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initproc_reparentrt2661_select_antennauvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildsr_crypto_createsvwsata_dmacmd_writescsi_ioh_setbootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctluvm_map_addr_RB_NFINDif_free_sadldb_dotbwi_mac_gpio_initucomstopieee80211_node_joinfilt_bpfrdetachcompress2umodem_openicmp6_initbwi_mac_shutdownbs_notimpl_bs_rm_1disassembleuvm_mapent_free_insertfilt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrpool_set_ctordtorcy82c693_readbpf_moveiniq80321_hdlg_irq_mapostypevndbuf_poollastpiduplcom_resetuvm_page_physloadreset_entryucomstartuvm_pmr_remove_1strangere_setup_hw_imwdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggohci_noopusb_frag_freelistip_slowtimordsizerijndaelKeySetupEncrt2860_load_microcodeubsa_rtsip6_nexthdrrtdeletemsg__bss_startumsm_openrt_tab2domdcphy_cdbwi_rf_readpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_cabwi_free_txstats64ixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachpciide_intel_productsuipaq_dtrmemsetcuio_copydatapipe_free_kmemufs_getlbnsieee80211_get_actionieee80211_sa_query_requestphysioohci_strin6_selecthlimdb_show_all_vnodesupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncin6_unlink_ifacrypto_kdispatchicmp_mtudisc_clonert2661_rf_writeuvm_pmr_insert_sizesodisconnect_spllowerumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsucomttyohci_device_bulk_doneether_crc32_le_updateusbd_initmtdphymatchtimespecfixbwi_read_spromsr_raid1_set_chunk_stateuplcom_opensiop_lookup_productuaddr_bestfit_createural_set_basicratesip_flushieee80211_delete_keykue_startre_watchdogsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errordb_hangmanwsmuxdevsbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsrt2860_iter_funcvholdbufq_fifo_dequeuepciide_map_compat_intrubsa_parityidgen32db_help_cmdrt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchm_adjmld6_stop_listeninghotplugioctlsvwsata_read_regpmap_map_chunkppsratecheckkmemlimitbuf_rb_bufs_RB_PREVrt2560_rf_writebwi_ioctlbwi_init_rx_ring32amap_copybufq_drainphysical_endbwi_phy812_valuebwi_rf_calc_nrssi_slope_11bbio_statusuhci_allocmuhidpollsched_wasidleieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_mapuaddr_hint_destroylf_findoverlapsr_raid_start_stopfilt_msdosfsvnodebwi_txtimelf_wakelockkv_anydb_sym_numargskue_attachhookdumpconfAES_CMAC_Initwi_rxeofehci_pci_detachbrgphy_cahpt_pci_intruaddr_lin_selectdead_badopbwi_dma_mbuf_destroypciide_dma_finishpool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatifnet_addrssysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremieee80211_recv_4way_msg2or4cttywrite_bus_dmamap_createSHA256Inittcp_update_sndspaceurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctlbwi_rf_calc_txpowerudav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readbwi_rf_lo_update_11guvm_km_doputpagepciide_vendorspci_get_powerstateufs_opencopyout_statfspmap_modify_pvi80321_intr_establishm_catbwi_free_tx_ring32splxbwi_regwin_switchohci_pci_attachrtinittqphy_statuscluster_collectbufskp_dma_contigsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inittcp_nowaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupcpuset_clearxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodeuvm_pmr_size_RB_NFINDiq80321_pci_intr_mapre_miibus_readreguvm_mapent_addr_removetimeout_setrdread__subdi3ntohsmsgbuf_putcharbwi_media_change_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishkv_pagedupfdopeni80321intc_calc_maskidgen32_initbwi_dma_ring_allocifmedia_list_addpidhashrt2661_updatestatsrtprefxscale_context_switchuvm_totalencdebugicmp6_ratelimitdb_unread_charsr_raid1_createsys_mkdiratiic_searchdofstatatstart_inituhub_attachieee80211_recv_assoc_reqether_fakeaddrsysctl_tc_hardwarert2661_prepare_beaconscsi_ioc_ata_cmdtcp_mssdfltrt2661_alloc_rx_ringrt2860_updatesloti80321_bs_unmapuvm_swap_freeatu_newbufdata_abort_handlerbwi_tbl_write_4bs_notimpl_bs_r_1umsm_closeaxe_initdb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updttycheckoutqrt2560_watchdogpiix_timing_debugicmp6_mtudisc_callback_registerdb_set_variableuvscom_set_linevm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabswaplist_insertip_forwardextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setudav_setmultiip6_mforwardingnd6_setdefaultifaceffs_isfreeblocki80321_mem_bs_freeseltrue_kqfilteruvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4ieee80211_get_probe_respdead_strategypciide_dmacmd_readswi_handlergcu_miibus_writeregni6_store_addrsspec_fsync__wdcwait_resetuvm_map_deallocateicmp_reflectieee80211_parse_wpamii_phy_activatescsi_xsh_iohext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupsieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textumodem_get_capsufs_startsigstkinitbufq_disksort_dequeuebrgphy_mii_phy_autoohci_devd__end__kinfo_vdebugbwi_start_tx32rt2860_ampdu_rx_stopnsphy_reseturl_sendcdce_encapufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_lockaes_ctr_setkeyumct_attachurl_resetusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startwsmouse_cdricohrtc_settimeVOP_FSYNCbwi_mac_get_propertyffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closecd9660_closeuvm_map_mkentryem_initialize_receive_unituvm_map_addr_RB_REMOVEsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinetc_adjfreqrnd_statesuaddr_pivot_createm_gethdrem_dma_mallocugen_activateconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namebufbackoffricohrtc_attachsysctl_rdstruct__divsi3uhidev_cdwsmousereadxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readbwi_mac_bss_param_initrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledswihap_sta_timeoutsiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headwsmuxioctlsr_crypto_read_key_diskusbd_interface2device_handlepcaled_cdipforwardingdb_lexohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalicmp6_redirect_timeoutsyn_cache_lookuparc4random_statebwi_setup_tx_desc64prtactiveksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsusbd_find_edescfilt_ttyreadsys_getpgiduhci_runcom_common_putcswaplist_trimcache_lookuprdioctluhci_allocxobsd_pci_mem_findrijndaelKeySetupDecdb_boot_crash_cmdbwi_rf_on_11auvm_objtree_RB_INSERTsysctl_tcbs_notimpl_bs_rr_1url_detachumass_scsi_sense_cbrijndael_encryptricohrtc_clock_writeieee80211_recv_mgmtbwi_newstate_beginumsm_get_statusaxe_detachdumpsizesowwakeuppci_matchbyidukbd_keydesctabsr_raid_inquiryextent_freeuvm_aiodone_daemoni80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featureext2fs_vopsieee80211_send_4way_msg3db_mount_print_cmdcomcloseiopxs_mainbus_caeephy_attachsetsigvecsiop_dmamem_freesys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodestrcmpsys_quotactluhidev_matchsr_raid_startwuieee80211_get_hdrlenuaddr_pivot_destroytcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createucomwritecbdb_stack_trace_printusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolhotplugclosedb_show_frame_cmdsys_adjfreqpci_cadb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initscsi_ioh_runqueueuaddr_lin_functionsuvm_addr_entrybyspaceata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubrevarpwhoamiieee80211_get_ratevop_generic_islockedrt2860_reset_tx_ringuaddr_hint_poolm_pulldownbufcachepercentbwi_mac_detachacer_pci_intrpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regukbd_cngetcz_errmsgtcpcb_poolsr_shutdownhookrt2860_updateproti80321_pci_make_taguvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragem_write_pci_cfgrtable_l2setvnode_hold_listlastdosdateudav_unlock_miibuf_rb_bufs_RB_NEXTuhci_add_bulkral_cdufs_linksched_choosecpusys_mkfiforicohrtc_matchuaddr_free_rbtree_RB_REMOVEzcallocdb_cmd_searchifa_ifwithafural_read_eepromin6_ifinitin6_leavegrouprtlabel_id2sasqphy_caem_reset_hwsddumpiminsys_chflagsobio_bs_tagget_hw_ifidKQRELEdelaypci_reserve_resourcessdstartdb_machine_command_tableip6_hopopts_inputddb_regsselfalseieee80211_media_initricohrtc_gettimescsi_default_putcom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncwi_setmultiuvn_clusterifaddr_items_RB_MINMAXre_gmii_writeregcd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusdb_cmd_loop_donearptfreeubsa_detachfilt_ugenread_intrdb_show_arptabbufadjustcom_detachieee80211_ccmp_encryptaxe_stopbs_notimpl_bs_w_2ural_set_macaddrdead_printeephy_serviceinphy_servicemii_media_tablesr_discipline_freebwi_rf_lo_devi_measurewdstrategyrt2860_set_macaddrttyprintfi80321_pci_bus_maxdevsreaperprocsigcodedb_elf_search_symbolhpt_chip_mapipip_inputdeflateCopyieee80211_send_group_msg2db_delete_watchpointcomttybuf_undirtysysctl_tstringsr_meta_cleardb_watchpoints_insertedxscale_cache_cleanDusbd_start_nextfilt_ttywdetachamap_swap_offpool_allocator_nointrbwi_pci_attachsys_sysarchrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediafilt_msdosfsreadwritecpu_reset_needs_v4_MMU_disablecache_zapMD5Initem_txeofpcaled_gpio_pin_writecryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlcpu_info_storeieee80211_outputfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedpmap_bootstrap_pv_allocatormsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchbufq_disksort_destroycrc32_combinedevid_freeboot_eaddrre_rx_list_fillieee80211_sa_query_timeoutscsibusactivatend6_timercomcnpollcatu_matchbioopenbwi_phy_set_bbp_attenqsphy_servicein6_ifloop_requestcd_patterns__cmpdi2crypto_workqsr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multibs_notimpl_bs_wr_1domainnamelenehci_pollpciattachigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initrt2661_enable_mrrload_dsatag_switchurl_ifmedia_statuspciide_pci_readatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedem_set_media_typeem_update_link_statusscsi_xs_errorprtrealloccheck_consoleamap_freeem_detachin6_domifattachugen_get_alt_indexusb_blk_nfreend6_prefix_lookuptc_getfrequencyrt2661_mcu_cmd_intruhci_device_ctrl_methodsbwi_rf_lo_adjustsync_inactivespec_printlocleanpagesext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokeohci_hash_add_itdusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimerandom_initdisk_openpartmii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtsip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutbwi_rf_calc_rssi_bcm2053pool_print1wdc_ioc_ata_cmddb_breakpoint_listcd_get_parmspmap_extractrt2860_set_channd6_ifptomacwsmousedoioctlamap_unaddural_watchdoguvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutrevarpwhoarewecue_txeofatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilterem_configure_k1_ich8lannforce_pci_intrext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchukbd_keymapdatasr_meta_validatestopprofclockdb_hangbwi_rf_on_11bgnullioctlcertance_irq_mapuaddr_pivot_printcryptof_closepte_l2_l_cache_modeisohashrt2860_rssi2dbmmclsizesparsediskre_eeprom_getwordrt2860_calibwi_set_debugbcstats_printbwi_regwin_selectbreadem_intrieee80211_node_copyamap_lookupipctl_varsbwi_init_tx_ring64apollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readrt2860_free_tx_poolwdc_output_bytesatu_ioctlieee80211_classifyproc_stop_sweepieee80211_media_statusiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keydb_playsieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initrtable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfiltercpu_startupamap_refehci_device_bulk_transferuhci_device_isoc_transferdb_command_loopwdc_ioctlamphyattachrt2661_updateslotfdexpandsrandomcoredump_countsegs_elf32tickswdc_ata_presentpdc20262_dma_finishmsdosfs_closerd_detachpool_do_gethotplugreadext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intruftdi_activateurl_setmultiusbd_get_device_descbwi_phy_writesyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivatecy82c693_initufs_unlocktcp_ctloutputrt2860_mcu_cmdrt2661_plcp_signalukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_setem_setup_interfacebio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removepciide_activatesysctl_tc_choiceptsignalboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputuhci_device_intr_closecompressBoundpmap_alias_distunpst_sendspaceffs_indirtruncieee80211_add_ratestcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolpci_detach_devicespmap_pageidlezerouaddr_rnd_printmii_phy_statusmsgpdc203xx_irqackcpufunc_domainsswapdrum_getsdpVOP_PRINTfdsharepci_subclass_memoryicmpv6ctl_varsbwi_rf_lo_measure_11bfintek_matchcdstartgf_premulfilt_generic_readwriteuserconf_disableumct_methodsvrefin_scrubprefixusb_detachipforward_rtuhci_device_intr_startbwi_rf_lo_update_11bem_access_phy_reg_hvdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateAES_CMAC_Finalsr_uuid_formatnd6_dad_na_inputuvisor_cdsd_cmd_rw16ghash_updatedb_set_temp_breakpointsiop_cmd_putdb_buf_print_cmdbwi_rf_set_chaninpcb_pool_initializedsys_nosysbwi_regwin_disableat_pollallproccdevswsr_rebuildxscale_cache_flushDumodem_get_statussys_mlockalluaddr_free_rbtree_RB_FINDwskbdcloseuvm_sysctlmalloc_lasterrgetsndiskmapopen_bus_dmamem_unmaprthreads_enableddisksortsys_fchflagsnamei_poolrt_timer_countvfs_buf_printuhci_device_intr_transfercryptodev_opworkq_destroyukphymatchuvm_pager_putdiskmapcloseohci_device_bulk_abortbwi_newstateem_access_phy_debug_regs_hvudav_cabwi_get_clock_freqin_canforwardifa_item_removeohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mapvfs_getnewfsidaue_rxeofem_cducom_attachSHA512Finaludp6_ctlinputitimerroundarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdpci_findproductamphy_statusukbd_intrifa_item_insertrtioctlkue_ctlscsi_xs_putifaddr_item_pluaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcbootduidehci_pci_activatespeedup_synceraes_xts_zerokeyigmp_sendpktsched_cost_residentloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcbwi_rf_clear_tssim_getptrukbd_cauhid_activateufsvnode_filtops_bwi_adjust_devideuvm_fault_unwireuserconf_common_attr_valsched_noidleuhci_add_ls_ctrlobsd_pci_io_findsys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwohci_pci_attach_deferredip6_freemoptionssr_raid1_alloc_resourcessqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofbufhighpagespmap_fault_fixupdcphy_serviceuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelhidkbd_ioctlvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofni6_nametodnssobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcnclosedb_tok_numbertcp_do_rfc1323ip_fragswdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changesr_raid0_rwipqmaxlenif_downalluaddr_pivot_newpivotext2fs_vptofhnam2blksr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessuvm_km_kmemalloc_plart2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodssys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingbwi_led_blink_startrt3090_efuse_read_2loop_clone_creatediskmapwriteem_hash_mc_addri80321_timer_initeduvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutworkq_add_taskttyclosewdrestartugen_isoc_rintricmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheobio_bs_freecmd0643_9_setup_channelural_write_multiuvm_pagecountcpu_initclocksbwi_mac_fw_alloccue_sendwskbdioctlmii_downrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delttyoutdevice_lookupehci_device_requestDebuggerwi_usb_txeofcdminphysschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputtcp_totbackoffvdropuserconf_basepci_subclass_displaylooutputrt3090_rf_readcue_setmultirijndael128_zerokeysoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonepmap_clearbitieee80211_mgmt_outputcrypto_freereqbwi_rxeof64syn_cache_rmclrbitsdb_boot_dump_cmduvn_putscsi_add_linkpci_vga_tagxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorcrypto_newsessiongeneric_armv4_bs_r_2bufq_disksort_peekenc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcluphy_funcsdb_leieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8board_startupsys_socketpaircnreadpcimatchcertancepci_addr_fixupdounmountuvm_swap_allockthread_create_nowhidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizesr_map_rootttspeedtabns_scx200_setup_channelkqueue_readieee80211_add_edca_paramscd9660_mountuserconf_maxdevre_pci_attachcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmrateacard_setup_channellxtphymatchi80321_bs_initsr_hotplug_registerpv_sizeuvn_sync_qin_proto_cksum_outwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutuvm_wakeup_plaiszerodevuhci_devdciphy_caupl_inputauth_hash_hmac_ripemd_160_96ieee80211_recv_pspollumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthbwi_ds_plcp_headerprobe_addrs_eepromif_attachdomain1sys___get_tcbraw_recvspacesr_raidp_set_chunk_statebwi_mac_set_ackratesieee80211_amrr_node_initdiskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadem_media_statusscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatsums_detachcdce_attachdes_ecb_encryptudp_inputnchrtoblktblehci_sb700_matchihashrn_search_mresettodrusbd_ref_decrpcaled_attachufs_readdirsys_flockiq80321_startpvwi_usb_do_transmit_syncspec_badopbwi_memobj_read_2msdosfs_linkpciide_unmap_chanbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdpipeselwakeuprt2860_get_rfxscale_controlcd9660_quotactlicmp_sendadjtimedeltauhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogdb_mbuf_print_cmdsiop_ppr_negwdc_ata_errieee80211_choose_rsnparamstime_uptimeuvm_pagealloc_pgcdce_intrfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuesr_raid0_free_resourcesbs_notimpl_bs_r_4db_putstringprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edatagcu_miibus_statchgupl_detachrijndael128_decryptbwi_setup_rx_desc64ttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashrembwi_phy_readsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsched_nomigrationsinittimecountersensordev_deinstallrawin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupdcphy_matchscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolrt2661_rx_intrvnode_free_listtcp_savetiuvm_pagereallocbwi_setup_desc32iicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printitubsa_flow_endpciide_attachdes_check_keyrt_senddesyncsogetopthid_report_sizeuvm_unmaprd_matchricohrtc_cddb_deletewatch_cmdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1pollscandomaininitsii3112_setup_channelvflushbuftime_secondbwi_pci_matchacer_chip_mapip6_forward_rtusbd_get_interfacewskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbackusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachrt2560_resumeieee80211_setup_nodebioioctldvd_read_structvdevgonehtonsumsm_intrehci_pci_attachubsa_setdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scancominitrt2560_newassocieee80211_add_pmkid_kdeenodevobio_bs_barriersr_raid0_discipline_initffs_mountfsin_delayed_cksumm_clticksfintek_fullspeedi80321_mem_bs_allocicmperrppslim_lastrtstatttvtimeoutatu_startkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEwsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachehaltpciide_sis_productseephy_cainphy_cawihap_sta_is_assocsr_raidp_intrieee80211_std_rateset_11akputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initdisk_gonewi_write_record_usbdb_show_all_mountscue_csr_read_2uhci_device_setintrm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollsr_meta_initural_startkp_dma_zerosensor_task_ticksys_swapctliic_dumpbd_reqbs_notimpl_bs_rm_2copypktoptsin_selectsrcmsgscpu_exitip6_initpktoptsworkq_threadbwi_get_eaddruvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqpci_vga_procusbd_nbusesfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusrtalloc_mpathsii3114_chansetupxscale_cache_purgeDusb_begin_tasksscsi_activate_targetdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnbwi_iter_funcsbflushehci_device_intr_transferscsi_link_closeipsec_require_pfsswapdevwd_cakue_sendsysctl_intrcntaxe_tick_taskvn_readnclrunegheadbwriteleavepgrprt2860_set_gp_timerqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closestatminsr_copy_internal_dataehci_root_ctrl_closewihap_sta_allocem_fill_descriptorscast5_decryptbrgphy_copper_funcsxscale_setuprt2661_set_bssidnamecache_rb_cache_RB_INSERTpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyuhci_rem_loopuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsrt2560_rxratergephy_load_dspcodeusbd_get_config_descsosenddosetrlimituvm_pmemrange_addr_RB_PREVrn_initieee80211_set_timuvm_objtree_RB_NEXTsr_scsi_probecmd_channel_maploopattachusb_match_devicesiop_update_residural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finaldb_listwatch_cmdrt2661_set_slottimepci_get_ht_capabilityusbd_do_request_flags_pipescsi_cmd_rw_decodechainlengthprocess_read_regsbwi_mac_startwdc_pdc203xx_vtblsys_unlinkatural_disable_rf_tunettwakeupwrrn_lookuppciide_ati_productsuserconf_show_attrsys_execveamd756_chip_mapite_setup_channelfdallocprfindrt2860_updatestatsrt2661_alloc_tx_ringscsi_doneexec_aout_prep_oldzmagicrt2860_set_bssidchkvnlockhw_sysctltc_ticktockbwi_start_tx64rt2560_newstatephtree_RB_MINMAXdb_siftinguhci_device_bulk_abortdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescryptof_ioctlcomreaduvm_pagefreeehci_device_isoc_abortext2fs_inode_allocswcr_encdecbufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrieee80211_inact_timeoutreaperbwi_bus_initieee80211_add_gtk_kdecoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readuhci_root_intr_closeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogpriworkq_queue_taskmemhookdoclusterreadcast5_encryptsys_exitpciide_chanfreesbtryusb_desc_iter_nextuvisor_matchieee80211_send_4way_msg1m_applyswcr_processcryptof_writeudav_startaxe_lock_miiuaddr_pivot_functionsdomkfifoatrt2560_detachwdc_exec_commandudv_lockbufqsdb_watchpoint_listwdcintrcd_playHMAC_MD5_Updatesys_clock_getresaxe_attachsyn_cache_insertrc4_getbytesttystats_initpciprintpci_mapreg_probeem_allocate_receive_structuresbrgphy_ber_bugucom_matchnd6_umaxtriesohci_device_intr_donedcphy_reseti80321intc_read_intsrcnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_pieumodem_cawindow_deflatedb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_iddefrtrlist_updatert3090_rf_writeurl_csr_write_1_tr_initSHA1Transformesymieee80211_defragcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasert2860_newstateucom_cdsiop_update_xfer_modeHMAC_MD5_Init__modsi3tcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initwihap_timeoutuserconf_changedb_panicuserconf_helpsr_ioctl_setstateufs_advlockicmp_initsr_raidp_openingssii3112_chip_mapcdst_pteuvm_growcsecreatevfinddevieee80211_node_cleanupE_ldsa_abs_reselected_Usedral_pci_attachpciide_unmap_compat_intrrt_msg1ehci_device_bulk_methodsether_delmultibrgphy_5709s_statussave_rtedb_history_currsr_crypto_get_kdfmainbusattachrn_mpath_initheadbwi_watchdoguvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctldos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolbufq_restartuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsys_fchmodatu_watchdoguvm_unmap_detachieee80211_recv_authehci_add_qhupl_initusb_dev_quirkswskbd_srcopsuserconf_common_devvfs_mount_printstartieee80211_needs_authwdog_cookieusbd_devinfosiop_wdtr_negvn_isdisksys_selectbwi_attachdeflateParamsbwi_mac_initbadaddr_read_1vop_generic_lookupcryptoattachzombprocdb_branch_takenin6addr_intfacelocal_allnodeslogreadumsm_cdrn_mpath_capabledead_lockworkq_next_taskieee80211_name2regdomainbwi_nrssi_11gtcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixvfs_unregistermii_phy_flowstatusdisk_mapselwakeupumct_set_baudrateffs_reloaddefault_chip_unmapdb_set_watchpointsem_initialize_transmit_unitfill_kproccnwritert2661_reset_tx_ringumass_bbb_get_max_lunin_ouraddrpolloutdb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodewsmouse_activate_bwi_rf_lo_update_11gaes_key_unwrapem_media_changerip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountffs_vopsdofutimenssys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputcd_pausecompresshashinitttstartumass_setup_transferciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrieee80211_parse_rsn_akmrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsuhci_hubd_piixin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setwordpci_vga_countdb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimensexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resetuaddr_pivot_removetcp_slowtimoieee80211_std_rateset_11bre_setup_intramphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearchsys_fhstatfself32_load_filesys_getpeernamert2860_alloc_rx_ringrt2560_prio_intri80321_bs_subregionehci_device_intr_closeehci_intrieee80211_get_txkeydb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagepdc205xx_do_resetauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXcryptoioctlbufq_destroynd6_prunert2560_set_chancomconscflagm_getbwi_bbp_power_offffs_truncateuhidevprintmii_attachuvscom_cabwi_rf_workaroundttylclosecmd680_chip_mapwdc_svwsata_vtblpool_allocator_allocsiop_cmd_getwdc_default_read_reghidms_inputin6_ifremloopchar_typeohci_free_sitdusbctlprintvn_closeworkq_createuftdi_readudav_csr_writeuhid_do_readin6_createmkludgedoclusterwriteusbd_close_pipeusbd_deactivateffs_writeieee80211_wep_set_keybremfreefilt_sowdetachnd6_initip6_maxfragslimfreedoutimensatdb_show_regsuhci_reset__wdccommand_intrrt2661_startaes_ctr_zerokeyuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlpmap_pmap_ctoricmperrpps_countuserconf_modifywi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_changeumsm_huawei_changemodewskbd_add_mux__muldi3umct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_cabufinitubsa_closebootconfigscsi_quirk_patternsuserconf_lineslimit0rt_if_trackciphymatchuvm_md_constraintsif_attach_commonE_abs_targ0_Useduniqdosnamedb_recoverinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolsr_concat_assemblesd_cmd_rw12ucomstartreaduvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTrt2661_initdcphy_funcscom_obio_attachufs_dirbadentrybwi_rf_init_bcm2050bwi_get_firmwarelogioctlicsphy_funcsubsa_databitsgeneric_bs_wr_1_bus_dmamap_load_uiostrlenrt2661_intrusb_run_abort_tasksdb_machine_initsensor_task_workuhci_cdconfig_suspendieee80211_parse_rsn_cipherkue_activatepool_page_freewsmouse_inputwdactivatecopystrsched_nmigrationswdc_do_resetiftxlistwdog_ctl_cb_argsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorbwi_mac_testieee80211_encryptxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3i80321_pci_conf_sizeproc_trampolinesys_rmdirem_attachcd9660_vfsopscpuset_copyem_get_bus_infobrgphy_5709s_funcsspec_accesssocantsendmoreproc_zapusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffbwi_phy_init_11b_rev4coredump_note_elf32fs_posix_sysctlif_slowtimouhci_root_ctrl_abortrt2860_setup_beaconwd_shutdownudbtablewi_setdefwdcattachufs_printem_rar_setuaddr_lin_createfatentrywi_update_statsAES_CMAC_Updatesiop_startbwi_pci_devicesusbd_printBCDsys_statrt2661_txtimeukbd_apple_mungein_baddynamicieee80211_keyrunhotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smem_check_phy_reset_blockuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadsural_bbp_writeknote_attachmax_keylenrt2860_ioctlieee80211_tkip_decrypt__assertif_congestion_cleardb_put_valuend6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqmsdosfs_strategycd9660_vopstimeout_delem_ioctlural_media_changem_cltickuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategybwi_rf_initiic_cauvm_pglistfreebwi_tmplt_write_4usbopenums_attachext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrubsa_methodshid_clear_localbufq_disksort_createehci_check_itd_intrscsi_sizescsi_plug_poolrgephy_capci_mapreg_infouvm_pmemrange_use_cmpaes_xts_encryptrt2661_free_rx_ringuvscom_cduvm_pmr_size_RB_INSERT_COLORdb_deleteauth_hash_gmac_aes_256crypto_driversiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolsys_chrootehci_odevdubsa_cdieee80211_rssadapt_lower_rateumodem_dtrsr_crypto_wu_getehci_device_clear_toggleuhci_portresetrt2860_attachicmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufpci_subclass_processorsr_wu_freeehci_check_qh_intraobj_pageruvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2rgephy_mii_phy_autouvm_objunwireieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purge__data_startieee80211_eapol_key_encryptifmedia_delete_instancefilt_timerattachE_ldsa_abs_data_Usedurl_caenc_xform_aes_gcmbwi_mac_stoprt2860_txrx_enableucom_breakpdc205xx_pci_intruvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepgeneric_bs_w_4inflateEndexec_aout_prep_oldnmagicsr_set_vol_statewsevent_pollieee80211_pwrsavesys_profilvmcmd_map_pagedvnciphy_servicein6_pcbhashlookupbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setehci_root_ctrl_abortsyn_cache_initcd9660_wchar2charieee80211_find_txnodeip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevbwi_dma_txstats_freeuvm_init_limitsukphy_cdentropy_input_rotatesii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeieee80211_add_igtk_kdeVOP_POLLVOP_IOCTLrt2860_node_allocstatvarsafepriluphy_cduhidev_ioctlwdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinebwi_newbufwi_cmd_ioVOP_CLOSEbwi_reset_rx_ring32uvm_anallocin_pcbdisconnectuvm_vnp_terminatewi_usb_rxfrmbwi_init_txstats64sys_getpidnd6_defifindexuaddr_rnd_functionsipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchrt2860_eeprom_read_2fintek_read_regrn_addroutesdactivatefilt_msdosfsdetachdb_print_sadb_elf_sym_numargsural_detachdb_trapperukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrieee80211_input_printdomkdiratem_allocate_transmit_structuresnforce_chip_mapem_mc_addr_list_updateremrunqueueatu_initial_configsoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_regehci_device_ctrl_donemaxthreadnd6_lookupieee80211_cache_sizeurl_openpipesukbd_countrylayoutbwi_led_durationsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectVOP_READDIRdomainsrc4_skipsys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharrt2661_node_allocieee80211_recv_sa_query_respneedbufferusbd_do_request_asyncin6_ifattachieee80211_get_addba_reqtcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4wsmouse_srcopsohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobeipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishem_copper_link_autonegbrgphy_copper_statustcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptyuserconf_cntdcphy_casr_crypto_wu_putE_abs_msgin_Useduvscom_methodsext2fs_inode_freedb_find_variablexscale_cache_clean_sizescsi_io_get_donebuf_objectucom_activateip6_rr_prunejmicron_setup_channelsbcompresssr_crypto_rw2iic_smbus_receive_bytepmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagescryptof_kqfilternclruheadscsi_move_doneural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockuvmspace_shareieee80211_node_leave_htrt_timer_addentropy_poolpci_get_capabilityieee80211_print_essidroute_usrreqdeextendspec_vopsieee80211_wep_encryptsr_raid6_openingsem_receive_checksumieee80211_recv_deauthsched_init_cpure_config_imtypetcp_dropicmpstatcom_irq_overrideudpctl_varsuvmpd_scansys_getrtablem_prependsoftraid_cainflateInit2_cd9660_pathconfin_pcbrehashpool_walksyncer_delaynore_resetre_tickin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleeppiix_setup_idetim_drvsreassignbufuhci_confdsiop_minphysip_freemoptionssr_meta_rwums_matchsohasoutofbandddb_initieee80211_release_nodesch_setup_channelbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4maxvnodesether_crc32_besiop_setuptablesinflateBackEndieee80211_add_ssidcpu_reset_addresspgfindatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwareswcr_compdecbwi_mac_lateattachral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumuaddr_free_rbtree_RB_INSERTnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spacemii_detachusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefvfs_lookupdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEnddevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapsr_hotplug_callbackscnioctlrt2560_startufs_vinitsys___tforksr_ccb_getehci_noopbwi_mac_fw_load_ivpool_primedevid_allocpgrphashtblrt2860_read_eepromifmedia_matchget_crc_tablestatclocksiop_ppr_msgaue_activatert2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writemaxcleanpagesuserconf_argbufatu_media_statusMD5Update_intm_tag_copyehci_idoneinflate_tablesiop_pci_attach_commonpci_io_finddb_value_of_namert2860_free_rx_ringpmap_l2ptp_ctordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelsr_raid0_intrmsdosfs_printkernel_pmap_storeem_write_eepromin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinituaddr_free_rbtree_RB_PREVeephy_initatu_switch_radiomsdosfs_readdirdead_ebadfbrgphy_attachusbd_interface_countobio_cawddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readieee80211_recv_eapol_key_reqicsphy_servicenull_setkeyrt2860_resumewi_send_packetigmp_sysctlin6mask64db_lbuf_startohci_rhsc_ableuipaq_activatesoftclockre_gmii_readregieee80211_node_freetc_initupdate_modifierreaddir_with_callbackffs1_compat_writeieee80211_amsdu_decapdb_breakpoints_insertedpdc203xx_dma_startblf_decryptswdevtdisk_lockuhci_initbwi_rf_gain_max_reachedarc4random_uniformsbwaithotplug_device_attachufs_reclaimkv_intrsafeem_access_phy_wakeup_reg_bmscsi_xsh_set_tr_alignsr_meta_opt_handlerrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrwsmouse_cafilt_logreadsysctl_rdquadbwi_mac_fw_inituvm_vnp_setsizevmcmdset_extendsr_sensors_refreshural_cadefault_product_descaes_key_wrap_set_key_wrap_onlyip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodbwi_mac_config_pspmap_proc_iflushext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachbwi_rf_off_11bgufs_mknodpciide_phison_productssbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreepci_device_foreachricohrtc_setcaldorenameatwi_ioctlrt3090_freqsugen_get_cdescffs_hashallocswstrategyuserconf_pnumehci_allocxbwi_plcp2ratescsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodssched_cost_prioritysys_getpgrpuplcom_detachuftdi_breakukbd_ioctliicprobewsonewconndb_fetch_regufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdoguvm_pagealloctcp_saveti6wdctimeoutHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdrt2860_switch_chanre_pci_devicesaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORnatsemi_pci_intruvm_map_vmspace_updatepciide_chansetupqsphy_ca