ELFa( 4 EF4 (   >>((DFffn / /;0&00Qd;0 2 @00Q8$/ // @ <  B00 RР -L @Ꜥf`lfmain() returned$l   ),@@(LQ 0/ᜀfl -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0P`U@ PU*00 ,*00" 4 ax0`\ \0@D P gXp00 9 P>>>>> -4!L01 M, P@0 J00eS4 Z0p , 0 Z 1!R,00 )  9P,00  @0S0 0@` V aH0o`P$ 0lP, 0 04>>>> - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `)pQP* 0 P(U:p p-QLM0@`  `<pQP* 0PXU:p p-QLM0@`  `7pQP* 0P\U:p p-QLM0@`  `pQP* 0 P,U:p -QLM@0 3;4; -(L  -(L  0-" _  P0L @ 00hS p-LM@ P` 000PY YR` cUpp p-LMP@`V0 pdp0H@ 0S' 000K  c 0H@ 0?' p-LM@` P?XP 0s UP(0S{p(00PS 0U 0 0 0P 0UPp -LM0pS 0S 00 47 q0P%PK% [)0S ) %0K ! [0@&@K& [)0S ) &0K xUUTT Z   Z8,0X12hZ(1,@0X 0KP0 0000S 00  000 000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU00000M> p-LM@`P)mp -2LM PR|2   Jh0S`2`h0 d0SL200l0S 2 2  B^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZxU00,0K,pK!0(@ *pK+KOjV D0< P202WU202" ,P2$00$0h0 ``|000P wXaf> X >j>` 4;Rj p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@P`l@p p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U L    ( ߂܂>j$4; -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|PP00 `0 0TF2 <?20;1$7234;4;<4;4;4; p-LM@8P@`4  00 00S p  0S > S 00p000 d`p 0 00  (000C0 5;@5;p5; -0`10#0LP8pJP@/ 00 0000  0 0, 0 004 P'`0 0@ 0  @0$ V0   H" ,# 5; -LM0p ` P_0ST  0 PE0 @ @00$00$0 00/A#bJiO_  i*  0 P(0 0S  0 Ph ,000i? YMb> -LM0` @2c1RP,p 00 P 00 0 (0000  dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph:W000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,aj5; M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`K 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,aj5; p-LMP0K`Pc @X_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@P(:w@T` O0Rj p-LM @00P $0`0$0 @R 0$ 0 00  0 wph\Rj -LM4@0S @440S -L M$X @R0  l0@ $@,} h&}5;5; - L  -LM /@q 0S@0 @BRj -LM@_ R000 1hu0 0-LPN,0@T 0U @T0Rj -L MPP@`x 0 0?<0040 000`000 0 T P 0 T 0 T 0w 0( `0 `o0S0 0 0 4w 0( 0 Y8;988;8;8;9; -L M0 p@ 0R , 00 QP X 0Uʼ00CXUP 0\ P Q,  P 020@ 00 ?@0S+ 00  0 <4<("4! < $ +0) *(@ 0 T 0 T0^,0S,0 P@0U20 0>0ʤ0 010 0 !  0?@?<0 0@0 0X0ʼ0U0U 0?0 pA 0\ ' Q0,0U0V0!  0W0T0 20 0 0100?<0 0 00[0S, P0U20 @0>0ʤ0 010 0 !  0?<0000 090@- @@P  @   0<4(<"4!̃ ,<,$,TW0U V0-  00  00 <4(<"4 !̃,<,$,TW0U V0@- @@P       0 00@ 0 0< 4( <"4,̃ ,<,$,TW0U V0<0S8<0y, -LM P0@ 05 $ Rڤiu0$ , `0t * 0: 0 ( x0 $ p@ 0p0 0 $000 T0$p000 $ p@ 0p0 $0 00c0p0" $;#;0c;#;P9; -LM0@ P `@ Q> >0q+ 00 0q l* l<, $4 ,<!$ 4.<$,,  a<4<!4", 0$0$0,$,!$#<0  ell!iFl0 $  aA-@0p 2 PU0(`, 01ll 0$( ,<4<!4"<0cP(0U@0 0 l0$,$,l0!$#,l(0l0a(0 !ll04 8< 0- L0@P0  < W0TU V 00005 $ 0S 0N0o0l0  0$0 05 T0$00C$00 0-0@L $000 PT $0P U@t0 $00 T00t9; p-LM@P$0B $C $P Uetp0R $0N $ PR` @R pJtp`Et 0N TpR07t0꠆9;9;9;9;:; 0-0@L $PP0 Td0 T0 p-L M1P`1 0 @@@s0Sf 0 0CBS]xP P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P sss0 000p`\XTPLHD@s<86;@6;D6;h6;p6;6;6;6;6;6;6;6;6;6;6; p-LM 0`P(@ ,Ta? np( -LM0)@:(Q( -0L !  <4<("4! 00, -L 0! < 4( <"4,< 01\ p-LM@1PU`KQ?U/SOτW p0x0 t DQTQLQ<>2 p-LM` 9ß@11,$,!$#<1@ZT 5:|S@00Y>0 0Y>0,$,!$#<@T 1  ß@T \?#/Z?B!Pd10h!l1WO WO R0000 0 &\P@$0SP\11@TPU0)(0S0>, \p0 0:(8% 0P80 ^ $ Vr00h 0 0,$,!$#<@0T @ 00" 0 0,$,!$@#<T00@ 00! 0 0,$,!$@#<T0pZ? 00|P@0!Y>!0@\T0 U P@h @P0|".@00|P!.@0|;̐9>9@:;9 -LDM0P $@T P '0S 0 , 0P 040 , 0400#0 0X0X0ST ! L 001P^ ,0S TQ0p0, \DH  0p0, \ q8 W 0 <#0! " p8 < nP Z XP 0, ,00C, \X R 8<<̟W@ 0  p00 ,@@ W   0SSp<@\ p`<\O \ L<\ @@ p40S40,0N0 $P9 #P# 4P 儒0 p 00 .V\nW 4  SlQnS 0 $`zQs $7nG B@=8 -n0, ,0@ @c, nW 0 !0 "$#(,<4<!4",dnb! 0"4#8,4m= mmm0, ,0@ @c, mw0; $000; TH ,p 4p D L 0p c8! 12cq 3 T0Tm 0Th:;:;:;;:;:;|;;;;;;;;;;<;H<;l<;<;<;<;=; =;D=;|=;=;=;=;>;>;<>;>;>;>;>;?;?;(?;8?;P?;p?;?;?;?;?;?; -L M p01 l!kMX@T T T 0,0 `V    (0S    $0 ( $ `V& V 000 Q    0ppoG(0S $ $0 (P,@>0 <\_0] ^ ,` 0 0" 0$ @ $ 4  P(0S]L1S/S0L1ppLq  $0 @( l0,0 0S0 0ml,@h 00S0cTb (T]0 00 '00S00 ppT0GG0E?;@; -LM`0p @P h@T0A`(@0S G/: cl0@; -LM4 Xl4u40$0KS80 00 , < <0Su8<00Q8 <0 4LQU @T00 4 0P1 0 00 PP0 #P#lTP40TQU @T0040X10  00 PP0 lTP0PU+ $0  0$0@, 0X0  xk 0p0CS00 00 , k R0000 0P pTp0 1`V0@00 0 / TʄQU 00 PP0 對 k@Y<0 0S40$[ 00<48000<0 4$JTx@;@;@;@;A;$A; -LM 0` 0p0 岠߻, DQQU R0000 0l  @MKX 00A0S 8P 0 0  $0, `< ,<00,$,!$#  < $ _0] ^\0 ! Ÿ @  $0@P n(0S    $0  (08000U00 PP00S000@,0@T  02 0 R T ,S00 ,0S 00`S _]0 R00   00S  #@D%Tj, 00j< ~P 000 8<0*P8T 0@@T 0Z  x  LA;tA;@:;A; -L M 8q ($ P, 0 0LQp81pU  0 !01 R PY0 R0TQ00  , R  0T0 0S $00` `1S `VV 0(`S 'W ʇ0(@ P@ p'W(W V000S 00  0 "000`  >A; p-LM@`lI0 |0< ziٹPJ$00$0ph駹A; -L000,$,!$#  (  4B C@A00! 0GDE0F000,$,!$#  (  4J HKI000,$,!$#  (  4R SPQ000! e0f0gd0< 0  < 0 0,$,!$#̂ , ,,4_ \ ] ^ kjhi00,0,$,!$# , < $ `a bc0011,$,!$#<1P0@ 8 4A=380600 4E=380800D D "4I=380800L L "4"8M=380800X"0,$,!$0#<10("0>,$0,!$#<>10!0?,$0,!$#<?10!>,$,!$# 10\00 @H00  @ 0 0@ 0P@0a SP >> >dB;B;B;B;0C; p-LMd1h! 0SP`*\aWV R0000 0 p )P`2 9$A.d111,$,!$#<1 P 00d!?,$,0!$#<? 1d1 0 d10d1pd! 0!0@0|80d!@0 !?\pl9> -0L`pP@4@P@' PUU1 l1P0l1@1 R 0S @0  R0Z 6PU0ma< 4 80 4! ke hC; 0- 80,#@L(Pr 80,#(i0h5 -LMP0p @Rp8`d 0Si:l!40b0C02#1 h1h1$0CRZ*d!=dP!8d!A'2d A-d10C0  d10d1 0 ( h1$ C h!P%h111,$,!$#<1#Ph1 ! h100P0 m$0!00|9 -LM0PpUA00 `0V Sd 480W`08 @08  800el1`0Cl1 -L,MДЄP }?:p, 4 K4KHKP`0 e,0 S h,IO DKF7[w(4eX ;7 40P5$ v $! 0- 1( 00!=P@K w  w  /3#`+=#`003#003 #3`#`d00|3t#t3`/05K$KPD3[<3  03Q }Qj +>4K2 KP4[S:0:z  ,<Ey $T6P2"#K <K#KP2[t2\# P6K 00 Q0N@0"02* 0* 0**  1 1 1 1 *   ? 'td:l!0:0\/0T!' 0l* 0g**   0[* 0U* 0O** 0H**ꀖj!HE;lE;xE;E;!_eNa!'(j) 0* 0x** d 0)^ 0)* 0)* 0) 0)* ; $0)5 0<)* 0T)* 0) 0b)*  0) 0)* 0)*  0) 0")* 0)*2 H2@ \`0ð*:\2\:0ð:d2Qh22 P0ð*:Š2 P:0ð:Ŵ2 o2*2@ Q2}>ø:2* 2R 2R* * < :0:3#Q: ; -*8 L#8 $ʐ R2 d X -*8 L#8 $ʐ R4 h X -LM:`0 5Rʖ R2 d 0X JR4 h 2Xxrʐ R2 d 0X :R0 ` (ʖ 0R4 h  X2Xo_  :R" D ( ʖR@4 h 0XH:$HT@ 0  `1ʖ R4 h :X41ʖ R2 d $1X<1S0ʖ R4 h 0X0ʖ R4 h 0X ʖR4 h 0X  ʖR4 h 0Xp -40Lʐ 0R (  -LLME0 P5p 0Rp5 Rx ᪐P` 1 P0P@ D@0@ P <C4SL S ^b- 0@0 0S 6S dIbx<@0 S#($0 P@ @<P3 R3Q  # x0SDl0KP6[5[ "P`~ k1w  Y00C b b2 R 6[* R^  R[ $[Qa "0. Pp 0 @`"0S 5[  H20S S $2 RlK |P|> 0k@  D P 8mx  0 @a>  D0⃑ $[Q>K  38K 3 *K 3 0 0D P x0P@ 8 Rx간[>0Sڼ6[ Ua  lK20 <0 < P 8 P=a<00 0lK t! !E;E; F;@F;hF;F;@-05;505 @0 @0  p-0LM`az <0@@5K p]L0,0P@@)T  ph`>!F; -LMA0P 00K  "[D10R8 = R 3[pCX#ymW$`ʕ   20K#0ʕ R8 p (K#[0 R3K#[101pW z0 008@ L@H0[]= 0   !| -JL@DtpP ʗ (0  @DϲtTeaʗ 8R  #8X JR8  #8X 0ZR8  #8Xʗ 8#8 XA ʗR0 ` (0P@D␲tT8< 0` :R  (ʗ 0R4 h  X0X  8 _F;,G; p-0L M PR`0 PEu @0@0 0S PE=uU:0:"d3`01K02K01K80 K p,_p:P!TG; 0-0L PR :*$@ʕ<<*0Tʕ@*0T0h0 -2L M @RP 2R 2R 200!P 80Plr: R8 p (0 hVu :R8 p (0 Pe`\0  R L8 p [0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0ASL X ` h p x  0P 0S0S` (PK?2K02K]< <0(PK U !*D !#(( -L8MP`? Q 3\ 3P [2P7  80Pp.؂ʖ R8 p 0X JR08 p X0\  R L8 p {ZP2 Hp0P0""K0 2K"K 2 R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kl!@0p2PTKPK&/U?G  K5K/0 Pp@W 0"K0C "K S$ 8 @ D H P X D D D ` 0[,PK2KX0000000S>L0,PK0K2K !!(  #! 6S-L@p6 8S `,Pʔ0S8 #8X0ʔS8  #8X|Pt0ʔ R (0  PEuU< ] `hG; p-LM@80PP`0 ( R8 p NYp -LMPp60 P a 0? R6 l `Y ʕR6 l 0X JR6 l 0X 60mP@ :R6 l (P0 S :R6 l ( 0 S4xV -|1LMp00  @PHQJDaʔ R0 ` (0PEkuU4 :R" D (  ʔR4 h 0X 60Po?PPl0ʔ R6 l 0XP?U< \ !G; -LdM⌐Kd ?.108K0p8K05 -8BTP @ 00`W cG0S P".Tp`@00X 8K0 5<5 d .0 ! p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 `T2R L2RD2@@w vx@0 - -1R 1R 1R111R 1Rv -11w /1RM !ʄ1R x1R p1Rh1>\1R T1RL1@@1 @ 01 (1$1R" 1R 1R10 0R 0R} R0`y Q0u [p 0 D 0v 0     -%* C  G;  -LLM]p@\ ` :h l  0` \0P`屫(=T =T=T* =T G=T <T h\ lQ `匫ZP \ hOP\1S $ /h \0h0 hP5 <  ;T> ;T 2 = S! =@S <  8C8::  < R h; 2KK"K(<0K : ; R ;2K03KK@ 3 505\ 0S ;  z;  \劑qhPk \p t \l4P`5@[ \:T ':T :T=hPD o \0h *h.P+ h0 &\ 9. @RE\0S\(|9T2 $p9TP9 R0\:!  $)000?K2K 9"K 0K8T[P \ hQP@ <  \0h ()hR.Ph \ H8P* Y8PP  P  P H 0hP hP5 0 h0 y7P7 Q7 P! |7R 7R l7R l7R P7R\:  :  :{ :@w :s hp7l6P 6P 66P 07P87 RX$7 R 7  h#7 @T&0BhPH6 RD 52@ 6 R5  g 5h 0h)0 0 \6  hP5vM@U   S90% ?A1c バბ L90v 2c0H%a0%0 % 5Ta 5TY*5TR "4T 4T \  0 4h 0h,5  hP\0h 3x4T$ p4T  \h $h0-P5@ x4 R hI P\ hH$-t. \0 \ \ U3T 3T^ (3T3 R\:    ,h h03  hPch2 R \ 101Z2TV5 2 R#  2h 0h,2  hP=h0 S9 !q hl  \ l! \w ! !->hP+ !V \0l l! ,Pl  Q10Slw@% w]P  @X`K@&@)@d1@5KEK A%K RK) 5 0 lw@ BPl0  0T C0T- li2i 1i iii i i i i i i i i8-%C> gfffG;i i iiiB5i i i i i i Ai86i(i| 8171 !D0T`Ph0 R  T 0h 0h,t0  R |0  hPdh0Sa >\0 d  h00iZV\0|SR:Vp h  pPf @|9)0 p0 |2 px20@R0S@00 $) %05<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0p 2BPx00x0\d | +P\ 000hd0 |0 iZd0  |0R*V   | `Bh0 ]  (0h20k \ $ \0h 8#h:+Ph0 Sh3 RM  R 3R 3  hh 3 ᳠ᴠh y $T (h0+4R% 4R P hDv( hD s(T4RT4 RlDh ] 10h04h 峠0㴠0h0$0h0S00  4h 0h4,  hPh0\0C Aܦ 0-M0LM PcR  0 R :AKA A 8v ;/0  00 {V|0|@x0 Kp ̠0KPT0K v R<0< CaE60G;!>gfff -LQM: `! 0㥦d 5@R7য়0 3K?3K#K<K ?;'K4K DK$K 074K04KLKK `7 0%K5K?5KTK 474'5K K%K\K  7 '6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK: @texvPK@&@`'@wmT6@`@K KK;KKU' 0@T 5 R- 0S R' UAoK@@@&@7'@Kv  .@`' 04xK3K0O &0K & 4K84 R 5 pp4( K-K00QK3 :F+=PCP 0nK0  P+`!0*  P:`! *ndF5z @05%p3+%<a4<T0T((3( K$S0BSKR/K00"2(K UK >K 0 2"#00  2P 0S P W_KVoK l2 0d0`2(K!0p<2<"Q1 "W_K(KVoK01( KOKN/K00 0JPK&@&@,1@K@ =KMKK & 0`10K8KKK 0010!8K 0(K8K 0K:|10/K7K'K 0|K:l !   : >G; H; "  *! -  -LGMA0Sp!, 000Y 1 Rx10 S<0K $8K $18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[90K 5K# <L$0 B@!$[H4[Q04KD 0  0000 <  L@ B0 DPp 0 P0 0C0 0 c0 R 0 R 5[ -L\M4@KP "03K2K [ R 0 S  R R2  2  | pb0S  "\23K@2K 2[[3K2[K3K "2qK3K0"[2[b1!1[!12āP/ 1Q# 1!1nnDF`d N`<p1Qc[S[s[ϠNP!l H 0@P["[2[P ! 1QQd@K&L"0 6K06KP`0[@S^0[.S[0[-SX0[S_[]0[\ [ac 1Z[1!!21Y [00:C5>C  0!9TI; QhhI;K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽   000000000 !D -ML M:BKI0 I| 000CSu  D )0T p0S^XPpڴ8! #  1  P`C P`=04H8( K81BNK0!@@D(0K 1  P`# qP`8 0(K 0$!  0  P`   XP` 8L0  @ T "P`@ ! p-LM:̀@ ( 0 P `  000  0S`V@PpR 0 S#P ppp l -<0(,0L0  !0 0   p-QLMPC  R:`:: :-::`000 0P@ V p-0S`+s է 00b=C4`#ht0  1> 0P@8p-0 $N: `p!8I; 0-LM:@+P"0 00> Ph0ʔ R  ( P 0,0B=C1: 0000-0! R-L ( 0 0C SE ` ` ` ` ` ` `  ` 8 D ` ` ` h 0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 40!!!!!!!!!!!!!! 0-LM0@PShL L @ | l t L h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0@ @P!!!!!!!!!!!!!!! p-LMP\` 0@S0\0S pD  d B 0000 0-P@0@@L +00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S /0jI; 0-8{MLP @t0 R 0s? X0  @0p  R0Z0x0 20h%, >L  I; -8Ll(PᝏL@6`p"`0     밠  LJ; -8Ll(PᝏL@6`p"`0     |밠 K4J; -LM8{mp `;s/000)+@T +8#@0SP4U@0H:i@T h@ 2 @TZK KPJ;8D>pJ; -LM{] P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  o錛7+00 1+ 8`   1R010000 0 !0*0!00 0@@"  +` K 8` 101! R00:`  J>J;J; p-LM0@{]Q PR0000 0` !*!0S00@@@P2 ph 0 Ca*>gfff p-LMC0IDP{m@D* `D20u? @$ R00000   R 0 0 0 @P 10C1p -LM0@P!-0  t0 a1a2cP  0Q P 0S!0S~H -SLM{]` 0 P ʴ8 I0N0  0A 0  pK0K@K @0 SK 0K@ PZ Pp 3• )P P; (3 p,\PH2   OC  ? ;,6 0Z $ Ӳpڨ K0 K&  II(2 R R# R (pZ (p@P 0  @K!1@RTں1010@0(p@0S @@00K@Tڴ( FI( P@<0 RQ1ᴠ01(s? ( pj!0R ʴ8 す @pSWI(pUHI  0( I J;>K;DK; tK;K;K; -LDM`{MS, P` d0 @+ھ00 S0 Lh `0 d dpK [K!`K 0 P\K`K  80KPp 8\0[ R 82 ,0S ,,w͆ 0\[ Hw j3PoPP 1 8K jPrh  p0S#< 8 /L@1̆6 _`    `0h `K `0`0 p` 0`0 1岐`00`0 p& jhYH8 <SH01 R' h0 h  0S !ᴓ 8 0 12  (8p3H!8 8 h 8ppH8 XHIRO0 B`0 d )jK;K; L; TL;>|L;L;L; M;0M; 0-S@P{ L 0P $8 G0TM; 0-S@P{ L 0P 1 08 G0|M; -8L`@P80   -0@0PL`0 鵗pP@ 100" '';0 s>> -LM`{} P@0 p 5 u  G 0R 5  G 0R 1Sc, P` 15  ,( 8F01— &03,0`1[P! ʚ; -LMd8`@T5{],  Pp 45Q (5Q] 35Q xFp,0 S ,)`K PpŖ*P@ !+K3;K#+K3 ;K:00Kp ᆖpTPp@K [Pp㛖P@ 1 b  1+PpĀK 2PprP@p !P3R pôf+[03!"@ %3Qk a:3QspL@TP 0|S:?0 K|o K  K  2&K0 6K34K3U K#4V0K3f K4K:00 f0Ke K:0 f0[h K0  f0K:0 f0[h K0  f0K:0 f0[h K0  f0KK| 8PpL0|P00@TE  |0R*@s?K "pPp K Pps =[ 0 K Pp10 ȕ@TP! 0S:`K 3i i| @-0S:0<0@ 000CS ! !H ! ! ! ! ! ! !l ! ! ! ! ! ! ! ! ! ! ! !:00:0^0: < : :0;S:0< 0R:00<0:0< 0R:00:0 0:0< -LM@D 7D0PS/  S S S hDhD0S @SS ʀS Sd`S SLHD@<hDdN;N;N;N;N;N;N;N;N;O; O;O; O;4O;DO; p-LM@ 0S0`5 P 3 804$80040P Tdؖ804P $80040P Tǖ804P $8040P Td㷖Pp804P $8040 -Lp@`Y804P $80040P Td㏖804P $08#h80P 4$8040P TduP` -LMP`8@RK4 P p$08<<40P TdTU'&@K804P $80004P T 804P $800P 4T0"[PU 804P $8040P T p-QLM@ plR 848` \`804` ,PUd`VV  p C804$pP; 0-8L#88P841` \ו@84` ,0Sd@ʕTT 00hRC(P; -LM`@Pᩓ"$1Rp  8#xtUT"TTb@ T  )Cad@804 ("|0 xRbT{x'xMT f@T XT84 $0pj@h@t@P; -LMP`p@Q0Q  0miVT!!!! !!!\0b Q{884#8X (Bd f h j t@P; -LM80`P 4, D ,, 5 p 8@4 0D \84 0\8@4 0\84 0\8@04 \,0RU@ P  C-0S, p5<5W  P 0@ 0U@pPW8 04D \2 S &S S 840 \8@4 0 < 48@( <"44)< \<48@<("44(<S S 0-80PL4D ,P@58 04D \0 0-L84@7 0TP n8047 $ PUU 84 0T0A\P; -L$M0`p3K02:K 0#[78@KR02 0PPU0PK S00[S/0[S 804@ ,@7@'0S24747 8 d9d9@0;%N)),7 2ƟP  0RSX} !(AR  A,< Q<,7s>@ 0s0@ @ ,0,PpW,7 0p0p  0 Pp),7< '2 PpPO,'< B@ll5  PPp@?U<%>@0 0 0@ @ ,,Pp<%X)4  4Pp$D <%=p0p  0 Pp<@D)`4 PMpP@<@  0P Pp@M?U xP`+3PP5#3$! 1#30!(1"3R3 0@0 @1  3#23@"2t#t3R? 0̠pBT  8@" 05"^i@P1DPQ=?U<0@$<0@<0D\"8<0X) 0@?P@QPUZ<0$<0,'<0 "8<0<' 0<0<0 9@ 4@ /@ *@&@ t!@ d@ T@ D@!8@.0[SP-0[SM,0[SJ+0[SGpW  +0[ 0+0K:804 ,@ 804,00)|t?9xP;P;*5! /!D7!0!(!!4!,!4!4!P;P;P;P;$Q;HQ;tQ;Q;Q;Q; R;8R;RjRj -RLPM , 0 40p0u 0"0  0,0 180 D<1 P4 ><(0SS(0, DbSB(0@S5T*80@W40, 0,00@0?R4 A @<(0SA@<(0S40@ 0 0(0@ 0 0(]?00S*n 0@ 0 0( 0@ 0 0(< $0 4 (<XmP0  m0 10P|m7PR; 0-LM,'P" @0?  RC0Z<(0S,7(G$7GG0 $0  ( 0-LP+D @ 67P@ ?T0\9H9`90 -L MPHP, Ȑ<B(0DiS(0`SV -Pp5LP`804> (p H$ T,00S 00S    [`/`(`I`V <1S(84> 0X{@ -L$M$7, S`0 D ,  0 D D 0 <0 2?H0 , 3 P@,( 04 *S@ D00@ 40 $740CQ@î<(0S(X 8 < 0< G(0 rSP(0@ST 0 1,  0 D04@,7X0CBAZ0AAXB< @<(0SZ,o(0X@ R ǖ P@),0;0 ,,'0D+0c B0Z B B@<(0S-< ,J 78"!"<(0S, H <004  $7(0b$7000  ?#=?0 c 80"00 0(0 0 0(0 0 0( H<X,h 7<@"(0HS0 X7@<0 $(0 0 0(P 0 0 0( @1X8@4L 0\"1R88T ;X ;44\"0R 84 0XhIT k804R $80 040R T% @ %5;5ފ@0I 840@ xt{?>k 0-@LPk20" 0 -LMP@`؊Pp 0P ᥊1TM1T7*1T# 1T %!8 @ 3A8#  @ 8C83% @ b505%@ 0 Rp 4P5@ a6t0T h0T-P0P\0S\80T/02i 1i i i 5i i 6i( -LP`Pp@9 0@LhR; p-LM`@PU Y5=51k847 0T8@4< 0X84> 0X\ P$@?P3SPU@Z@?P@7SPU@Zp<0D$@jh0@7<0$`h03\h\Y`Y Q-L@0 ?-#@S?Zc?!NP  ARNO`PO_P`` ??CS0cS@  p-LM@ 0PT 0T` $8  `$VpVp p-LM0 00 PU`00S PU@ 0@ 08P<Tlvpaf;!@lf -LP@NTp` T 0@`(R 8S h - LMş0 0 P)((, @4 c0qW_ 8PPT p\5\% 0 l[   0 0S00 p0 00 ҈h 4 Ɉ, 0S 0Sp) `p$4`P@ p  0Sp0 p0 !>!TA!p?!p?!p?!p?!p?!p?!p?!p?!p?!dA! 0T 0T 0T 0T 0T0& 0 KSӇR^ 0 TdG $ 0Td: $0S7  $  $0  0 00 T 00 T $0 0 9S0p00 p00p080 T $8 80 T  @0{K

$L!LH!7>7>+>>> -0LM A8P4pp0`  0  h0 "㗇p0   0000TD0< p0 0p0 VR>7>> -04Pp@0`0L0 8@T0 T0  0 0; 0 Td\ $dU 0TP P 0P 0 TT 0T 0T 0TT -0L040 0 T -(0L180h2>7> -(0L180h2 >7>0 18>00 S00 -L MŸa8@4h, Ÿ删ŒpPP0 TPH2W .<2W& 02W 0 00, 0 ,T1W 1W0 @00, 0 0 @00 01WI 91W |1W@P 0@ @@@@@@0 @@9@S@@ @ LD,  ,0 @$@@0W 0W000W0 0Q0 0 000000>7>]t@yt xt zt {t ktjt@\tltmt -L M#l00Q(@0 P4, $0S S 0, R@pp  Rp  Rp   p0p00 pSp 0S $0R 0 0R0 p0 H`|2|"]|0P0C@|0p00, T0 0, T0 B40, T,0 T0,000 T0 0SH $0KS,0Ӂ0 T0004 0) 00$0(  0 9S0 &6R h0(!"P C0 ,000 T00, T 00, T$0KS!0ӡ0, T,0 , 00,000 TB>S;7> -LDMP1l  , A4`pp  |0Sڗ0 ل ,0S L,000 T0 0 >HQ3Q Hp 0p00 0 H0S H]00 lK H ^@TP0 @TT000 T0Hp0 Hj> S; -LM@㟄p0  0p0q p-L M@㏄0pPt`x0p0t0a880V @U 0@@3p,<7>> -L M`84@P㈠ $8 ,    $W  $P\  p %0  ,p\P+0  , 0  , p0 0p0| R,0H& , h0"2  $ h0!20, h0!,2P0 000 Tlp P嚃0 0SA 0m  $ 0@.0U:x t0 0Rt0x  $P|0Ta0U, 0 0 000 TD0 R 000 0pp0b7>>h6> -LP `?p $  $ @$@ -LMP`p}N $0 @T 0 T00 0 }N $0 @T iɂ -LMP `p@ 0T@0DD @T0 T 0T 0T 0T0 T $i醂 p-L M0 K `0  PP p@ T \0\@PU HPH0 0Q S00 4 0RjfRj@lf;! p-LMt`t0lP P0P@HH D0 0S0b$0@p0RjRjRjRj >RjS; -LM⌠@p` 0PU 0 =@@0@ <040@, ,0`pRj>`ujRjRj>Rj> 0 RjRj0 0 RjRj 0-@L 04 00P0 T0hɁ -@㈠4p@  0LT5 QK  $  0P T  0T0  T 0Tdʃ R  R  0 T R R%Z![![![![![!\!\!<\!?10^ 0 S0 00 0 T  $0@  T@0  T0@ 0Tß#00 S Q0Q3 r 1T <  nPl 8S080mB0$04 40 Q000000Q 0000@ 00 x  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0:0  T  $0 0R0  T!0  T  $P  0T  0T $ 0  $ P P0 00  0P000 |嚂0 @0 0 \.T.Rj4S;f;!@lf`ujDS;HN!LD!N!TS;hS;|S;S;S;S;S;T;Rj'$T;@T; -LM0`4P@ 0T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 ,@T *d'p}N $0 @T 0S\ /pT  $0PPpT WdT; -0`LM:0|:P ` @ [: ,O 4h/I2뭎0*  [/0 P0p-]P P  PN@ P P i0P702H70X'T7   PO'PN>U0@1!51(!$1!1 01 !( ` }&1(71!021,"x!(2|' X0@0`t<<T1TL1LH18|<@@!0P (TP   . . .I FC@ . . . .p!p!P; T;x99@!!d! !Hp!ܥ!pq!q!T*Xp!t 6 z 2>!(!T;T;U;0U;TU;xU;U; 0-PL 0@& P -0MLP 0(0$000,0 ʐ bp0 0 0 P@Wʗ,0K00 *,P@LFʗ00,  04P@7ʗ 0 P@* 0 0,   P! T`0ʗ0 0 0 P@ ` X<-^- @U;U;V;(V;LV;lV; -LM0 R0 , '4 40q00` 000 0R4 B 4 ,0 Z(0S$$u\00 R,0ʓ(0S0,0 0(0$000 $0 ($0 (, Z -LM0pS Z(0SI$ ʙ " 8: 0@T3 0Z o`0S Z (0S$\0Q 00Z@@:$0 (Z $0 (Z -0L,M0  $0 0(0ʐ0`【 R0p`  0 P@ʘ,0K00` ` *,P@|ʘ00 `,  04P@Dʘ 0A P@r a0,   Pj 04@ TMD@ D0+4@ `0ʘ`4 0 <  D D0@<"0T  8 D0 PHZP A Z;!6 ʘ@ @ P@"<8 400@S 0, ""4"0 ʘ(0S $0 (PY,A4Q, @$ U;U;V;(V;lV;V;V;V;LV; p-LM0PU@` 2 0P 1 Uʖ(0S0(0$0 0p $0 ( -LM0pS Z(0SG$ ʙ " 8: 0@T1 0Z ok`0S Z (0S$Z Q0Z@@:$0 (Z $0 (Zv -LM@e%4P 5A0AS  0-0@L{X7PS 0h{^Fq/ ( p-LMP0@{T7`S@ I{(0phX p!> -LM@q 'W0CQ  T 00HSAQ B00HSʸ -LMp`N @⫎, XWV S Z Pr!r!r!r!r!U  , xʗ8 0\  7l` @181a 7lS 7lN T'GR s   # T'RR SP$  P  T'R R 7s  Y <0 dT'*7>gfffV; -:JLPT 0p \%}ʕT 0\}ʕT 0\}ʕT 0\ }ʕT 0\}ʕT 0\|ʕT 0\|ʕT 0\|ʕT 0\|ʕT 0\|:T , ``WFʕ@A0T \|ʕ@0T \|`VZʕT 0\|p`ʕ0T \|:T ,J, Ƈ ȠT 0,x\|`VZʕT 0\|ʕT 0\w|ʕT 0\n|ʕT 0\e| -L M:pV/,:!c 2Q,0 8 Z (0bS 00@T  L \  Q00P,     """Ƞ J( R  1?1c0A,0 Qʗ` 0\ + ,(  ,$, $!,"̠"" (ꫪ* -L Mʐ`0Ⱀ;(0*BQqP0@48 ,  0S~z!{!{!{!T{!{!{!{!{!{!{!{!{!{!{!{!{!! !0@ʖ(0S8 $@W @3G@ 048< "0""(0 ʖ(0S +x 2?1c0"BA++0  0"00(ʖ $0 (ʖ!1 01! 0@!1 01! 0@K 00K@0  $( ,h( 0@ *5 ;5o0 0 00(Nꫪ*W; -LMʐ`08;(0$(+BQqPs0 48,b` 0S4}!}!}!}!4}!}!}!}!4}!}!}!}!}!}!}!}!}! h $(,z(ʖ(0S6 $@@W @tF@ 048< "0""(0 ʖ(0S 8;00/". 0bA08;8+0  0"00(ʖ $0 (ʖ *5 ;5m0 0 00(DW; -LGM0ʘ,0 ( ,;$c+241 R0001 } ^P8 0E@ 0 0 u,0E0000ʘ(0S+4 ?=0 cR+0!<1S 5  h2 ,0S `, K+0 "0 00(:D ,:@@ ,PP 0%%l%H 0$Q 0<0 \K 1 0 cʕ04+` 0\1 ,0S , $0  (ʕ(0S 4+0 "0 00(0p 07!$ 7KK ,4 0\0 $ <0 K 1    0-0 5:LS@C\0ʂ5 0hH( 0P@ 0@I; -LMP@`p|1T0p! Gd1T2 \1T  7p4W p5A0AS p505 0S 5 @ @  W X74PpT7S5A0ASL00S@0T  Y4Pp i i i ϖ1i -L@p`Pʔ ,0  PrcUdU ʔ49 \h X; 0-P:Lʐ)0 \@: ,  @ ]rcT000X; -LPp`@ʕ ,0S@@rcTdT $ʕ&01%3 \1{hPX; -L M0 3PP8 3 #0Pp1p#Sꬠ!P!!ܡ!!!"2 1 #@ T7S X7S FyZ  FNq: ,,"(2 1 #)D ~!Z -!t1 1 n#@ !g1 aC0I D@]xq XZ  -RP!NP1` H DZ } ,p !:1 1 4#)D .0 Z 0 A0 !` P \ 0@ #)D  T0U000  89p9999P999 -<0LM @R ;);@ h p-LMʐ@0`8 0\7Z#20 \ʔ4 0\T7ʔS;=8.\T7ZSM0 08 \p 0-LʐPO/00@\D-0ʕ\JQ/x0\ʕd0R/\0ʕ-D0\JQ/,0\ʕ0p8 8  T7 S:0: -0L0D'pj@P PW, ocTdTDP@p  @TP 9X; -`L:0*R0:ʖ#0h \J:l \ʖ ;t \JT;p \ʖ;x \J|"0 \ʖ; \HR@pʖ!0@\TPxO0 7}ʖ1 \ =ʖ 0\J 0\WPB'l 7lqT Q 5QN n   ʖ0 \: ,ʖ ,J 0\ʖ 0\5;5%@ %T7 S  (P:9 000 9SX; -pPZ50@=L5`U (ʗ` 0\J 0\ʗ 0\J0 \ʗ 0\J 0\ - JV *R ::0: -`L@kVp0P Vhk:S 5 :S5@ %0o -0` L|:*   0@:*,pW@mTT 3 0 hPN P0@PUڽN P@ GP0P7 2T'"XH700CSc  PO]PN>U0@ڄ2"52(!$1x"x2 01 !( `@L2(7D2D"02@2,"x4"(20V X0@0<@=25͠10=!0PD PH     b$POP=@U0@CNdP@P=U0@ONP @P=U0@o ^BPUJ02N:PU0@DZ K  FB@!!P; X;x99!!@!!!!!X!T*!  2>""T;T;h9U; Y;0Y;TY; p-LM` /0@+cH PDQNPPU0@Z<p ;2> -0MLP 0,0(0$0 ʐp!ba0 0 P@Xʘ,0K00 *,P@PGʘ00 ,  04P@8ʘ 0 P@+ ;0,   uP" T`ʘ0 0  0 P@ `Z<z^r @U;U;V;(V;LV;lV; -LM0Y, ( 0 4 p00 `0S40@8040  ,0 Z(0S&00$H00 000 0Y,0ʓ(0S0$0 0,0(0 $0 (00$0 (,0Z -LM0pS Z(0SI$ ʙ!b! 8: 0@T3 0Z oo`0S Z (0S$G0Q 00Z@@:$0 (Z $0 (Z -0L,M0  $0 0ʐp0`S0`  0 P@ʗ,0K00` ` *,P@pʗ00`,  04P@8|ʗ 0A P@o 0 0,   :Pf 004@ TI4們@ `0ʗ`0 <  4 40@<#0T8 40 PHXFPA F;!6 ʗ@ @ P@"< 8004@@@@ ^ 0, ""4"0 ʗ(0S $0 (P 94 @$ U;U;V;(V;lV;V;V;V;LV; -LM0@Q 0#0Qʐ(0S0 0$0 $0 ( -LM0S Z(0SE$ ʙ# 8: 0@T0 0Zoq`0S Z (0S$TFQ0Z@@:$0 (Z $0 (Zv 7 -LM@4P 5A0AS 0-0@LgX7PS 0hwg 2q/  p-LM@0PgT7`S`  5<0< Xg00ph0!> -LM@q W0CQ  T 00HSAQ B00HSʸ -LM`N @~pXWZ !!L!L!`!U   x:4!,ʖ04!\7l^ 00a7lQ 7lL T'GR F    # T'RR R R 0<^ H0,rtT'T'd0>gfff -:JLP$#0p \hʕ"0\hʕ"0\hʕ"0\hʕ" 0\hʕd"0\hʕ@" 0\hʕ"0\hʕ!0\hʕ!0\h:!, ``WFʕ@A0|!\thʕ@0T!\jh`VZʕ,!0\_hp`ʕ0 \Th: ,J, Ƈ Ƞ 0,x\@h`VZʕ 0\5hʕ` 0\,hʕ< 0\#hʕ 0\hp4 -Lp0⸠:H!,F 40S02Ю^ҽ^,0 0aQ 00& S 0@3, 0 R0C, 0,!1 01! 0@1011 010@ *5;5mS0W; -LM`, ,(0J( 1cqR 80P0 N 048< 4 CA ,0J(0S1$0 C4000 48< "0""(0 , J(0S80(0 0S(040(0( !b!( $0(,J( -LKM0ʘ0 ,0 00! @1 H ,(0\AcSp'0 48<  @<D1 , @ 0@ 048<0#,## 0ʘ(0S <0/"-? 0b < ,0 0#@0(ʘBP4 B41 ʘ(0S $4D ʘ0 ;P< {4 8 ,0# #$# 00 048<#8:#:0 0,R801j 04Y;W; -LQM0 81 , 08H1 02>@L 4! <1 0PT H0!0@41q 8'020?0P1 PT7^SP  6 TT D7 PQ Qd7SP T!S T! T10 4Pl0   X &DgPP @ <@T@HP$Hm X   &0 008#HH 7P`Q <0&>Lş,0 S L,D`_4000|_4D X1 0T,00\8(  0@ ʚ(0S<$0 0/- 0b0&=00A 0ʚD 0!0P@0H F  @0= =  $0  (ʚ(0S <0$ !b0! 80(0<7 64[? L@L N41 0X0@  P0 0H %jN W;Y;04W; -LM5p=@S`0P  GT$ ;S0S7 770C7 $ P $ ,P0:05 㞾5;5X7S4AT ;S0S8141<1<0CP<1"$ K0P@ P$ 0P $Q0P@ + c _ 0-0 5:LS@C\0ʂ5 0h(r  0P@ 0@I; -LMP@`]|1T0p! Gd1T2 \1T  P$p4W ]5A0AS p505 0S 5 @ @ $ C  $4PpT7S5A0ASL00S@0T  !4Pp i i i ϖ1i -L@`pPʔd ,0 PS_cUdU ʔ048 \ h 0X; p-LM@`Pʔ ,0 P,_cUdU ʔ49p \P:T ,0P _cU( pp p00X; -LPp`@ʕt ,0S@^cTdT $ʕ&014 \1(| hk 0PX; -:ZLH!,`p ,$HGHT0!, ʖ\J0 \ -L@nM`j:P-,ʔp8`-\P . M*ʔ0-\ 0-:PLL ,0@l0ʕ  0\0P0 -LM:@8 ,t7ʔ0 \P0 -wLQ@ 0 Q0 >ʐ 0 \ʐT0 -LM0HP,@p ,`P XP(8`` <SR <S 0 P`1  ` h  <S  <S K V X # a b:-,0(ʔ((0-\0   , -LMp0<2P00P  R22P@ R`  0@ Sa1 0\E,0BBPCJR0CT: Q  V@Aت   XLa {0 %uw] o k   e0 %_a] Y U  P0 %J l 0SS Y  ^0 o4] 998 p-LM 0@j4P8 <0 \ 0ʕ48 \p00 p-LM 0@j4P8 <0 \ 0ʕ48 \p0 0 0-:PL-,0@5 ʕ0-\0T7 S:0: 0-Lt7ʐ@0 P P,ʔ00 \0$0@P$!4! l0 \PK  @ : @@yʖ0 +00tJ0 t5p0 R W0D'S1#600T7S7,NZ; 0-0PT'LR@p0p  ʐ\:P ,7T'42ʔR 887 \0h0d0:  <Q QJ@QZ@@@<Q QV@Qd@ -`L@VVp0P VhsV5:*0R: 5 :S5@ &0 -0`L M |:*   s0@ʖ*,0Ss 0@`XcTdT PL3 @888#8"($ @^pPPI_pWFM,@PP2 2R   0T72l"PXH70SSW d {P vPOPN>U0@v> " 2%"(1$!2" 1 0!( `X ᏼ 1!,21(4210"@2!1<" x!(2 8  X04@0͠0 01!xx!= P#LqP@@APO-0U p 5pW J111N@pWIODZ    <","!P;!!!Z;`(!x99T"X9"6"8"",D"HE"@I"$G"p"T*"676.7h9ة9Z;U;0Y;TY; p-LM` 0@3N@PPUIOZF,p -LMʐ`p 0P0 0p   P@ Aʕ$0K 00p p  ,P@/ʕ$  ;4P@"ʕ ; P@+ ʕ(0S ,000 0 ;($sMLV;U;[; [; -LMp`0 $)"40 @T Z (0S! $3 00@?X`ڐʗ(0S01 11 $0 ( $0 (Z -LM0Sp Z(0S9$:+8ʗ   0Q!`1@`T Z (0S  $2 00 @?V $0 (Z: $0 (Z - "ML00ʐ凭 0`  0 Pp^ʖM(0K@00 *,Pp|Nʖ]P (  ;4PpD?ʖ ; Pp2+ʖ(0S/@W] P 0 0  0 pWB0 0X,000  PʖXW0 0 ;(ʖU;[; [;!!LV; 0-LMP0@S ʐ(0S,0 $:+8ʔ  00QP0S00* 0 R LP:(0  $0 (ʔ!! -LM0 00ʐ @00 @  0 PP0ʘ `,0K00`@ @  ,PPuʘ0 ,  ;4PPgʘ00  ;PPY0+H0 p04P , 00 0@ʘ 000 p0  4 PU 4 `C0P< 0;!1 ʘ PP 40@S,0# #$# 0 Pڐʘ(0S00 0 ;(DX02(P PU;[; [;<[;d[;LV; -LM@ "049#\0ڐʐ(0S00 $0 ( -LM0@Sp Z(0S<$:+8ʗ   0Q$`0S Z (0S $0 @Q`VZ: $0 (Z: $0 (Z -LM@4P 5A0AS  0-0@LRX7PS 0hQ{0 !!- 6j p-0LM0`@Q :,  0QT7PS Qp0ph_ʔ\Sʔ 0 \Nl"> -LMRpP` 0S  W0CQ  T 00HSAQ B00HSʸ`J!+0tj -LMPXN @~`p42Xe Z "8"l"l""X   x:T!,ʕ084!\7ld 11a7lW 7lR T'R ! # T'RR R R l0l0   WT'?T' >gfff -:JLP 0p \ Sʕ 0\Sʕ 0\Rʕ 0\Rʕ 0\Rʕ 0\Rʕ 0\Rʕ 0\Rʕ 0\Rʕ 0\R: ,0``WFʕ@A0 \Rʕ@0 \R`VZʕ 0\Rp`ʕ0 \R: ,JƇ Ƞ 0,x\pR`VZʕ 0\eRʕ 0\\Rʕ 0\SRʕ 0\JR p-LMP`: , $ 11!̓  R00S 80 0  S000000@0 p -1L M11@nB:O ,`, 0Q? 1@ Tr Z (0SD $G. {!00@11@0  0!$ J( R1 0/"-? 0b, AS 1d 5 ;5o'!,( $0 (Z! -LIM0-ʐ< ,0 娠00`01 8! @ 5( 5r1GMQ<1 @PV036 0 48< _$ @ 0@ 049#$ 0ʖ(0S %00004 0"0 0(ʖ,P C-1 ʖ(0S $ʖ0 0;P4 -0ʖ 0 0;P4  ,0# #$#0 @ 0@< ,0# #$#0 @0!  04:#:0 0p? 0 @Z @3 R/  # !$#8 00|&00SD7s V Vp0 000KD'5 00PS0000S$ 7 `'H1!4  07K 4\"4 00 0=ʐ  0 \ʐ_ p-@LMM@ `7 b> P 7 b ? 7 b @ 7 b VV b R: ,V ʕ  0 \V0 0 P Q+ʕ0p \V` L 0.0 Bph(0( 000 P Q+,!! (^" -LMp0, 1P00P  Rs0@S 0@S01!10QSZ SX , @0A d1P `  VRc   I    I    , 0 `0  X @XXozI9!!!!0  !(P" p-LM 0@j4P8 <, \ ʕ04 \p p-LM 0@j4P8 <, \ ʕ04 \p  0-T7@S:L0::P< ,D7ʔ 0 \0 p-0LM Pp0Rʕh``@0T \D7 dPh Phʕ0 \pNdh -LM⌑` P|0 6J84  0\ZpP,!,0(! !4J62 0/\ 0.4ʘ 620/\ 0  4J62 0/\|0| Z0 8".\X X0ʘ 8/\ -LM00CpSvG",I"I",I",I",I"$I",I",I",I",I",I",I",I"4I"00 0ʗ 2 0 tJP 80Ptʗ 00Pt:*, 0!ʗ0*\0ʗ@ 2 0 tZ` 80`tʗ 00`tA:K ,ʗ00 0j 0-Q@LP* 0ʕ@AK ,ʕ 0\0:,ʕ!00*j p-LM@07P  ` `0\ 0c`f @ @ p0=@P0 0R00 bX"^"_"`"a"@0\ 0R\0 0R!@PK"(K"0K"8K" [;X;\;\;\; -LM`?<&0@ ?36& +& ?#MP8@xP 4U0@ (0S8"$46R w 66 5q!(X ! 5!%5 (0S%0"|00P'pO@)0@d5d% Ġ@P 4 U0Gp"|P5pO@<S@4$ Ġ@P 41U0Gp",P$ 00RP00*S00B00*S…0U ( (0S  @0`"$0S  @0a<ኍ}C\8$pojp0Hd3 H !@00A<CJS0 ,R I@00A<CJS0 ,R Zp712" 8)2" 9!B2 $ :2" ;0"S2 P2  jp2p" kX2X" l@B@2 $ m(2(" n0 "S2 1  #A1 $ $q1 $ %1! &Q1 $ "0SSx1 $ 000 SS000 00S0 00S RZt0d h00 040 ,0 $0 EFGI"!"""!!!b"c"!!"e"d"g"f"h"i"k"j"l"v"n"m"p"o"q"r"t"s"u"w"X"Y"`"Z"\"["a"]"_"^"UU!" -L`@00P00S@TT|P@p  @TPP0P Q E I <鬨9!`(\; -LM`:0*R0: :/,JP^@0/\ʖ/0\J+6\ʖ<+\:LP:@0:xO0 SDvDV@!0@s PrT@:/,P  @DcTdTM J^@0/\ʖ/5\J+5\ʖ+<\J\%0\ʖ@%0\4U@pʖ!0@\TP@ʖ,,0 @DcTdT ʖ$0\J$0\P~@pZB0#.\ʖ/@0\ZO 0\XIڔJ#0).\ʖ/0\J/0\ʖ#3\@:/,P  @#DcTdT J^@0/\ʖ!.0\]8P@QQ@TPZ2R #2S 2T 2 0S  S t7'l0@r ʖP",D7 :ʖ!0\:/,P  @CTTA 2CʖeP0/\=T'PR 1RQPʖ0+\J0! 0\ʖ,0\J/,1\5;5%@ %T7 S  ( 7< f /ʖ\P:3 `"?9(pp"""!DO@\;d\;Z;X; -LM5p@@0`"PP5U=5 (ʗl0`+J;)00ʗ0`*Jl0+`ʗ0+`J0*00ʗ0/\: ,J0 0 \ʗ 0\J0 \N@PPUIOZF, *X0: :S :0::y! p-L MPKH KaP` 0 $1)pʕ+8\J 0*00tʕ+0\J+0\ʕ 0\J 0\z@ʕ+,0@ZBTT p<p\;\;(pp\Z; -1LP0@l0 T1P1(1  0S<0^pS6:0Gp̠L<s0QS*L<`p@0D+ r <C̠0 0A<CJS0,R.ڔʕD+, 0\ `<S@*0pS0p̠L<S0Sv"w"" -L4M0@`pPPKW0 70) 0 @K K1T@ @4K TK[KJPKOK0+tZ0 t 0Nx 0-:Pl L,0@7 #T Q  Q Qʕ0 \00@ p-LMhR@`lp2 ` h”l 0XdohRlp2 ` h” l0Xp -LMhp`lp2 ` h2l $ThBlp2 ` h—l 0XhBlp2 ` h—0l T_ 0mP x"0hB0t2lp2 ` h—l 0XhBlp2 ` x2hB ,0l 0 \cP@  PP  @00\}P 0P00  pP@ 000  cP`v 00 P&@RP00TQ^0$0 0 0d00 X0 HBBt"01 QXP>@03 < LL0\ 0004 @{0=0 hR `lp2 ` h—l 0XhRlp2 ` h—l 0Xo], 0> Q- L Q  =S p-LM@ `P PQ ^P -QULp  ]P` @T: 0 mkZ@T:@T*Q@T:u\;%l 0-LLT΀Pe  H0S<̅T  ߾hP0@ 0:#:S0 000S00G<8 @T20T2d8 T20CT2o<Hn"<0S<<   <0CS,<00-,000 p-LM0P` L0S @0S0 0  ><SLp00>-,000 p-LM0P` L0S @0S0 0 =<SLp00=@-,00@0@ p-LMP`0 L0S @0S0 0 =<SLp00=$0 R0 R  = -LMhPplp2 p h2l ( H?` L10S<````.'  A0S 00VhB lp2  h•8l #8XX20X2`x`h`XhBlp2 p h•l0 X \;\;];,]; 0-T20QLPT2 @T0 0ST20CT2000V -LM@0SS#  R 0 R  0!  0:0::Q:\PhA-`4PU%@P 0 0;#;-R@ Pv@ Q0 00AccP09040Q@Dp 0 \+0"+^ @L00eL00@p@-P @P0` R p@w 000 0p@\ v" 0-L@e:Pb0h7: -LM`0Vp0PjhB p2l  h•l (0?`VZ P 0S P 0Sh_0S  0-LMhR@ lp2  h”l (0?00h~ p-LMhBP lp2  h•l 0X`hB p2l  h•l (0 `jcVphzcVpX]; -LMPp9h• lp2  h2l (pWp hWhB` hlp2 `&h h•0l X`hB p2l  h•l (08:0#0W` i V`9W   V9x];];]; p-L Ml@V PK 0wgP ,0"  000,^ `0< ㈺pp<0 p-L Ml@V PK 0HgP ,0"  000,^ `0< Ypp<0 p-QLM`P @Tp -L$M@, 0 40 t`@ D q 0@l H  0MPZ0 4PP%0%40 `1`R< J< `Z8 2,Q8 @T007 0<0 V0 8 " D0B B * ':@474$ \9i000 `V P%,000 0gZ 0P HP  ,  l"];040 -LM@aP 0h -LM@!0P`h0SX0 Dp0H 3L0<(K,@K @AP , 040(,0P 0 (0  ;8l<S0,x00> 0⼌0 R 0 R @@ 7p0 RP@ 840 ,0 ,!  =v">Mb -L0@` 1p hR780 TQ0 R@7pPP R 050 R70h7x0 P %]` 0g77Pv`m77pPPj l]; ]; -LM0@D4 0  -LM@`P 0h 0-0L L0@P R P(0 R0 = -LM@`P 0h -LMP !0`hp0S?0< (@K03H0 $K @@P@ ( 040B7(0$ ` 0 D0T L0 $0  D0P$ <@0S,00> 0| 0@6  $0S0$0 -LM0D`pP7@T6@3gTLgiL0@TL0@T -L 0⼬0 R 0 R 00B6P@ 0 0 ,!H<\040<,K<L T00@K @7P00, p00 yi=v">Mb 0-LPe_@T0T0^ -LM0` DP@1ZL0SE @t. < 00@0@, 4pP6Z @4 0 00o5G00 0 P CP0@T4@6 ^:^ h• lp2  h2l ( @g ]; -L`0pt0  hPR40  RD0 BA5 @`@<.S0<x \ x5 p-LM0@DP5 `0R0R00S4 S00 1* **P\^7)^phE5 -LM0DPp@0!@0T50eW5@ m0P` 0S S 0SP 0 0 @T5giV i 5^; -LM0 @p g`噗SU  44pp7DpD@PP! p0PU5Pp ͆0 0PU04 00 PUJ0PUZgih0S0S 040P00 00 -LM`pDPPhh@ L0P  0(Q 0S  R00 H0 <$K(@K @( 0P40$ (0 0 L0 $0P  $ 00 p-LMh@ PRh` 0S  000 0S DMX0Sp0 ph?Dm p-LMh@ `RhP 0S  0`D ph#p-01 0000 00 p-LM0 1P m @0S @0S0 0 6 0S0 @0C0p006 -RLM`H V`pDg i^L@*P U  P011"PUP 1@1\:P UpL@0P0 0 U 0p3P U@3L0Pw UO@^; 0-@0PL80 >4  QL 00ST" " "@"4100EPD PP  PT H0 aP0DWP%T"0DLPDG0000h0p000PD, P0r00 0hJQ,0 Q$0000|>>>>L>d> p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -QLMP Qh•@lp2 @ h2l (h• nlp2 @ ` ih•i< lXch•lp2 @ h2l (h• nlp2 @ ` ih•1i0l Xd4h•lp2 @ h2l (h• nlp2 @ ` ih•il0 X p2bh•lp2  h2 l( h   h•lp2 hB00l0 pGXWWP0  h•lp2 hB 0l0 DD N -LM@[P 0h -L M0 D:p` R%@ 0TĀ<0 @0% $R 29R R R 2@Z1R R^l9^>T9R H9RD9 RR ,9 R 9RV 9R 9R\ \^񟗿8"""8""8"8"8"8"8"8"8"8"8"8"8"(""8"0""h—@lp2 @ h2l (h— lp2@N  @h—IIlI= Xh—@lp2 @ h2l (h— lp2@N  @h—IIl?h—@lp2 @ h2l (h— lp2@N  @h—I7Il0h—@lp2 @ h2l (h— lp2@N  @h—IIl0h—@lp2 @ h2l (h— lp2@N  @h—IIl0vh—@lp2 @ h2l (h— lp2@N  @h—IIl;U `5 T5R  RU00$5RU4 N4S, S < ğU1# =C4  0CSU 0R0 Rx$yR\$. U1 #Pj U@1 @# $  PdU010# \ \s^o8"̞"P"8"ԟ"8"8"8"h"8"8"8"8"8"8"8"8"8"8"8"8"h—@lp2 @ h2l (h— lp2@N  @h—IIl0h—@lp2 @ h2l (h— lp2@N  @h—IIl:  Rw L2R R U005U R+ 2R U1 # B1R\ \Uh— lp2  h2l (0@\ \Uh— lp2  h2l ( H0     RN4JĠ,K +0K)K,K*K0U        # #D >d^;h^;>>> > 0-0P L@3 > $0S0$00h6X -LM@XP 0h p-LM`0 Pp03M @RT0 H ?A3c< , ѾӾl p >MbHn" -LM0@3 0<0S0S Q0- L@P Q 08S0@  0-8PS@L ľL4QK=_0HPP2> p-L Mh@V PK 0\P ,0"  000(^ `08 00pp80 -L MX`U(pK 0\P@).P(,0 0@00(PU 0HZ~..H 08ү0$00a l. p-LMP@.`_ 80HphV. -LM4 < @ 4!P< , 80 4p8  0<0CR76, 0 90>0P`*@G S : R#: , Jc0 ᥷@`p`B0 Xp0C$ 0P8 R <0 ,4 0 ᅷP@ 0P0NPP`  0 0B@$B -LMxPW$`K 0\P@)-p$ ,0#  0@0(0(?^ H--H 0p8040 0- p-LMP@-`8 0Hph- p-LMPRh• lp2  h2l ,` B\0 @`0 D8T8V 10\2p0^;^;o ($8 0ZPP t2 |,[03P P 090P P 090PP 0@900D?0P! 0T90"$@0>T 0ڔ@2|"@Th—lp2  h2l ,h—Plp2  h2l4 ,h—lp2  h2lH ,0 h—lp2  h2lL , \4 ,P ~d\hBlp2  h— ,0l\d\hBlp2  h—l 0\@ H.h—lp2  h2l ,@ Tt P@1@M>THEBvZh—lp2  t2 hB,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h2l8 , I$I00<#N>C 0ChR0l , Ȅlp2   h—4 l 0\2hbA$lp2  h—Ql0@ \hBlp2  h—0 :lH \hBlp2  h—P 8l\}[hBlp2  h—lH 00\hBlp2  h—l40L \00#Z[@ `T[h—lp2 ` h2lH ,@ T P 1PT!0040TXPX弥0L8 wh—lp2 ` hB3l1 \hBlp2  h—l ,0\p@TJQ@TPEZPD>^;@%I$d><"2>|"0 X!Y -LM HTe | H0S 8$T| ܫ@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPp{*UU U mK*teh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \2Z00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\ZhBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\YhBlp2 ` h—0H l\2tY 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 RXaf= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"RIC-@T2V0CT2hB lp2  h•l 0\303 >(ap1@`T-hB lp2  h•l 0\|M`\80\8RP`\(0\8h lp2  h2 l,|"`hh lp2   h2l ,`X |"pS_;>$_;P_;d_; 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@L((PM0h' -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p_; -LMT2p0T2'0H0,08,8'T $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT200ޯ3 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0\'`P0'0S R000R0 A60S!0\@P R 00c0C20000#2w'`O&$0S` 4 00hB lp2  h—0l \Z0 00&`O&J@`$0S  -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@ T 0 0 m;OTph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0PV0 QhBlp2 h2 l,3 `VZ00hN70S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`2P, @ ,P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0V,0P @, k4040<0<@   ;140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $p%08 08hBlp2`  h˜0l \0S 0 R N%P@'` X0 P0 ,! ,(0=">Mb0 0  Q-L 0S S 0SQ 0 0 _;-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@5GX" 0-L@$P0h$ -L Mp0,"`P0U@, > ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y "("<"T"0!<00  RP s$@F$00S  X 000oz000U$, 0r00  o* ?P 80(S"ˠ ʠ0S80 S0000 >>>>>> -LM04p@P$`OT#0 0004i= -LM@P0pl14 RO80 TXH1 R<N#`P⥳#090 T#0 ` 8I0 z##L0$ `R 090Lo#0 #>XS @ $0S Z00 #`P` l_;_; p-QLM@`PpvT 00 @DRT0  0 @DRTʃ0p -LM@LP 0h -8L9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳0""""""" """"""""H""""8"hB lp2  h—l 0\0ISh— lp2  h2l , ~hB lp2  h—l 0hB lp2  h—l d^; `;">+>4> ;>  -LM@IP 0h0  0 R(  0-P L$0S0$000 @PI0hl 0 (( -LM@IP 0h 0-0L L0@P R aP(0 R0=U 0-0L@P080h4 000 -LM@IP 0h -LM@!0Pp0Sl0 40< 3@0(K8``(P060( 060(202(  ( $L` ( V0 $P( 0S00( 8090hBlp2 h—0l \0S 0 R p0 R{P@Ꮿ< V40 ,0 ,!R =">Mb 0-0L@P80h% -LM@HP 0h -LMpP0 04Z0 08@, 塃`V # 0X6$0!<0@, , 00C  " 0`$PL@q008`090C ($0S0$0P -04@pLP<`@S 0R O1P 0S S 0S 0 0 Q 0/- 0b1|# BQ|#84mO -LMR, `4C PP0@ ptW@*Q*001|#Q: Pp11^P:1" 0 0 Q *001|# Q|#:,0@p<@o`; 0-LPG@T0T0 -LM, 4 04 0<00 0,2P, <0s|",00<0<0@ 40D0 ,0@ ,D 8@^L@@0 zPP'z<0 << 00 < @0 S0>08 0 Sq`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0EP`$ @ 0A,(0"A 0 P `4@  D 00p0(04 0,08`090o0  o8`;0 0P  -LMP@0 0pSS 004`090LP40S -NpF0( 90 i P40S iT`; - 0p`L<0@@pP4{ 0-0L@P80h0 0 U00#1300"#"0aS -h2pLl $h2tl ,h2l ,h—0\2t"0l\Mh—lt"0\PMh2lt",P cU h—`02lt", PD"h"p"";2o*0ZKPP  0hB02,0t" 0l \2H 004 N706@PP U@P0U!"1P0 0DP0P:D 0!@0U  0L"PU@d:PUPX P :0P` @00 `HD``LPh—P0t"0l \n ao \m\僁h2lt",hB 08lt"10\h—t"l@ 0\Lh2t"l ,JP cUAh—t"6l \KR"P001"@T:<5<3h—l 0\^;x>P"`;`; -PLM@ l0 R`0 Rhh2t"l ,?0h”t"l \= p-PLMP+ t"h2l ,?@p6`ph•t"0 l\T2X"0 T2X"60*T2V0CT2p6h•0t"6l \ 4nN«T ቫL0`㉫4WA` N `_;(">$_; -Q6600Lt"h66l \ -QLMP`, <0 @Ɩ1p0C S1 !@T 0 0 ivDt"h2!@ l,?>*0D <@0T 0-T20QLPT2 |@&Tx2 6S d 0ST20CT20 00ۣoN@5 0<#> -LM @R 0 R  "888@S4QP 0h=hh`;0@-SS0 04@ Q 0 #88R8 ,40S,(4((40bQ,5@   ,20#0Q00S0 00@CS@ p-LMP0U`0@8Kl0 Rh”t"l ,&00?PUZ00phC0S p -LMh2t"@ l,6 hw 0-7PS@LoznxP 2<SKJ0闕PP2> Q0- L@P Q 07S0@ꆲ  -`LPVm MVK&0@0T0Fh2lt",h•00`lt"0\@h•t"l ,0 @ JcT\h•`lt"0\@h•t"l ,0 @{JcT"00C0 mt"h2q @ l,"@ R0 6Tڥt"h• l@ \Th•0t"00l 0\2•hB,0t" 0l \&hBP0t"l 0\h•t"6l \6@Tp&h•lt"2\hBt"l@ 0\@h•t"l ,0 @ JcTi2It"h2 @ l,-R`@@0' 6TW 2I6@Tt"h2q @ l,-R`@@0 6Tڪt"h• l@ \t"h• l@ p\=^;`; 0-Lh@lt"0\hRt"l0\00 vGG -LMFTe m H0S6T  $0 p0 t@x {@#6H SH0&4 010 -L MP `P2 pR,  R000 00 2 ,0Ru 0S kS kW00Y00SYP@@ 0, 04$W 6Y8Q70!"#;81;W0   0?04@W@""""<0 FP0 00P70000, |0r00 o$\JS R<0 R4000 `;> >>>`;>>D0HD00DD 0P0R0H0HD0 D0D0S H-0 0@008 0 00  RE0LEZ -0` LR@ m~p|U]℀ Ph2lt",h”0lt"@0\0@ ?0P` V m|>Pa; p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@8AP 0h -9L4M , 0 Pp9\  R '%@ 0d<0t @0% $R >9R ,R& R 00@|@8 ,0S ,塪\000 R 8RRWh8pW\8R H8R @888R 08,8R 8R8R8RVڸ6V1h•t"@@l ,0G*pS񟗩,#P#|#l#|#|#|#`#|#|#|#|#|#|#|#|#|#|#|#|##|#h•t"l 0\h•t"l 0; S / h•t"Ad^;a;6>@>I>R> Y> 0-Qh2t"@@PLl ,h”t"*0l :\0 -LM@>P 0h0  0 R  0-P L$0S0$0001@=0h0 & p-L MFPT `K?*0$CP ,0 00P0&@)TD `@D06D 50H0D0pp6D0 -L MV`U(pK?*0BP@'P(,0 0@080&P)U4 `FF404 60<040 0-PL@640F0h -LM<@,P@ P<   BZS.2=6=8  P40 , 0 @  8P@ <P4 ,!4 0P`W >00 0c S @1::#:Jc8ŝ@`@ d=:#:0P*pP 6. \ p:4 <8040P<0D 8 @ ᯝTP4.4 Z@P @ P ` ) 0`,(P8 p-QLM`P 4@QTp -LM04p@` Pr0 ?04i -LM@P0`p24 R80 TQp2 Rd.0 V 0`0 @0("h0000P`mh,6 H0 ,0 &@  0P4<1@@8 x!08 L4 0Y`8@P8Lp P 08 0Q S0@0 S@4p4P 0P 40^0 80QP4^ Y , 00< o+00妛00 0E`Ph5 la;a;a;@-0(0h@ R @=@5 0-L@ P.0h 0-LP@l80h -LM@><P 0h 0-0L L0@P R *P(0 R0=-0 R0S |Q00  -L$Mp%% 0 P D4 < P@ P`@ 0D@4 8 08 44"8  80T ,` X<0<@  10< ,0 0 0, 14 <  R, 800004 4Mb -LM@F;P 0h -LM\!0P`0SO0  4p0 < $K(K3 P@P@ :(0$ 0 $`0S 0 R 6@S|0&|00j> 0V0@p0 RP@q< 840 ,0 ,!4 =#>Mb -0 R0S |Q00r p-LM`P0CT0CSC`0 R Κ0D00 C1T p70D @Xaf -LM@:P 0h -LM\!0P`0SO0  4p0 < $K(K3 PP@ 9(0$ 0 *$0S 0 R 6@S|0&|00j> 0V0@p0 RP@Ỡ< Ⴀ40 ,0 ,!~ =#>Mb$0S0$04 0T 1 -LM@P( 0R`0S 0S |Q00  <  0 K$K034@ PP $0 0  p+0S `0 R w00P@O0 (0 0 ,!=#>Mb  P p-LM` @P080 4`0 p< -LM`@ Ƞ Ƞ,Ā\ P 8\ \0 > -LM< @.8\ 0 > 0-@L Ƞ Ƞ,PP 0\ 8^00-Q |0Q 0 R 00L0Q  0 @T 00>RR,@R, -L M@K 0  @ !# Q- La; -L0L\88 00S \0  f%f#@lfQ Q< -`V`V` pP0UL`p` rh @0v0S APP U 1hr>Rj -LM (0("t0'Q0@K0 0Q0KU 00KR0@K j 8P@0KR0(p0tP@`%#7"00K82T3 ,2T 00S0 ep@ 0e/㔏q01T 1T0S 0j0S e/0S00L1T/ @1T00 0"  10S0S  0  P0T 0%4400 0 /0S0S0S S mt mY0S 0 0ymdRjr @sd edArdAr hdk~gd$# -LM`@ePp <(00p04S80,0d080 4pŨ00 㿨, 07><4wtOὦ&(0("4400$ 0 0 i b;b;WEV$# 0-D0P @L 0`P 0000P0W> -LM0s@S* 00 0000 - qL`PU  0P6PU $00<0$0@X0 P:00 K @ 004;0000 `\ @1@!0 H P@00d@0 H b>$b; -LMp0PU  @ kP  r 0 S X 0`K 0vPP:PjB,b; 0- L@P_oP0  0S@ P0 0> 0-T0L PR 0U@ T 0T000@o> 0-D0L@PT :P @T00>(00S S0S> -0L  0 0 (ff f$f 0-L MHP0 @(K00  ,@ =0K# 0S V0j8b; 0-L MHP0 @(K00  ,@ #0K 0S <0jPb; -pL0S' P`@V 0PPRPt0   p@h刔t "bD 0S000,0 R 幻(f ff,f$ffhb; -`P0LS  X@X0p0 0S 0 0C0  (f$ff 88#4  R00ᜬf 0-L MDP00@K0 P 0 S0 嬞0jfb; -L Mp0`S  @8PK0SXX  0#HP 0 S ( 兞 㪅jfb;b;Pკ -LMA@ 0  R @(f,f 0-1Ls8P@  0 080g 00@<  0f> -LM@X H 0S00  Q0 0 0S00h 0f 0 0P(f p-LMPK@` 10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$: { -T LM@HT00  (0R >>0^jb; 00> -Lp`P7@T@ hh R(( `@ pp00 b;b;> -l`L@PTp P 0S `@T$h?0T0 h>b; p-T0LM@PT` P 0S @Tpp> -LM@h 0-pPL0S`0@T P@T00020#J>> 0-XPL0S H0@T P@T000 .>> p-LMP60@`TL  (`0#p鸹pb; -LM@ h- -LMx@0Slh鞹d圹@T BLP0 @@ 0 ,剹@T>b;c;t; <,c;&< -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0QW>0W> -L P00@-SP@  0P PR  0S0P 0P 0 -LM@Q Y 0S4^j0^jPc;`c;pc;|c; fQ#& fQL &0m& fQI$& fQ & fQ & fQ#&0 R DBj;c; ᗴ&Q0 p l& &0 >> -0LP4M 0X 0T@K@0t0 Rh@J P`00TLL00 R 0X  <^jD^j8^j4^j@^jL>> P-L E00밀 -L4M8#0Z,0 PL LJ0P0 L p@ TP`A HKP I0D1S3I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#|I#I#tI#I#(J#|I#|I#|I#PJ#\J#|I#|I#hJ#|I#|I#tJ#|I#|I#J#J#|I#K#|I#|I#,K#|I#HK#pP@TZZ!0, PR ,塘P8 k 0@^S||P _ `P"pp  L  E 0 R 5 R 0BP ^S %   l  0D R <մ80PCj8^jf; f;f;f;$f;,f;4f;&<>8>H^j0>G^jf;mj -P@L@PpP`P0P @D@PPP P  000cmjmjmjmj -8@LMxP00  0@xnjtnjmj0 00xnjmjtnj8 04S00 0 0S405@>mjtnj0@>0D> -$ L0S 00 D> -L 000D>@> -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@Ut@t Tl_P Q:P00\P0S0p P@$V0?Sbb#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#b#b#b#b#c#\c#\c#c#c#c#b# c#(c#0c#Tc#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#\c#pc#c#c#    .P@ -ܮ:<P@  >P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0Pmjmjtnjf;f;g;`>njg; -LM||`P0Ulp@V0T UPe PUP0U00 PP>H>T> 0-@PLP 0ScP  P h 00C0\@P 0SU00h:0 qPPHg;L>Tg; 0-H1L0@S4!0CQF!0D]S& T T T T 00h 00000P@000 0 0np@x0 0 S 0CRL000 (00  yX>L>H>T>P>\>0H> 0 0 lQ 𠱵\>H>< -LMS@ \00S SL L0L L0P 0^0?l 0ܭ 0`>xg;g;g;g;g;g; p-LMP@PLU` ph鎭8`勭0 ,$0D傭Ppg;<lg;h; -PL`%HpP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 4 S 1!0S 2!8S  1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@娬,1@@DT$@D⠬TB 嚬 00CS0 00CS0ڸ0 R儬(倬00  0 00Sv h00S 0So P00S 0Sh Hpfojojnjojh;<d> -LMp0@SSHP S 0S iX 0  Pi/ dT`0 Q00 28 6S Q R000ojoj 0S00lojP0pQr  8 80, ,0 0njojnj@^jojoj ojD0<08 pQ(0 0ojnjoj@^joj oj-L0H D0pQ, ,0 0ojojnj@^jnjoj oj 80cR   (0 0 0ojnj@^joj oj p-LMHP@  D T h0\ `` T` T0V D0\ P00pP 0d>h> 0-@@L08PS0S00000h>d> - 0L@TT xP\ lp`bXd0 4P 0S<00hFp h?`l>>oj h;$h; e; 0-\L@P 2S P(0P2 00l>Hh; p-LM`P`@2S@T<phPT0"2 000pl>lh; -LM@ K;40S0:00A0 R0  @f p-LM`@PƕP  0S  p麕P   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$jPl>ojh; -LMP`@V 0FS \oRP oM៕p0S  SPh;h; -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP xW0`p0@2S @T:0T0 P0( Pl>h;@u#h; -0LM pR K >TP@`2S@PT P Wp >l> -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5ojl> -PLPM`\p 0K@  0SV 000oj -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (完l RW xK| K0P x| P@hK0@@ >j>>_f^fmj -LM@KP -LM KPK -0 SL 0  -L \   00 -L M6PhKP . P(@K3P &P,j;m;j;R0 0 0  -T LM@HT 00  (0R $> >Xuj$j; 0 0$> P-PL` @T p P 0S @TP@ 0P0`0 000 $mn0S>Hj;b; -p`L@PTp P 0S0W: ` @ThI 00h(>b; 0-LMl@0S`0h7X5PU @P@D ,, @% PU0(>`j;tj;t; (>0 > -0LM@`TPp bP 0.S 0U:R0>0>0Up1 @TW 0@(>> -lL4M 0hR,0 0PP0 ` LRH bR` (`LKHKp 0S! @P   0 ps0L  piL PP0S h0h fP <,0 S D,寉8_`lRjj;&j;j;4^j8^jj;j; p-L MQP@D00CS ,#P#X#`#h#܆##0 up-p0 R 0up`0K0,0 uPU 0S0pD0 R< 0(`$p`>\>X>T>ȵjd6>h6>,> -40LM @R MXaf 00Cs0 -@L`0 SpP 00L S0 @0V0 0Sg0 S@P 0 a0CSa0RS-TP@堥a@0a S_R@ zTh锥Bꔬ9Ȭ9j;j; -L4M0 sS, `@HKTK   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SVQ000 Qj1 4V@xq v0PS`LK0 PBTU@P !0001 ,0S ,l$pX T KT@ IT0cP T K0T0 >0X P U0:S000 S 0a0CS0000S _0a0B`F|00C ZSQj\ujXujj;l>k;# RA0 R0#0Z RA0 R0#0Z RA0 R0#0ZRA 0P0 ZRA0 0#P0 ZRA0 0#P0 Z RA0q@ R0Z RA0q R0`Z RA0 R0Z RA0 R0Z R-D0q@0# R0Z R-D0q R0#0`Z RA0 R 0#0Z RA0 R 0#0ZRA0q@00 q\  ZRA0q@00 q\  Z RA0q@ R00Z RA0q@ R00Z R-D0q@0# R00Z R-D0q@0# R00ZR-D0q@0#00 q\  ZR-D0q@0#00 q\  ZR-D q@  0q\0#00ZR-D0q@0#00 q\  ZRA0\0  Z RA0 R0Z RA0 R0Z RA0 R 0#0Z RA0 R 0#0ZR-D \ 00#0ZR-D0\0#0  ZRA0\0  ZR-D0\0#0  ZP -gM`L M0P@ᤀ,0 8@40\P 8Pp4P\h06  8Pp $4P ,0 S ,>AB_Dp}zO?-ppXs    08q@q4t|qqxK Hg^K0PE PES @3SX30X3 <36 H\ ?KMMKK@DL@D@@MK^φ ?K@D@D5nφ ?K@-xxt ?KXXT ]?Kj<\k;k;k;>t>>>8k;k;4>@k;k;T>Q Q 0-0@1Ld{`{ 1P0CS1 o02c 1LyP,}`h]0PU 00S PU@ 0) 0$ @0 00>k;f#@lfk; -L3Mp @PoK0 L3 040H RKPL L30 0 S  5jk; -LM , p ČP 後P0S7 S 0 0S ( `V0Pၡ 8 ,@ ᤌ0S`, (0PV 00000 1S8 0A@ 00$ 480 00 0 0S ( `V0Pၡ 4 ,@ n0S`, ( PV00000 1S0 04 0A@ 00$ W440 00 -L`@P pP:P @0S.P0S 0 @ -L M@K 0 @  埇|# Q- L 80Q 00Q(ԟ 0Ql;Tk;l; l;,l; -LM4@T0 \̠0pSP` L^ 0 L P   S -40 P0LS hTT0  -LM Ƞ` Ƞ,@\Pp/0 AT+ 1S*40S% 1 0R1 RP 10CS1oYy 0PR R 0>\p@-@P` \ 0p@p\ \pp@ 0- 8@8L#T P&0AT" 1S10P1 P P10CS10oxPP PP00> 0- 8@8L#T P&0AT" 1S10P1 P P10CS10ox2PP PP00> -LM Ƞp Ƞ,d@^P-AT) \$^ ^P 10CS1ox 0P^ ^ > 0- 8@8L#T P 0AT 1S10P1 P P10CS10oOxPP0> 0-P@ L Č P!0AT 1S1 0P1 P P10CS10ox0PP0> -P V `LP*ypW 0 7!; 0 0( , 0 4 9 : py` 0-4PL@h \ =000\ =000  C0 Px0  C0t P 0-@PL0 Cx0/"?CQA x0  Cl0 a0 0 -PLMU@b <000 \040P`<X`d (, <0 0 <0 <0 0 <0U, @K Op1l娐` !Ppx0 0 ` l t p P p 娀 ,0 HK倐Kl P`040 ,!=< <@BPD> 0-@L 40P4 R ,1S =000h 0-@L 04 $140PS0h0 -LM0PS`[0SX0S+@p hw1`SE  x@ 00 0 pW p%0 00p)@ ST  0s00S@dp 0R 2c0du0!d0R00@@ST - 0>0l;Tk; -P1 LQ @4<p 0S ,1S4 40 ,0R 00000`0 0S 0S# 04 ,000W<0= 0 <0= V<0= 0 <0= @ ,AX@FP0S 0> -83LMQ, h;P,1@SK=0H , 0S ` $1pcW`@0"^` bt1`@S@@T #A$w, 0S0w, 1$1P0$1,0@ RQ,0 T00R00S  `R0S0SS @l`0T!^` t1`@S@@T R090`3 0 pb0fAWpv, 0S01Sv, Vg0`V `%@ ; g090`,0 T00R00S0 AP@ f>8l;Tk;@l; 0-@L 0PS` `0S04 0000dS d0S04 ,000hKu0d0Gu0`0 -Q0B?`h`P4p L!0?0RLv0 S 0 0-SQ(0B 0 "#0>Mb -LMPaq` @ v@0`cv00CSꈮ#Ȯ######Ю##########0 0KP J R K0 R0PZU00K 00B0 -LMp`KB@P 0 TQ 0 S \ ;Q#Q!@a \fTP00Q00SjHl; -3LMap;0, SP\ 1 0 P 1 ,^=0 =0 P 0@(P P S1!u 0Oxu `(10h(1\ P \P 4 @$0T, P0Ud|"^d r1dPSX@$0T0900400 $0 Pd00Zc  9u 5uP@UPUP!0 e0\PcX0 Z %04 0 :0 S  0P0 c 0c80 u@8uT4 P 9 : 0S80S$ 4YU 1S t@  00   X00R00Ssp  0X8tP` 00 14!T4#P->`l;Tk; -,4L 4aQp4@ 4Q S3Q 3Q pP0S 03QtP@ nP$=0 0T0R00SX =0 0U0R00S m 2Q" 2Q,102Q 2Q 00 @l*tt|0 0a 00\0t11QL 1Q 1Qr {1Q 1Qgpq08l x1Q l1Qd1Q \1QMW<000 P0P\ <0S,Q80P1U0SX* X0S0X0%  H0@ @cP @0 S @@#s0 0@H>!A @A@A A A@A@A@"A@ A @}f$A@#A@A0@A@A~fA A p-QPLM@`L`Qd@`@0SĭXPv ph?p6`Wr00 -0LM0 PApA` ,1S/=0, $1R&P ,1S=0=0 (1S0 0Q`VP U@]LY` 0R> -LMAp04P\' X0S$ `R ;0S 0 0 X 0;00 0S0S V&> 0-LM4P@d BR\0 Ttx l00@dP000000tl @(# 0-LM@P0S04P`0S L00 0`P00000@ $# -LM<0PS4p@`s0 0S0 0%; 0%(0R0(0 `0S0 Ph1$00fS0&90S0:0!  `Wr80`S0040000(!0 40(! 00Z0$0 % R0%`0S =0 80S 0S,Q`0S m080P $P  0# p-LM<0PS4`h@p0 0S0 0%; 0%(0R 0(0 d0S0 P0(p08 R 40 0 l40 d0S phP0T0P (P K$0Q90S00 0 l00# R6 R- R0 0 R0 00BSԿ#Կ###Կ#############0S 00C S0SS S0S 0 00S 0 -@P 0 @0 PpL040`@@OP@00 @040@ p-LM`0P @r0  040KH# HP(3S 4 0\3 0X3 KDP?K  0 S zpjhl; -LMp0qP$0 ` 040P 5KHP@03S04 ُKd3 0`3 DP@ $0 S L$z0V004 \3 @P@ =jtl; -L$M8 \, p\ S D  Svʜ /=2D0 r6 0@ S> 0@@K04 <0 DP`PV8 $0PS U V P1 ,0S @,+z40s@0  D  0P | @KD  0@ `004 @K<0 DP`8PH P@$0  4|@KD  0@  PH00H0 PU@H^@0c D -¢jl; -L@40P`pDP 00  00040DP 000 -L,MlŸp~, H T0 D G 0@ SO 0@@K04 <0 DP`P0U<0 8 $0PS! U D0HS0T  00 pT01 ,0S x,ty0oT@`40s@0  D KH0KP | @ @KD KH0K< y004 @K<0 DP`0P<0 H D P@$8P @KL KP0K 4|@ VPDL0H P0` D H U@Z Do 0HD0 oH jl; p-LMDa0RP0  0s+ 00 \) 0B0$ S0,0 @0S PT 0 S xp$004 0K(0 @@0\,0 ( 0$0P( R (0S@ 0400K@jl; 0-LMP@0q0 00S004 , (0 ,KDP 0 S x0 0S 0P$ $0\ R0P$ $00 Rjl; -L|M4 ɟ 0Rp 8`,0 | q 00 XKB @pK0P s  X0 80sp0  0|sT0  0sl0 0| sP0 0sh0 0|sL0 0sd0 XZX@ Z Y 0H0 D 倐 @0s Y 0=0= 倐  0=0=  ,1S0=0Q- 0 \ TpKXK T = p0K0 0X0KPPQT T pKX@K t@ l0t0  0Y0 t@ X tTz6p 6"0Sj Z tT\6X 6"0SL Tt00 r Y? ]PP|0 r Y- zPP0s ]Ox Kq0K q0[ PP|0s 0S30S ]Ox Kq0K30x PPl|30S 0S R ]PP\p0s 1s p04 @0 04K<0 8 @K@PPG0s =  0SY]xq 0 Q01S00| r 00CR01 x0sA 0 0bQ000S 000S0S=0#|00S 000S0S=0 3 ,0S ,v @PU  @PU|0s @LPP$0 S- p=0 0R00S 0S0S U=000\00S 0S0S Uo>P]Pl0S0PPYR= LNx Kq0K|x 30PPNx Kq0K|0 q0[PPoa| \ t@P0L 1D0l st@h0d 1\0l:oX0T p0 l L0P d0 h Op0l X0 T d0h L0 P FXKpK+`@ \ 倐 @XKPPpKPPj0>Mbl; -LMP40 SP`( 8p 0N0!8 ]10  10 1 0%!@1H 0k030 1s 04 <0 080 4 <KDP00[ 0p0 GlCl0  c( 00b(0 !, ,000 0 00S010 2 R 1 2<00060<  6 070 7 l hl lPtx  lxl|=00(0 S (lujl; p-LMRQQ@h@`k k0S00 $k kp\0S\ 0S 0 S00mE -LM\@T vX@T - L> -LP@Q< Pp4`D $1P 1P @0S@ D\0\08@0P 0P0@00H 0@P@0ST0@ 0D>MA0@}fMM, 0-h0@ qL! qPP<0 080< 00@ 0DP>4>$> 0-jl; -LM@PT`p+R28L00 ^\*Q^ ^nQ%@5Q i#Lj@  00  Q0 -LMtpP ` PXu  0S %D@ @0  I`ujduj@lf -LMP@0`p 0PS$ K P $;P0 %D@@@0 Œ0T00`ujduj@lf -L0L0P 800P 0$0Œ0D>`uj@lf -P0LPl<00P  Ġ 0 2 0D>`uj@lf 0-LM^P@ Plx0P 40`0Œ000,@0S LP000btD>`uj@lf,0,P 0S0妰D>`uj -d0LPlP0P  404 02(,D>`uj@lf -$0L0S`uj 0-HPL0@S P0 T 0 `uj 0-`0L @R LP0@0C000PS T0000`ujH> -@0LM\0 @T `uj -1LM1\@pP $P  AP`` 0!/ P?@0H0  0lKD h0 l` @P PP@0\0 KP@@\80S @V VB 0 SR@ AP @\ 0K0 K@0 | x t pP 0\0KP0@\0  B\ j ll; p-LM@0@S`P80S D0  Q*QL0SX┢pP4 0;#;`$pULL$g -H1LApD0`F Ė\@0!SL600LQePP&Ė\ 0S \  K` T @!T@!XPP4$0;d#;40S Q ^ Z V# R`>m; p-LM80@S @0I^SP pc4`S ph3<0S0<0 -LMP0@S0P<0dp0ShqTP0f p-LMH0IN PPU`@ 4S 440 $P PPE4$0; B#;4$UH0 4SphTtphmp#P0444$0 B;#;R4$00 0S 4 -1LMaD0I~pS @0SJ 4 S:0S#0S 4!S0X P1PddP@#@0S$4 S+c [`0UP!UP! WP@ 404G v0S p l h`> m; -0LMQ@@0S  `xA p 4S``@ 8 S`1VR T=dX`>l0@0SP0Q H0Q Rp  p0S0p0`>}f~f 0- LM0PP!0AT @0S8^d040pD## p-0LM Q@0INS@P@ T0 0c4008p 4`S<0SP@ P@0P0L 0}cP@0S<0St`>m;m;R0S 0-x LMP@P0d 2@?@4cST00T0K4000tH08P %l?0>#$m; 004 -LMP0 S@@ L0Sl0P\\ 00 S P0 0LL0d0PP0df#@lf Q- L,m; -LL 0!RP@0S 0 400`>8m; -L M@K 0  @ Ir#0`>RA P00ZԬ9R-D P0 0#0ZԬ9R-D(0qL P 00 ZԬ9R-D$0qP  l00  ZԬ9R@- J0@0qL P " 00 ZԬ9R@-J8@0q@ \ "  00  ZԬ9R@- J,@ qP00#0l 00ZԬ9R@-J8@0q@ \ "  00   ZԬ9@-R (@UJ0^0#  RZԮ9RA P00ZԮ9R-D 0P 0#0  ZԮ9RA P00Zԯ9R-D P0 0#0Zԯ9R-D(0qL P 00 Zԯ9R-D$0qP  l00  Zԯ9R@- J0@0qL P " 00 Zԯ9R@- J,@ qP00#0l 00Zԯ9RA P00ZԱ9R-D 0P 0#0  ZԱ9R@- J$@0\0#0  ZԱ9R@- J$@0\0#0  ZԱ9R-D00q@ \  00  ZԬ9R-D00q@ \  00   ZԬ9R@-J8@0q@ \ "  00  Zԯ9R@-J8@0q@ \ "  00   Zԯ9R@-J@0\ ZԮ9ԯ9R@-J@0\ ZԱ9Ԭ9R@- J$@0\0#0  ZԱ9R@- J$@0\0#0  ZԱ9R@- J$@0\0#0  ZԮ9R@- J$@0\0#0  ZԮ9 -LAMK_K0,0 b0IK qWp#<  R p!`T,7T`/p Pl0` `T< ,0S 8,l \jwjwjujHjujt>Hm; -< L0S 0ahUiLj>luj0 Lj -LMTpPPH` KD ,T@0  wjujt>Hj -LKM⼠0LpK,0  T P` NKp`  ST  S Z4Z ,0S ,]ljwjHjujt>Tm; -pLP WThH 4S00 P` ` hFwjHjujt> P0-LP0P@``b@qP:b0 p-LM`@PT ph h 00 0   @@BZP?ZHH @40P000  p:#04 0qcp=<0 8p @? ?C4``@0 @0 P``p8@0S<0 0S x_0x0gl@0D  `P`P4 hujȋjx>|>vjwjȋjujwjuj vj -L M0q`,gh@0 0Q3 0 R;C"0% 5Q+  0 0,0 P0K 00 S 090R 0S\0B`P 0 _Ju -00  ujujwj|>x>ȋj Pj -!LM 0,0  0SV K^ R TxK*fl!`0 R1CT!0#0 00b0 P<KK8 [<0[ 7 [1[ 6 [9@[ 5 [0[ - [2[0# 3p[ "  @$" ;[:[.[/[娐 4`[" <0K0,.P"<K 80K;K:K9@K7K6K5PKYXzdF 0R 00 KXGX<KDX0 ,0S ,ijwjwjwjlm; 0-LPQ 0uj -LM0S@, p  a90`S! $@<@ 8 < 8@ S:#@0 $4@S`$$$$$pW00Z00S W0S9  Ppp4Q0S",p#p! 0@K 0pK p0@0KԀ0@K0p00 5]PpP@0 @X w@0/"?CQPEu qpHop @APEu@wjuj |m;uj - 8LM8A#4@ S @0 RwjPj 0-1Ls@PP sHPD0 080808<00(0@(0jTj>wjwj> -LM@T P 0S00  Q0 0 0S00hwjTj< 0 0P -LM@TP 0S00  Q0 0 0S00hwjj - hh&$00R0SLp40S  A80PS &4SX0  8 S:#8#H OP 08#H$X0SLj -LM`P&(@t1pUS 9d1U& X1U p(%BP p^1ph1UBPOVBP0 ?R#p>0p0U :00SAPL@)D 00 S090 0 R@R R wjwjR ujLjR - LP0\ 0@0`pV 0p  G@h0T Bh@8PS'00P B  -L\M 0l  h PD0 Fx@ `@ p` ht 00 0l@8 `0<` @@ PD@P H X T   8@T0$  lP00CS 8hl P@l@`lX1` Sd \  0=S p0@@S@<P@ hPjjj -0LM||p@P!f0  P 0T P0U  P  ljj - L| .601 R 0S R R @ t30S鄍jj0S R00  -PPpLp 9S  0-PL@! 0S:500 0 0-LM0@99 909RP9 HP0SP U P09P[?09P 09<9 0@9@0909 09090909090@909 040 0$ 0 PR0a/K -0LMR`(0 P1 HP0SP U (P*P5 xx=P @ pP  @yP   @q0 PR(Ka/0( G-M1vΌ \0000 0c?0cll0 Lb1a/"ba0l A ?#όO$/LNpBNa|P0PP 12c!b  <`C<2c2c!dV!B0 Ѝ*Q989QA0!0Q0CZ 0-LMP@0l0C0K00K00K0 0K0 0K 0K0K Kz0@-0 @  0@- 049 0@ 48<0 0@ 4 8<0 0 $)000 0-PL@ 0hm; -L M, 0@000 0 (0T`$p0?*Z2V/00Ǵ`0㸑 P Sa $ $$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $2P`V  [Q0p0@00T:(0$p`0, 0S000  (000 $00a$0 P22P2pf`0pf `【 jP2 2P0P -L` -L@4M (0 0@0 DK;  @ 1K > p-0L4MP"`l @`1gPP  01``1gP <$ LK0P H0  pm;> -LM@\R00S0?00,0 R00\ > -LMpP@P` )KU 0[ )0[P ;RAC 0 0@R Q$\TU )@K 0) [P.R ;R bU 0 )0[;S a0CSb0b C0;S TT 0 ! 00C S@0BTU@  0y)0[!P0U0@C d -L M@pP00 P=0` 0pT )K0 V0@S)0[)0[;S T0p00p.ZpG p-(1L|M1`P@1QP@ {p KP@ p0K @ P@00 R 00000 ,0}0   B rJ/ f lPjxfjn;,n;4n;j -L|M✠K` t @pOPPQ$0y  ԁQm @0(0$ ,pPP<@80SZ|0! 0QP0 0S4$0* 0TP U@KY 0 NRZaL0Y DRZaLM t L,  0(P 0 0!PP m ~  Kf -L4M$|`0` D 4 @ 8` <` L` P` u P@ ,Pڴ5 Xf4040 WP@D PR 40P@l0; p0S,0 0, pH /0K;P@%00HP eP0S S 0PpcW,00PL0S L0 DD QPDp @0P<\ D R40 kV 9 .01 9Zn-Z`"L@LP P04 8jjj`n;n;n;n; 0000p   0-@ P L@.P00 4 0 0 D0s 0s 0s(0s00s0s0 s 800CSB$$C$4C$4C$B$4C$4C$0s -LM @  @ -LDM d 儀p0x@0 (P 9:#:0)0 0 0 8 h`  @ 0h@ H0 h@ h0d80 S 0D@0 L0$0 d@800u)`0Kl PP KX0 @0l@X0K8KH \ D < 00 4 ,P `@ T @ PlH0h;c@) -LLMP4 0 0 S8 400H0 0S80 0< 04 0h`\0 X H<00 ᚌ4p< 0L X LP 0bV01QD @0 OTS@ \0@0 QA 0 L0,@K@P\,L @0@@0cS@1U)D0H4 @<D 0SP 408 h0R ,U40ST`HX 0R, 00000R  (`P T ` T<0@_    X0S8 h0S T @`  PT 0<` 0Q1`P0 ̃T,K P0L0PP')PfE -PL0@ Qp`:@#R D3S`D3@#0CD30  ?P?< p-<1LM@\`0=S`L RB?   BR R3 P0S&0S V0/0000 ?2΄ !B00Fp?` `! P2 BP_P  -LDM4  000 8  < <@40@PH@ '4`p$0 Sd$d40SL P @0P<3TP ʯH(3p8@`Kh000@ R*H`0K ``K`0@P 0P0K08mPp0H0P`UD<H`0 @/0@`S:(3D S:Y<X1S% Y4 R YD3L@0c04PP` `0P ?T 40 <30( P'|2 Ut< @0X@ TnDŸ 0!0Ug0_X0/<X1S@ _,w_\0 0S# < X1 S000 d *0K!tA*0[@n0 S:![00b0![000![00b00S <m$0  R*0 S`%*Tj -LM@ q -LM@ e}0 @$0@ $ -L M@`d80p0CS?XP0XPPP p | 0 D040P0W 0R 0 nPXpH<DX@004;00`P 4qX>>n; - Lro;0@$00CST$S$S$S$S$S$T$T$0 X1S  0%00 ; < 0p@-P`Q@1!2n1[/73n1Q1Q0[/ Q@& 22a11U3a11U0S@0S` C0Q@ 0 0@C!0"b12cp0 Q,9 -L4MPK@p0 D!!0CXa00/A!b2c2c!babSD[">j -LM@P0 @1S<@0 d0R0T 4S 1(S0S1S2 SELF-|0P0h 4S T 0S0 1(S0S1S2 SΕOLF0"> -LM,0 0ps` Q, a0. 0c0cbc8 0#1 0 0000 00   >0^ l0 4 Pp ^PU \e*!l!P2@0P8 Y )400 00U \F*80!l!1@Ye0P  400 0 0 , 0 0 0>.0 N^@PT \*l81 @e00  0000  \*!l!0@0P8Y 4 00,00S0c,00, a08 c@o$p$ r$ p-L$M@P0`   K 0`P0Sp -LsM, `Dܡ  ! 1 儀 |` KpPPȁ ́ @80S P104 ,0S |,S0 07PPT0$ 0 0PP`@K 40PPgP  KPPC[B "D 0@uPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1$0 jK! . . R l>K! \=33 5 Ƞ 張P!>Kn kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0`$0a$0a$0a$0a$0a$ȑY; 01 bpnKoK  m?KP H\5!:0\*  b 0 0b$10#[1 @TT00 7X "ܡ $ AP P*pG0!>0kK1 ̑  c. . j?K!#[ ̑ ,j0o; -L,M 0 D 0 ) K3S`@  ^P1D RBB!p  0@pP@01 1PP"0PS@ U3 414  h3@ 0 @/P HP) [R0 0S2 @ TD 00KP00T00ST)0[402PU52 0C4 < 8 @S%(d$d$d$d$e$ f$8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%D R h!*@@@ )K@\0 S*dgD   D0P@( ) K zP 8">@o;0">Tj -LLM@Q@D1U d0 ` 8d0K00pW !|hPp@ `K p!jh0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 eBpTj0S -L MBpBP ,0  ` 0@ P@"@2V*0S @T:@W !! 0 PP: c p  0P@0 S 0R , @XP -LM (14 < @@ Pp 0St X P 0 @S@R*0 S  R:R*08 S S0  Q Q 0S4 `! S S `0S S SQ 00 Q Q Q Q Q 8 00S0 0!D0;D0  @  k00  @DD 0R0 T0S .,K` P@{(1, 0(100,0, $,0, (00(0,,00C,0,(04 0   (1?0(1 @?  `4 W80S 0 @?8 `W? (10[+`wC00 0P0<@4"(10(1 <@g(1! 0(1,D0 001@  D0 100 P(10(1 00(1 04fY ` P ?0S ?200 '01$ `ul,DkHo;<>TjLo; p-LM@P0c0? Ad`A = 0P?`p p-LMPU`% *@0 PR@ U: @0\0 ?00@pA -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV Pp $@ Ȍ qΌP00 ``咯P@0  -LMp. .\@0  `P`$@ @cP@0`P 0  00WP 0R  $ . . 寵 -LM@. .\ 0P p`@@ ȌqΌ$  p-1!LM1!0@ 00>0>0^`P 1.*!n!00`G/ 0B!0b0!P PPP0^*!n!00` 10G?  B0 P0PPp r$ -5襟LDM0JP뻆j뚥Y,/b`5!댄M p  pp0tddş0P0S P0 0 40 < R0< @0 @ 0S00 0$0Dp0H  !0 ',0  !44 15 | ;xl GJd CJXXP `0@y'0 PV-$4 (0.6 00;N0`V000#3@p@A Q@Q0@0P K3PK@cFPFPp00 0郀``P@`*1HH@@@"0ß43$ > 0Xo;0%h%jjj >jkjjTjlld>jj{$`o;jlo;2>to;jLjo;xjX/o;o;o;}$o;o;}$o;o;}$o;o;T/p;hj2>j !P ,g@;PPKPKaBP K S\0@`@V4l0@A덣 -@ LHM0, X 00 TK0P0 T ( UP0 S$ hhD*@p;Pp;xp; -Ljp;p;p;0 l0婼 l6H -|L l0P \0\ P0P 0SD00P0 B,0hD f}$Lj@fDf4j0j>Xjp;.. p-LM`Q`P 00" 0 @0S; 0 S0S 1AGP* 1 R# @00CS@0C#HPp0 @PM0`S ph000 0@@0TdCKG0 S0S $0GPG l>4jLj p-L M@ K[A  0PQ@c=YB@DB ]BT00U00S p|0T t0d`@_APpD0`fAT 0@MA@c>> p-LM@ T00PU00S"d|0#b!T# d0@)A R!p<0 /AT!0@Ac>> -LM00 0  !!0 0 0  !!` 00S0 H0 R 404 @( (0ùhSTj4j0jXjDf@f 0-00L  0  !!0 0 0  !!X XP00CS00 S0T,0 $0@ 咹0h"Tj4j@fDf -LMpD0 @S` R11D @ w00SP V 00 E@00CS@01 R#V 0P@ d1P@ 8!V0@0 l04!0l00S000oK00S V H0V  0@0@0<1 Hk00 @00CS@0l 0 @QL L 0 @Hk l@f4j0j MjLl\jDlTl"<l4l p-\0LM`P0P PL0H @^ ,0K (P $@ ,` ;7p>>4j0j > 0-@MLLPLLX 0P_400J P@_0@0D6>,q; j4q;`jj@-A"@J1S RJ1S R2PP1S@P1S 0Q *0P (0   -L Mp @(`T& ,00,0, KAPU, ,0( 0C,0 Ul> ,0P  -L M`0  P@D   0S<0S90 V5*Y/ ,0(p0,0T0V, K PP ,0( 0C,0 U pc`,>,0V0  0P00`  d >~f}fwt@vt -L pq@P? 0aV,00,00000 ,0( 0C ,0'V 0V@ 00T   1 2 1 1s 0T@1 21,1<,0( 0C,0 ,&< -LM0 ! @ Q 1Psbp 1 81 U <0!'! -LM@!pPW. ,00,0 b 0Q 1s 1 01 U 00Ui'   1 0 1  -PpL(`0S @ @ -LtM`p됀KP@  0 ,00,0,0( 0CP,0,U 00S@P p `7P|; -LMp`PP* ,0 0R,0 R0S<``0,0( 0C,0,U;-`$@ 0  `  -L M, p0 , 0!  Z PP0b\! Y!04   Vg0EEW  c03PP 6MB@Dx8 X0  R@0SB4  c03P- MB@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T > -L Mp 1Qぐ2 A' 0a |3fv3`  s3 fm3 RH02 0"2 SA' S', 0 00202a ,K3,0@fC300202c0 <300Pf4300202S,00000''' -LM@`p PK 0S Szhh1 Q100L[XP20(0 R 0S00P P0 0Q 0V  000PW 00,00,0 0S0@  0^ R1s 1 11 ^ P_1 11j > jj; 0-L@ZJP2T @00 0S 0(d `00@2000@ 000 @2 @0`jLq;"> 202 -pL<ZP@ b2P P0\2f@0 `P0 20BT0Ҩ 0 ' '0 0B @B`42 02!C+2 '200s @` V 0S 0S ` V 0008 4 < ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV' % 0 A}?x`j -pL2`0C(2BP@U R ,00,0 5PU@Z000S&0202SP P4P <PdhZLJ''~'z0`j -PLMP`; Q 00 0SU ( K 00CS 0,00C,0,0 S( ,@0H!6,0Sʸ0  0S 0S@ R000  00C00Z@p0K$8K @㲂Kp@ 0 㴂K&,0,0C,0I8p0K$8K@@㲂Kp@ 0 㴂K Tq;j j p-LM0@P3 R.`P(0K$``0KaK`P`01K!K 090 0 p 0 0pp`aK0 90 0-p p (("` -LMŸ@0p \`P 7 R `0R $Pl U. U  00S# 0s 0P  00 0101 1s 0Wp1 21   P1 1  0Q P 10 1 1s 0 W 0pV ` 1s 1 2 1 V1 211 21  l p-LMP@` T0 @ TpD -PL(p`@R0T 30@Tkg  0-@MLDPD 0<PSW, (@0P@JW0D6>\q;jhq;j -4 L014 s$ 08000\1>40$ 0S00 Q0 0 0S0040$ Q  0-L@gPP 0 0 0^ P 14P 01! 0 00  10 A 000  l(04  1S0 1 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  :P000(0!0 (0p -L M( 0 0@ 0(  1K 0 D0ϠAl2l1!Bb!!  <d=Mb p- L M0`S K 0 0 0ϠAl2l1!Bb!!  1P 01 -0@ 2=4=<@0p1>1>Mb$ -LM<@U= 00C01> P0 0 -LM Kp$ K`PU0  0 00 0V@. 0P@$@$  00S0P `(00(0 ,00C,0 (0,05j@1> -L$M`8 P 0S ,00,0P^P$< B @ P !!@4 0PP?4p P" @0 :0GPUp  0<S< ' 90 P B1 0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,450@K 0PP@ -LM0pS,p @`PsJ ,3Y 0S8P < !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 㕬80` P (00(0* _  (0  (0W   , r(0` R0(0 B  c(00(08 UPP( W`4p8 ,0( 0C,00p,0 0 p p00fP,   ,4 0,0  80  0Vq1RnU rmPp ,0 0 ,0 00R]*40QUY 0V PUR!0S 1>j -LlM Q$P  S% 4 P,/A#bl p p@K \0 0  % :Pip T4RL$002c2c30 xK4 t0p$x0P 0p 0 =9@ =C  0p 㩫0pS`XQ#0#00F0<2nYAp0Sl0S x@K4xp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30  Z0  h0  !! /l t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 1G 0`01 ' 0 (0 0(0 00C0ZH٪ " 4/ Yp ` 00 0 @(  ( 00C0帪800 F Ԫp80 P(00(0  B ᜪ X, Z ⌐ p l MbQ>?Bpq; -LM0 @$P`ᠪA@p 0 S m/n000 p-LMP$`p+08O*0 H0p -LM0, X$p4 1@`T 0WP`/ U@0X8Q q < 1@`T 0WP` U@80X:l\T,0$80HRTP4,00,08  4 CTPjj -LM0@  t h m `20 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 4  -8 L0pS`( 00Q@LT 5 0 P!4*0`*4P 0@4P40Q000p(0 8\ 0< #4# 0Q80 @4$8< 0-80P@Q08#4#04 < 0!0LS0  Q0 0 0S00(080 R40hS40,  , 4ꨔj 0-@L PQ00  0@(00(0   0h 0-@L P8 R 0 0 00  0 (  ( 00C00hP(0 0 (0!P -L$M`"0$0( PP@8pW@ W @4hSü0 0 zP@T0$0!0@;00 0 VP@1 I 0 0&P@  0 @p 0,KRP@/, 0@0b 001 Y$$q0S  p*0TYT$1 !S@#@3R 0! $0S: 0S* @T  0 4`RP418 (1TP#2@0T00S DTj,">"> -LM0D H" L P0  !0 0 !D"TK0? p1 1 Q Q Q 匡 0 ˟l1 h! n?K `1 \! >K/K KT1 l < dQ 0P 8P XQ HP Ppb:ЕH0P @ D0PP R   R?' 0@SD0? H00H0 D"`Vp H0#K`P2 Pd7 42 +Pp?K` 0"R? 4"W.P42p@ ?WpWKVH0*0Q$8PL" 0pF` QP9P'O?l 0  !0 0 ! Q0@ H0 D"0`T2 V 7  42 N+Pp?K`0"R T" T" 4"-P42p@P2Pd DX0 @R T"0<  P"0100b0P 0S42 p !P0 Gh0$P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00Pp~42OKcT2( 2 K P2<$Po = g+Pi & |1S0# 42 P(42  0> Pp p婺p @!0!!0 0)0 !!0 w QZ 0  !0 0 !2 0  !0 0 !0  0 000 v%P'\tPL"p 0CCz C<,0S KPD< H2 K( <P800 1?l 1S H R < S <H0 7  @0S@0[70@0S0  !0 0 !K < l?  0  !0 0 ! V@ 60 0000 0 0  0\j OPL 0 !0 ',0  ! L@2  0 202 0`  20082 0S/KK 82 4VPpH;n K⧸PpD 0Q @ GPp#H@"D00D082帀8"0082@"82$ 8(00(08",00C,08(0,`Vź#.< 8n@娹\!0Q8P ,OL"p 01!P'=;O< 8H0Q 0Q0Q0!!0 0'0 !!0!!0 0 0 !!L-x\b00C ꜍j">HafTj1>J<> -LMp$K4 ,@P  `@) PT4(  01 B10R,0 P@( ,K w)Q'00K@8,+P4( 0,0 B0RP,0 ( 4K  ])P@"`V@J,K R)Q'00K@,+P0 ,0`V0P,0 Z  <)@P  -LM40H -L  -LM80PS$  R 0000 0 0 ML0!!0 0*0 !! , !00 ;00!!000 1 4 4 44 @0S   < 0R50@0@0@0 Q 0 0 0S0 0 0PX@ T `,Pp00 KW@00 "[R? LH .L0  LH0Cup0 C00L@L@00 1}X0S L@, R 00 'L@H,1H0S`!000iOi5,0!!0 0+0 !! P |0S P00004lꢷxP^uP   0!!0 0 0 !!L+7$!$ Qdjjjkxq; 0-@P@L8r0< S<00@ @@Pv0h+1>1> 0-PL]@T < tR@0@0@0 _[00 0L50L+N 0)1>1>o; -LM0S4!P0p0c00 X@T `0 P@T^ 00")P @ q 80S 41a R  ,0S 5\= \   0!!0 0%0 !!8 Q1 K0  &'   0!!0 0*0 !!8 Q R/0 K400 800Q2 Q)\P PP `\`6, R 00 +h0h  $R$ #R?h LH 5LH &PoR? K  &Pf z,0SRvq;L0-SXL0P QP 0,0RT0T0T0 X RP X0TXLT伍j -LM@L}LP9  R 0 0 0 PPT0T0T 0  P! 0S ]L 00C0 00CS0 HLL0 0,CL *Adjj1>jȬj -LM00@ hGA -LM8@ $0 @@@L8$ -LM 0 : -LM  l  \ \  @@    0 0\$  -LM@( K 00@ @ 鐭j -LM`HxDP@UD ^P, ^ 0P#O00UU   t0S: p0S*F0#0C07 08P `JpP,5p\"EE( "x$ 0 00 0  000 !0 0 0  !!, 0 0 !0 0 0  !!l@tJ0  M"0 p0 000Po, i, c 0 W0 00041 Q 00 0  !0 0 !,0040 0  !0 0 !,L`@ 0  !0 0 !,h 0 X0h  1D0S @,0P<#T@ 0 P@s d 0  P0,  8 $ 40 0000  Dp0S 67cAPß0 R800 0 C8 P 1<0S !<0@0 0Q80 X0!P@ D P0T0X0RT0PD0XPH000D  D H DP L L80R\08QF 5@ w)2  5 Cv 8C"40,S000000000QP4 R 0000S 00 P8 00 .0 !&00 *e 080 0800 67c@\,0 <0 0000  @, 0 0000  2 0 0 000  'f(@Oe(50Qf0 1>>Hf1>c;W>j0%h%Ȭjh1~$~$pjljhj ܯjدjԯjJkq; -LM@cP pP80Q 80S 41 R Qj 0-0-@ML0KP -@ @P@ 00 !0 0,0   !0 OU00(j P0-L@8P P08 N lq; p-h0LMP`U@  pwP(  0`@PpLM됕j1>q; 0-XX0@ TL  P0 RP @T01>j -Lp @P`0 P 0 0p`p 0S 0 S  -4 @Lxd `8pP 070 ' 0<$8 R0P  0ASl$$X$X$X$$$p$0S7  0 00P 0000  0 0S0S 090&000 0%0P0CP0 0 MPP000 R 0SL0 0 0 0 90 0S &0SJ  0 0S0P *0:0 R0U:0090p 0S$0 0000 0$0P0CP0 MP0S000 0$0P0CP0o 0 @ 00 PbT 0S 0SB 00C 0 R0S00C00S0  0 o0Sl0Si0P 0S 090 0S$PP- S0 0S0S090p0S4M (K$K lp @ q;r;8r;\r;|r;r;r; -h2L MP`@ DD,P (M K PkP_ PYPppaAQgQ0 0S1 V>0^Ã0WPŃ. B&, !0,  00 HP@+ t!t0 0cC61 Up ,0Ų0 0 e R0 e Q @000*10T00S L 0@Ppp P P pp P p p P  P P p p PppPPppPpp`j2>s;8s;hj1>jjXs; - @0 0cC61 `BL!bQ˜`p T 0 S0``00`m铜 0&> jjhj1>h0@-0`S\PX0 Q?#/0 IS0B!@R !R %501>1>1>f -LMp|`00 Kl !@6$ K@هLPP @ 4$@0@;0W>1>Pf1>j\jj -Lj|s;jj`jЪj@jj jj P>0à PP PP @P@ P P   P   P  P P   P  PPP -0Ls; -LM0@ ;Ph? -<0LM   @)0Sh, l -LM0@ CPhp -LM @ Ph`0S00 00 -0L88!M11p *`@0 PP0S #@ @ 0@ 8PK0R<0 " 0)"< P?"Y @0 #"P "9 l p-LM@P`@V0D  Ppph9# -LM00 3`0 P0Q&Q< , 40 0 ʚ00@00000嚚0D`404x0, 80 Sl 08 a R` 00X 0@ D 0D$;D H 0S8<0 @ ܯjjدjԯjj$jjjxu;D6>u;ju;ju;dju;ju;ju;Pju;Ȭj p-0LM 0 !@PT` 0S @T) @T 0S @TP0S00`pT )UpTjj -LM@ 00S 0xGu;,00P 8 RLP l<0 40 P 80 S<Pدjԯj<0 40 P 0 SPርj$j -LPp@P`$ 41P   4D RH0H0H0 40S 4a0SD0 D0H00PH0i8P P BT` 41 000p00! R00!`00a 0 10|A4 00 P @ 0  !0 0 ! @jj$jPj -LMD @RH0H0H0 40S 041 -LM 0@ `R x0S0x0 R000 00CS0 hRB PBPjj -L0P4LQ@p ` 0S X@T 4Q 0S P@T500CSW00000CS0 R00000CS0 -LM@T  50S D@T@R D@T -LM5 `NP,@Kp0 @:08 0> 0 0 <$ p @ h2Ll p@000P<bGT9k<v;v;"!v;w;8w;QTw;w; -LM0 Sn0Lr0 R 0R  R RmPPx 2nP@h _aPU T 50LPS 18 T *F0nS& aS @0*T00S1@T<1$l FwSt0S! P((04!5U8`P000t R 0S΄ 0 F 0FwP 0d 0yF|vFxtFtrFpmoFw;ܯj lw;jw;Z@S0S0 000@T 0 0S @TW pP4 @T   D@Tp8Pܯj p-LM0P0@^ `V 0 0^ V0 p\0T@ T@@ TP 0$0 @@&ؑ0" p-LM0(@KP `P0  p0 -QLMpPI0 @ R  0R`0S  0RnP-` Qڐ0V 0GSH%%%%%%%X10S0S0P 0R W   Q0 PQ0ba>0>0$ 0|0ab0P\0HL0 /<00A0@0 @2>2>> >\ 0 ~ -L$M@ , 0 40 ;0 @@0K @K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% dY. p_Y0@R/ `Y"M2 0S @##mSPU`!q p0奎 @K3' AY  0-LP| 0\ @ IH 0h0 0H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L9@ s0 0 pP800ܯf(jw;D6> 00CS0D:(j 0-P@LH@ L@0< % -LM8@L ,0,P000 _>fw; %w; -0L@ p0P50#̏`@0S 0S 0S 0P50#ᴏL R <Q@0@0@0AL R0S lj -LP M@(Kj$   c(0=ɂ0aRC ͌(0 $ ( $  $0 (0=B`0`R L `L0LS<0L08,00 $ 0 0, jj@-> "Q@@00 00 0S0 >0jj 0-@L0S 0LQ050< R B0X0)P@P R0000 0 R0 50j lj 0-PL@ 0S  000@000p0h鉂\0^  00lS R00@2>2>w; p-LMP @T0`SX 0 R0Z<00@4<0 R00T00T0ph馎X R44 44^ Q4 ^<000 <0@40P<0< 0bS -LM@ 㣎` `00CQ000 0 S0  0S00fh2>2>w; 0-PL @T0X0CQT00X0 0 S0  0S004 <00CQ 0h:,0 P 0SP2> 0-L@PP XP 40S P0<0S -LpP` (@ T $0 `*0(% -LM@ $0S :S0$0$ Rh.0( $0S0$0$X<x;x; -LM@0 < L 0P0$00k)%> -LM$0S@ 0$0$0 S 0$0,0 hL0$0hh>0@-P@Q: P8 SO 00 5 ^.p*%p*%p*%*%*%*%*%*%*%p*%*%*%*%*%p*%p*%*%p*%p*%*%*%p*%p*%*%*%*%*%*%*%*%p*%p*%0 Q \ 0 Q \ 000 0Q Q \ \ 0 Q \ 04!4 0S -L M88 0@, (O 0@5鬴jA%D6>`x;j 0-LP 6(O/@0810j(0(0( 81081 0-(0L8!PR @(@0( 810CS810(0/7j -L M@PD^`(P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0 PP P 0 $00$0 $0 0$0  -0P` AL r(@媌01 0!000X8<0F 0110010@ 1 100 1011001011001Q t1! Q0  !  !X10110 1m6101 R100, 0  !0 0 !80S 0 0S 0  !0 0 !0  !0 0  !0  2>D- 1B#20R00S1 11R 2> -@L(`P# pPr& @101 ! \1010!! 0  !! !1S0 10  !0 0 !PQP 2> p-LM1@0P 㷋0`S S `㇋p0!8< !S08<1 1000 -LM(@!1!0108<1 J0'P hx; 0-LM(@P1 10 1Q#P0 K $P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 |P 0-LM(@P1 10 1Q"P0 PK P0 1101  !0 S1%Fτ"0#1%( 3(F EP -@0QL`p% RPP @ 02PTr 0 R0 b0h -LMPS`p$ (1@T 80S@TX0 Ġ T\0P V R4@T 80SD@T0  0P V 500CSPܯj P-Lp`P$ $` vP @T U 00 V  V 00V U U U D@T@P@ U 00 V V 00V U U Uhi -PLM@/ P h p-PLM`P @T U00 00  D@Tp@ -L M0A P`p(@10(,q$ai%0! <  < !@ !101! 1V01 0!10101 2> -L M00p P4 rCp C00  0G4 a0 1`1000 10 4 0  \#0S00Ň 41 RG  0  ! 3 ! 0  !  !.!0 %0  !@0!! 0 !!00S Y, 50SN HS ,)4 RLo0   (200Q00S#&100Q00S 0!! 0 !!R/p .02S200Ň0!! 0 !!S1  0   W Z& 0!!0 0%0 !!0 0R40  0Q t0S0500!! 0 !!Yt0S ~ {Z~ 50S{l 2>"Mj -LM0`!30#P03\ +#p0@à@0!! 0 !!!0` 0` !> S> (0!1S S  t'80`0  !   !80S  41 RR?Z8Z 8 \RZ %Z0`  P 0@!à 0!! 0 !!  0  2>px; 0-50L`0 , !0 0, !@@$!0 "0  !  VhX0 @P0pS ·000 0@@0ꬴjLj 0-0L@T P00@T00!!0 0"0 !!L 00 L ܯj -|1LMP @0r`(@0 !    !1$!,0 0R00 ,1(40 0140 00 ,0S5 㔇1011  !1 1V 01 0!10101P 0<  < $ Q001$1(1,140000,0 0 o l 2> 0-0LP@ , !0 0, !DD 0001 0h(0$QPPJ 2> -p#LMM0 ,0 00 @`$D 006:D R @0S ,0 S ,PPK~" 0p"p6!P 0` 00 K0- 0P 0 @ 右PP 0MK<1   0aPP<80S P <帹0 <H@U,\8 016 (1S ḘFK 0 <Dh!<0"00.<7k |KP `!(P $1pKh0 (!`P d 06\0 <&X  Ơ0T ,PP< 0NPP8 8[<P p`@PPPL 0 9 8 0S5 0S$1 @j<Tx; - LzN -LM@P`piT0EP@S $0R0000 0 2> -PL 㺄Up ``@T @Th還(`@T @T2> -LDM0`SP\` p 0B S|!XKCP@MX00C SjN%$P%,P%4P%LP%kh/d' &$Z%\1ԅ#8' -LGM⼨\, P`p @# 0B9S9R%Q%R%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%Q%R%Q%Q%Q%Q%R%Q%Q%Q%Q%R%Q%R%Q%Q%Q%R%Q%Q%Q%Q%Q%R%R%R%R%R%R%Q%R%R%Q%R%,0 S ,0BFS񟗙4S%LS%TS%lS%tS%S%S%S%S%@T%T%T%T%X%T%X%U%xU%U%U%U%(U%xU%U%X%X%U%U%U%U%U%U%U%U%U%U%V%TV%V%V%W%W%0W%@W%\W%dW%lW%tW%W%W%X%X%X%,X%4X%PX%XX%`X%hX%X%X%X%X%X%X%X%X%Y%8Y%TY%\Y%L6 8646  6Ɵ 0Ɵş 7䕟0 0K ~PPW 0S0\80Sro0|i`ş0 L@P00W00SP 5 E0MK 4 G41P0F>B 3=944 /ğ0 L@P00W00SP H4 0u 0p4cğqğoğm 4 ̠ße 0[ 0V0 S<0U KOK0 PP3Q p3R  04L 0@8C,3S 1 01Q2 2 (2 z"0L 0Z"""`2^ P2R  0ZL 0/4BNK 08 zPPz8!0BSR pnL 0@e!!!1 Ϡ&-WL 0QL 0wJL 0,C  0>( 04PPF_L 08$+L 0m $L 0F !jx;T2;\2;e2;j> >ȵjصjĵjja xjĴjj`2;:> :><>uj2>ja08j l jpjdj5>0>1>1>l6>j4jjdj$>H;> -LMP \Q`@ 0LSZ%Z%Z%Z%[%[%<[%P[%|[%[%[%[%0\%\%\%\%\%\%\%\%p2 -T2P"0 820"06"0 0b6 :XP@10S1MP@1!l0  |!A 0@`10S (KP@ (0- 0S 0 _P@0dSd00S@W00S0000h0@FP0 P<0< @ 0@cFP0\afl">fk2><j2>jеj2>j̵jܶjԵjضj 0-LMPR@@ K P0 0R 000, p-LMP@`  0STRPPP  0T0\00S p Fp p -PLM0 @ 0 SR0 \K  0 @0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  p0T0\00S p p p M-PL0@ 0 SR0 \  0 B@ -LMP  -LMP -LPp` @U  0S*T S 0Z030#WQ$U T 0S: 0W0P00S s0 00@SC 00@C -L@`pPT 0 S:U T   p-LMP@`P  0S:T\P P  0T0R00Sp  p p 0-PL@P 0 S:R 0\  }P -LMP@p`& V00P eP P`FU@ WVX X`F VPX@PU0h00h 0  !/ jj -L$MR, 4 00 8 p04pS,H0 D Q ^0S`@0  P[4 2< @T 50S Uff%le%g%g%,g%Pg%dg% f%80S$ @T< R < <2 ,0S D  0cR0  080S 4 R D00 O=0H0S @0 WSD0 0D0 4Z 1/#4 P@   Bpj@ W*D /D 8M .P8/PG00 41 R41 0S80 00 41 0Sl00 00 Q~Q Q0SSPS ``@ 8 S0ܯjj p-LMP41`  0 @P 05 0BRS^@KA AAA< > 0K0 1 z_08 K10V, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 L0T!P=9@ =C, 0 ,0 ,00  "$20 $ 41 !01@0 !<1@5  00 0 1.`0` X0Qt0V/@> 00"3J6?B1!2 -QLTMQ0DSP Y 500CS00   V$0 00 K 80K`0 \ H D T P0K =p`KX @P < $ XKVfP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt P`sxP K0@@ h0K `0 `0KH \ X0 T D <  $XKfP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 $XKeP`@P@*0S @T:0l00S0*d P`* d0 T h0d 0h0   `qP` pd0A0 d0 p x0t0Qx0 t lR:0l S: `$jz80dKt d0 H`,0  TT070- -LM@P|0S R `V `VPkPd2"@`@  @Al2  ;`pV@E 08"S0 g,"*@"0P  pl}$ (  0 08 $ @ ,0H 4 P <0X D `0L w}`TVW00`C00  T 0`V p 0 P@"C}$ ( 00 08$0@ ,0H40P <0XD0`0L -}`TpV2>jj2>2>j">@-QMX@ ^@ L|\0( Ѝ@ Ѝ l !0Q0j p-LMP^@ 0(`K^  Gy0@yypJc@0T0P00SpXafjj -LM0@KPp'sU  y|8j`U@   0V0T00S@{ -Pl`L@ @ px>p00␀`t`00 @@ lj 0- 0RQLP@Q t0 < x0  !0 0 !0  5 @00@0 l!Q0x$ l -p LM00K0xB0  !!0 0+0  !!# l 0-0Q@LP) 0  !0 0 ! R 00 10 P t0S0 50 0QtP0 l 0-0 SL@P P  R 00 10 fP  ( @0000 l 0-@L xt0PS 50S 0  !0 0 !0hwd t0S20 ?Q 00000 t j -LMp `w 2?@TV t0PS  UV@owU000t0 0`F 5 R0S 050嘐.0 D jMjl -La  0f -LM 040,0 @ p0 c`0E"0 $@ R:0S*000, R 40Rx5> -LMp(K K P`5 (42@ ʚ; -LMp(K K P`5 (42@ @B 0-LPL0@ R:0S*000 0000f -LMp(K K P`5 (42@ ʚ; -LMp(K K P`5 (42@ @B@-TpHP` 40 ^5 420@ 40^ʚ;x5>@-TpHP` 40 ^5 420@ 40^@Bx5>0-, 4,00Q0 40Q0x5>0-, 4$00Q0 40Q0x5> p-LM `0@ ? 1QQ0 U 0 0@ RP0R 0S  0R@p00 0$& &>5>|5>0x;y; 0 0x5> -L,M@KL L`0Op0K! (L04K @00S@,04 S00S0B40  0@80 aS :<0S*000K0Q@PP40`0#0 RX46QL@@P 0<`@H DP $ K@Bʚ;fxjf,y; -LMP84 40 80 4PD D@D2p 0g^ Dp @@@ ` 0@ pp% "0 0S:0S*0004pK0 K0@, R:00S*40040 0  $04 @cT@T P@DD RTD4 $ 0pKQ_`5 42(0400K,0^`4542!000^O0$  BE!;!ᣎqpW!᧮ᇑY ! Q P)o `!nQPU`  D =8@D@@p @$08@ O8@04 40  @Bʚ;x5>|5>f5>5> -L,M, LK@P`p   0P@ ,0 S , P h0@T  zPP @T 0@j|5>Xy;5> -L4Mp@0T,0 P ؀` @ `T ;@0TP0 LpK 0   $ M @`T 0 P@$0 ,0S ,5>jMbf|5>@-QM@ 00CS L%x%%%p 0 Ѝ@-@Ѝ 0H Ѝ@ 0 Ѝ@ 0 Ѝ@[ff@-0 MR0000 0 `Rc =9 A = /02|@0 $ 0@Ѝ @0R 0r000 =9C =CS0 j|5>xP0- 4 0$000Q  00$000|5> -L M@ p0pR K\0 R 0HRb h#fv 0R~ly;ȵjy; 0-LM0@S S 0PK 0SPK60"c11PK 0 0-LM@;PKP  0@P0SP 0-LM0PSX@ S0 D0  0QK 0 00Pʚ;> p-L,M `KP  P@ p H1(@K 0@a(0 $ PE0S?ZP0U0 p@0@#T@S8K'4 ,08c00Pc0 A00 , 0 ,0  ,0 c00Pcd0 A@ 0@ < <0 @0@KS0@0 <0  6P@0KpMbfy;ʚ; 0-LM0PK S@ 0@S  0 P> -LM@wPP P0S0S Kl00(K"c1 1( $0 P K cPK ]P> p-L M0@SP0Sp9P @K APP `KP P 0-@LQP(0S0S =9C =CS x0S0 =9 =S B P( P wPj?B -LM0PS@9 .r0`S ,@KŒq W4pK8,@K$ R Q 4R $  0 `cQ$  =9 B =$ 0 00Q -L M0PSp`@T 4K P6\DT@ ,@KP4`KP 0S#P<K,0S(0S D( 80, <0P=9@ =C, ( , (0 | q @ uq0$K $0 XP?B -LMP`^0S@$pK0  0=BR L0 00$ S ,K ( 0,cP=9l A =( (0 , , t00@Q   0R?BL0Q R 40RQ R 00R0 ?B>0S0 0R0>0- R \b =9 = L 0 0 aS 00S 00S0S 0 000 aQ 0=)0C -0 p-LM@ KP  0 `0nRC(0 ( =$ (0 $ S` ^P 0K ` p $0S -LM@(KP`e$00`( S a,0 =90 = B0 ,0 U QP 00S K0000UQ000000!0 Q00jj00  0-PL@\s0  0|0  0 c0cR 0 0 PP$0hLs00 PP5>Pjj -LM@<,s00 0 00000h+s5> 0-Ls  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @r@T@05>Pjjjj -LMqr0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0SoYrS0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@-rrj5>jPjj -LM@PT 0倐0c/a"|,K0K t t0H0\0  b,G$0@TjPjy;y; 0-L0LD@~<q84PK@TP0hqPjy;z;5>jj -LMP@T0@ < 000M0 05>j%5>2>$%j -P0LM D@R80(0 h+5>5>5>>j -LMH@0DSK40$00 5>j5>5>5> -L MaPQY P= P9X0 P@0S ,Q0S" PU qQ0S PQ00 $P 0tp K00, 0{P@U4 440$-5>5>jj5>5>>2>$% -@ ML400 @00@h,z; j5>% -LM8@440 P000 @5>4%<4z; p-LM `PQ@P0 8 00 P`   0p̪% p-LM@ m0 0R`0 P 0 $ Q0Smph`z; -LM`p V `m@hPfm U0 0p 0m0 P Vm 05> j -LM@<0< 0S$000h가<4%lz; -PL Um0`$ @T p0Sp0000m  >m`\X0@0CT00 4 000C0m} jz; -LM@P 5 -Liz; -@@LM 0,0, /C!b0 h%fP%>gfffj -d0LM @T0< R@ @000l000000lj lMjl -1LM|!`0Vダl1, `d1@T X50 0CS0 00 p Q5p0 @T_n1,o- ldVpPl0p  l h00p l0^hA1Q |0 T 50S d0.UlH 0#1!S  004jk0jܯj5>j> l! p- LM0 P1R@0hh00BP0 0CS0 kP 00CS0hphk 0-P0L @8l@0.0P50 @00@0$0hl l! 0- `0RL PlH0 >@5  D00D00hkb l!z; -LMq$PK`$ PY 0 b0aS$ 0=9 B =$ 0 $00!Q=9A =C 00 P/0S0S @0S0S 000kV050 000] 0R 0R 0@ 0S$l?Bk -LM50@Sꌲ%%%%%%%%0500S0 S > <0S 000l00  R? R  B0 , !  !z; lMjlT h00 0S0#4 P,0 <0S0 "! lMjl 0-PL (kh0@0$S$0#h001S 0 Շ Ň0hj!-000 00 00@5>jjj -LM0@S`p>0S,0S00S7  0PS0U 0S PPp0Si0h h0Tc0S <]4Zp0 5>{;${;؜;8{;<{; -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,` @08JC8 1!Q4K 08SVj5>h{;|{; Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00j -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0P4K 08S,@>x> -@Pp L4`V 0 h$W  0n5> p-LM @`PU 0 phUp{; -PLMp 0 Q` @@i`P 0,0 a0S00Q \@@00 `:W?  $Y   1P @0S S $@0SP #5 ,00 R \ 0R0 S0 0R00 S00j l;jXaf{; -LM0p@/P`N PPG 0 S0 (0 @00= 0P!P2$p@ \T00Sʃ0S0 sPp T p0 !R0,0B!0T|2 2S00S \0 !R Q{;{; |;|;4|;<|;D|;h|; -LM0`<K  ,0 r @0Sj 0S-aP g,0 S ,A0S S: $@0S R 0X10  0P 5 0Q . U1S RR 0 R <K[~0000 0S Q0 0Q B 0 R00'P j|;x>jXaf|;|; 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ bP4  0@ P0 0h'4|;j}; -xpL@`T 0P$ R U@U00000 j 000j0  B Qj p-LM`` @0P R $0S0  P pP0 j p-p0LM PR` $0@S T pV V -P W;j -QLM@0Q 0AT (00@T,00,0,00CS,0b@-$ R$ $@@0^"*$0S $@ @0S:$0S$$$X@@0^:\ 0RX X0R$P$0S$ X@@ @0R:^:\ 0RX X0R$P82P *0P ":p-(0 S<3(057<@@0 0<080Sp ( 0 P0Z;@@0 0< P `0;P(@0  ;0'}; -LM 7, R0  '0 0PU < 4( <"4')Q 0`<4<("4&<S4` x'48<#8S8p 2\ *0R :P,(4@<` P08PDp,Ll T \| ⴠ< < 嶠4D 尤 lh`KH@ o @|r00 @00S, r  0S 0S  Zq r 0t@T 00 j00S0000,0S0?0,080S00, 8Pʐ0E/S  7<x' @0P` 0  0 QnZPڌ0Q00S Rmڀ0|@000\00S lH 0 P P  <@8S ^2"0"P# t0S t@0S0Ol@( t2< 00lp l/hP \lH ;@P@`$2> G?Q P' @0 0 p0XW}\{ P 0K 00   000S? ,S S    S @ 0 0 T000 0@ 0MS S x@K 0\x  K00 8S  0CSS S0 0& 0 0tP00$~;8~;UX~;p~; -L$M80PS,  (0S KKT re 1R0S PZJ [,@@(208 40 R00 Dڸ`帀0p 0@Q6R40 4@ 8@ 0H0 0@@K H0@K@@ 0H@ 0@RQ 0S0@ R 0  0Z (,e/ e/WEV -L,M, <,4 D ?08p ;"4 WLp 0 Pob , X8 0S ? < _008p@0 @K( #<0 0@$@p8 " P'! `VU@<0, @@K0@# "`P PU ` 4,p0@ V ,4<0(8L 00 @@0`pF80X,L %0{*,p0@, 004 ;0000`Y~; -LM`D 88#0| 40 , 0 a@̡ 00!1  0,0  X@<  R TUş d <  B?+$0O@ 0 W5 U44 20 @8 P0 '0,0  8 0',@P0 '0 p` '@0@ X < (0R 0 &p9d&~;<~;~;~;~;~;;0  0 jjj -LM@;d 00 0 -LM 0@  e0SP0 L00@ @0 00$0@  jjj; -LM@= LR 0@00  0 $0 BR  `jjjL; 0-P@Lc$0X0S$0 0hc -LM@ Pc$00Cs$0D 0KX,00 0aXS40  `=98 = B8 40 `408 0`Q=9A =C`` 000K Z U@H(0` p@0ʏ  c80K*80P@ 8?Bh;D -LgM 0,0 1 Ġ "88 #$$    $LdHA  0*pP;00-K0PP*0*KK "0 @@ & .K 2 S0 S 0h,0 S p, S`000 0H0 040}xfj l@lfedA.$;|-;̈.;;; - L P 0 00  _%%%8; , R  00SSAπ " 0 R$0|$0\| -LMP@ PtLLqH0@T 0S$ @TcaX;l;5>j< -QLM`P6 0 SaBQ00`R00SppPE,P@ 0@T 0S  @TyP00SrP 02$04 40 5>5>jx; -LM0 ,0  PtܔW00 `KW 0S  J_P@_`P  0W0T00ST0 S*R PK0 EP p0S W 3P#  _Pa@[^|P 0W0T00S 0Sw[ ((0"4400$04 ă\ #3C 0S x ,0S ,R2  a 0gb!((0"4q!$#@9 0" S!$ "^P@uP( ,B0U00p  "88 #$0a0""3p  "88 #$0a0"""AS   0KPM 0S \@DPK 0|Pp ,  3@a 5PP 0 2$40 $`0ā T@L0 P&븍jj5>f;;5>D;!f R0 00  0 f -LM`Pp ^H QDP?1@ T 0S2 @T0NS %%%4% 0 -T n]0E]0 PBT 0 T 0S 0\fj@@ R4 000 S00 $f,f -L M8@4^ 0 P00(f4j; -(0LM@T @T,f -L MV, 0 XP. ,PG)@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000 0  #  AP@ 0-@LTP  @T000@RT R000   00hĿ -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hW 0R 0000 0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP)  R 0S 0S * R 0  0000 0P  # ; -L4M@`p`P, @jP@ ` P 00C0@ @P T4 : P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  )<R0#03^0S< 8@ 0P L<0 0QP8@0P  000 0P' ,#,0 p0@4 L , ; -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp000!0D 0W ` U*00 U R000 OPp  B Ȁ;; -0L@`p# PPp0U W (P  P @R000 pZWP$@@ZT00;4j p-LM P@* 00  00 R 0  @000phAZ`h[Z0 p0 0S0 0  @*Z` DphY4j -PL M@ L 0@ @T  @T _;4;\;p; Q0-L@0PA 0R "x0 0 PR0 R P P0000 0S0SS RRja0jj-0x0 R0  0^0\\00 0RP00ja0 R00j0 jj -D1L P@pY 0R`) `Y000\ 0 AQ 0 `\ @1@!T P` 0Q 0Q`0S@0T``` P` 0R #Y Y#jj; - L@P9YA@`p 00( Sp Yjj 0-1LsDP@   0,0, 800<0Y00@X j6>j -LM@ YH 0S00  Q0 0 0S00hX j<0 A P 0-0@ LRPD00u 0hƮ00"000 C0jjj p-0LMQ@. 0Q 0Q p0 p` X0 $PBxXU0 PP0Q x0Q \ 0 0 000S$  00000}ff@wt@jj~fvt 0-0LS@P00 > 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-$M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000$Ѝ0\ 0^ : 00  0S   P0@-0 M @00 Q \ 00  0S  0000 00 0000 Ѝ \ 00  0S@0 p-LM0@S0`0C0@ H0P0bH0 R000 l  V 0S00PP`<0 0C <0 phl0t!$j -LM p@WpP\`s V`UP@080 $Pl 0 d0P  <04h(`XpHL000T0 RO 0$/">CXl05%03l05 5P% PB2P5t% }`,x`0@0`}P0`p0x |PPPPPPPPY$0S P 0@`  0 P 40 0]@:D6> j$j(6>;; pY -LM@Q  $Q R0 00  0 (6> -l0L 0$j p-LM@`YPYU 0 SU000p0S uYP}Y -LM`L P0Ru PUp+P@  PUT  M000T  h d0 h  p*000@T^ R0000 0 H L0 B0H L0 R00C0 R000  R 0PP0 00 S  R000  R 0P0P0fH 00R:5"0S h  d0h  0S0P d=;; 0-0LS@P X X0000 0-L MX0l @  0Pt0tS XP_ 0 0S0PPP 00C0L0 0CH L0h0Q H 0h0 R0000\08 0S0 R000  R 0000 @00C\ 0 R000  R000 4K/t0 S:dԁ; -L`@4X@P@@DPP@OP@  vpWT  04U004PE804 R0"80%XT C -LM0(,S00pP 0@`p`@l0) |x 0Q0||Z0@ 0j@@H00AqH0 0A0 q@@$0@ 0 S<0 p0S<00tY -H 00LR@p:PP  `VU  0H0 0Q0:U p0S 00 0 Q0-P0L @@@4wWH 00R:0h}W Q0-PL @@@80 p-LMPL`Q`3:Qq 0P`` @@@8p0  0-LMP00 1W@T <40\ K@H0@00lS:T)WP @ R000 Pl0 @T06$j 0-@LTP  @T0; -LM0PS`p pS0pS,l@$ (0d@X0P@H L0W" 0S0S|0S` P@0;L;X;;;;;0;D;\;p; -L;;4f;;$;,;4;<;D;H;\;9 p-0LM`P@ X0VPpTT -LX !@K@0  u?W>Tk0?W> -LM@ 0@,; I`; --LMxP0Sp`A \5ML0H0 R *5S(@ 0o@jt;0f -LM@0 HD00S S (SgShhcS|;l6>; -p-LM@ `SQP 0@@M Q(0 \0 Yp@@j p-LM`0@< 4PK0 =0\ 40[S  10S >* 0S pjk<; -p-LM PQ 0@``P,0 \0 p`j -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00ShRT0|(PW  0U00jD>jp6> --L0LM0  4!0 \  l --LM 0w --00LM Q0f,> --LMHDS 0V(0@ R DSbX6>j 0-LM@HP(S 0P;(0@ R )S0GX6>j --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0 u pX00Y00S 2 H0 0%SSRS HT \  pH d ` H L H L  0BZS54+&2&2&X+&2&2&2&2&2&2&p+&+&2&+&+&2&`,&x,&x,&x,&x,&x,&x,&x,&x,&x,&2&2&2&2&2&2&2&2&2&2&,&2&2&2&2&2&2&2&2&2&2&.&2&2&2&2&2&/&2&2& 0&2&2&2&2&2&2&2&2&2&#&0&,&2&2&2&$1&,&2&2&81&2&l1&.&2&T2&2&`2&2&/&2&2&2&2&83&T0  0` 0 0 x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ9X ,0S ,m\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dml`  gcT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  :8D@Kd(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @ T@D 0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OT0 00 T T @ 0 P` 0  P``QH0 H0 HT0 0T0 00S H\0 ܥ0c\0 HT0 0H+ ` H 0*SH L0  L@00A S HL 100 A RH L 0@C0Tppr0@ 0Tpp bH0T T \@H L10H 0 L0@C RL \@ ST  T T0 n 0` Vc WTdp ̣T d00\0-KSP  R1 :R D3P0 h l% >P &B`PbP P(K 0a0Ch0 1!P0`P0c P0 T 00SP000aP V0 P 0bP 0 `PV PP000lP  U- Pu`` T0 00 T T @ 0 Po0  PozT  T T0  0` 0`0 oT0 00 T T @ 0 P`0  P`TT T   0`00  T0  T  T@ 0 P`0 0 P`\l T   0`00 T000S T j;ȅ;;Ѕ;؅;;;;T0  T  T@ 0 P`0 0 P`0DK P 00 h ` D KHT0 @0H lR H  T00T T T0  0X /00 T T@ 0 X0 0T  0 X0 00X  0 T1P` l0 x0 T L0 0H 00P0 P1QW P  P P0cPh hp ` ?PSh \l NL R D0KD KP0 h ` -t0Y00SH0T ̌Hd -L; -@LMf; -LM @pT0T0 P ,K @ 0` 0  00wJ0p@- `0Q c: 1P#(80S$H*   0!!0 0)0 !!0 pMj -LM00P20#0R0Sp ` 0Qc : <"K#80S $H:@@0S 2[02KP LE-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0x>|6>x6>h>6> p-LMh`@qP T0T Q 0QUqU@@0p j0@P6>6>p;;,0, 0$ Q 0÷6>6>6>8j -LM0(h h`'\@\ 0 0S<:80 h000t<j6>6>8j000 Q 006>6>8j6> 0 S-L< 800( S $S hk;; -t0@LMA \0S9&$9&09&9&09&,h$h{x>|6>;`>̆;x>;;f;;h>>;;;o;d>H> ;p@-0P-S0`P0S @,  0C0 RSR 00L0 Sa LW0LR7L0AL\0S 1! 0B RSR pU00a0pp0@XSxS0@A-P@a@P`pՅa0@S*P 00@ S 8C81000C0 @8 R#H0 S S 0 S S S P@ S -L M0 ` S S, 0  S S  08 R R# R RP0Uʄx@0GS  08#h XE8S@0 8Cp,0P%X0P 6>> -LMp`P)@n$(=0 S S 0 S S S RPU  KP 0P0  S D;8jL;T; -3L M PP:bP2 PoxGooh@yTYT nTNTYTyT cpBah00c P2 b1 @GGo, @AAh@yTYT nTNTYTyTc1 000 R @p]  X 00S0 $$P00SL d几0s  0sa OP4 @4  4a 0s 0/po 0s%f0P ,@HOKo !4P40 04㿪Po9ꇠx6>|6>h;`>̆;;<`>Tr;H>;x>h>>;;;; 0- 1L @PP,01 RB&x>;ȇ;ԇ;;|6>;`>H>;̆; 0- 1L @PP,01 RD&D&D&@D&D&01 @U 0heP01 h0T\ X0 TH0` <0h00hx6>x>;ȇ;X;;|6><;`>H>X;̆; p-LManP0@SN g P @``@T1 D B2RVF&G&G&G&G&G&G&G&F&G&G&G&G&G&G&G&G&G&G&G&G&G&G&G&G&G&G&G&G&F&F&F&F&F&F&G&F&G&G&G&F&G&G&G&G&G&G& G&G&G&$G&"P!@0Sp|xtplhd`\XTPLH6>|; <;<؈;;;H;l;;;؉;;$;D;;;Њ; -h`hP0 @0XpTL@000S@@]0 0T|6>`>6> -X`@0PpTL@ @P0S 0@0T006>6>>; -LMX 04 D! Z0 , p((@ P 0 s ,0 Ƞh8 V W@ P8sW 0$Zڤ000 R 00 RE4 peR dR `4a 840sS8L ,80pCx6>6>h>x>; -L M |0p S S0 @ SQ SO 0 8 R R# R R0 S S<0 S S S `0VܐPW0HS ! 08#x hF8SP0 8CXu Q ,`KPXs F~P&h0`  S6>>;T; -L M8#8cZ00 (<2"(@4@, 0Sp `P0PE $`0@S$Pa@0T0 Ё8CX APUc0J 0@TcZ1  S L&L&L& M&d1P <1e$! !@ 0  P0 8C(R R% R0, R0SS=Pc0JSM&M&M&M&Y\ S*@0SS 6>x>`>H>|6>(;; p-LMP0 S S` S S 0 S S S S0 S S0 S S S PH @K P0@ \pp SH;T; -L Mp`0A,(0P S S= 0 S S S R`V ,KP0, Rڰ0!1 WP aY ,0 `0?P QPqP Hf  0 S 8jh;x6>̆;x>p;T; -(L4M8"(`LK$T #!#3 pQ Y C0S P00S $0$@SWp0PpKa phP0s \# PLK@0@T@4i p岤KDKQP0s aJY@VITPRxŸPp@Wʼ"1Q$@D0W0$PEڀBLK @ h2 0T XŸ @p PT,2@0T Ÿ @p PT0001 R P@060S I $0$@StA0pS P0#0S ( $0$@S(p0S P @00S  $0$@S[O0QP0S S2ḠSrı0BP0S S0Wp04P0S S0Z0&Pp,x6>|6>;x>;ȋ;;>>D>@>; -L M0P S S@` P P 0 S S S S `0 S S S Su 0S 0S  ] P1| R0 S SN0 S S S x@ 1 D B2R*PW&Z&Z&Z&Z&Z&Z&Z&W&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&Z&XW&W&W&LX&X&`Y&Z&Y&Z&Z&Z&Y&Z&Z&Z&Z&Y&Z&Y&Z&Z&Z&PH 0KP0 04  P  0K* K,0K3P"[2[0CP 0KP0  RR R 3P 0PKP0* K,0K P"[2[0c0P 0PK3P0d  P0|* K,0KP"[2[0dVP 0PKP0e P0* K,0KP~"[2[0eP 0PKtP[k* K,0KPf"[2[0f\P\hXqMPOLPlQh?E0KFPB0S 004Q0 0B RS R  0B RSR P P P P Pt%#I0KP0000 R@@R@t0 Sd SP6>D;6>T;X;h;t6>|;;>;Ќ;5>\i=;;; -Lz<84(0S JP h ;4;j<;N-  0`1af  02@lf-T0 $\ <0 \ 00  Ƞ 0 Ƞq fff-l0 $ RT00QD1R  Q (04(fff -LM`@PprP  0 P  ,00,0 -L,MPUP0 P0K4 0 H0 D , LP 8P !0H K P80 80S pP #P 0Hc@0 Po` 0,0( 0C,0 , -LM`@PpP  0 P  ,00,0 -LlMp`WAa W] 㰢P 0 40 ,` HP Dp 00 P5P8 08 8 0PS;^9Q80@ H K P8 8 ^ pP! #P 0@0H  n Po` 0@T  ,0( 0C,0 ,:W㌠ PK -LM`@PpzP  0 P  ,00,0 -L,MPUP0 P0K4 pH0 0 LP D 8P , "0H K P& 80S pP" #P Y 8Pc@0 Po` 0,0( 0C,0 , 㣵80 -LM`@PpP  0 P  ,00,0 -LlMpW`Ak Wg 㱡P 0 00 4 HP Dp , P9P8 08 8 0PSD^BQ80H K P0 8 ^ pP+ #P) Z" 080nP0 @0 Po` 0 R  ,0( 0C,0 ,6 8W㌠ PK -LMp#@0,0 oPP 0 `43V ,3V &8yy W9,0W0,000 嬐KV&?0W00S 002Vd E2V/  0 @T&?0W00S,0( 0C,0 R 㕡2 ,0S ,U,  @0S$ @<00 0 0@0c01V 1V00 S00000 K 00L0 S00@0@0 0S 0R0cҰ0 P@ 41 $@< 0 @0 0D0 <rWn   P@i  v T 000 00 wjf f |f{f@L;wt@}f~fvt -L\M0`Y!0rYt A P C2  @P 0H D@ XP T0 P L PP PP\ ` 0x0 C0p  !0 @0 !tLX  0P@Mt 0SI0S# hPKh`0\w >`@KpKl 0pcPl=9 A =p p l p l0 2R]ڠ"002c2c3x0 g=00P@ dŸ0S 7=0  !0 @0 !$"Fx0@!=T 0  !0 @0 !t@#T@TQQ QL@ KPFP YP@T SP@X M@2x \ d0S`K P@`KP@hK\ d0` h0P=9@ =C` \ ` \0 =D P@2 H P@( L P@ @K<0K8 KH0 D 40K0 KX0 T ,0K@ KP0 L djQ>k;`j?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a0S0CP8c% U#HP@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  t9E 0-08PLS@ SP0DP t 0R0000`j 0-@LP, 0*.0PP0# 7<t 0@R 00@0h<0  !0 @0 !50S 0(0  c`jdj -LpMW,0 P`*0 S0!P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0p.p 00 -LLM0@d d0p S 0!HKp h W! Rl d0pl nPP *p0 R0:z 3 PKBa2a11J"c11L0 P RPrXKL T0PX0"PP L =9@ =CP L0 0`  !0 @0 ! h0pdh 0SGz" XPKXP0\o =PK`K\ 0`cPl=9 A =` ` \ ` \0 1RUڴ!002c2c A;00P@ |!0S ;0  !0 @0 !Mb?BdjQ>t;`j -L M`(p>PP@[|P@Q,K0 K̈P@J,0, 4K,00$P,00 K000幈P@040 4 0040$4 000<, p-\0LM@`'PU 0 0(P0 `00  pW>0f p-P@LM0`@ hD@@@<@@T0 pa(0 0800 -$@p@ L <@0`PTD00D0Q# R` 0(PEUP!0UP! P`0 0S00%0eS0``0S@ < @05V0 D00CSD0@0 00" 1R@0 00b S:@ @  81Pt 㶏@0@0m@ 0@0 <@0@ /X< @0$0#`@0 0@004P`@  <@0`P <@0 0!P@  <@00@0@ <@00 0 PO@  HTX;`; -LM$0p<@T @ D00D0  R+PT0S' 0 S$0S! <@0pP D00CSD0@0 (0@0~P000@ < @0ZH @  Pb Z00U0#02SPU <@0pP0 00cUp 0S`1`!PbUP U00P00SpTW 0 0S00e 0%000@ < @0>W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Ptt 㞎@0@0U@(0@0<@0e ឲp@ < @0l <@0g<@04!0Pt@ m(0#p@@ 80P+t U@00@0 0Pp@0} p~@0@0@0@0<@0"<@0, 0پP@ hj`;h;0Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`hj P0-L@R @0@I 801P"t L@0D 0R@0)L7>40!$r< r0S00 Q 0 0S000\0S00 Q 0 0S-40$ < @030Q0S@0 191\40$ <Q @0 !0) 0!  00b 0 S -L M$$@ H 0@x;D6>lj -LM$  0 -LM$  0 -LM^@$^ )|1^# t1^ .40iS rS 0  0 0 h 0hݠ0#300P00^( 0^0S 0+< +00+< t0^ < 0 @0 0D00S00<<0<0 s@f@s@~f}fs -0LP$@5A` L `0R*0 3S3S `p  0C aS0SԱ 0  3S `  H0S0@ `V W5 F;0;p ?707 0-@LM0p$Pö900  0 -LM@$0P0$0/0 p-LM@Po5p0`  l@ <p0<5pp 叶p0 -t LM0@S00C>|0 Q>x  0,0CS0 p||[D>Pj -LM`lP\0 p(5@"4  0@D  D \@0訠 $☀ ";p05 + R @J 0SU 0S = )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU Wg x GU WX 0xU U U|Uu 05 0=  (0r05i UZ   ^;8p09` (0S.@ 20U0S 6    y0PD 0@$  $ @jHj9@lf,j - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HS&&&&&&&&&&&&&&&&&&&&&&&&&&&X&`&h&p&'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d Hb P!0?0S0&$&&8&L&$&D&QA0 0(!)^  so 0@d 0 d  0=`H ! PPT JO  L-0c Z0 =2PH @} 0`0Od  d 1-8j9m< -P$LlMUp` r:U9k9U95g:4| 0S 0 x0\ 11F0S )9@ P@ `9U8 T9U l09Uc 89U 09U 1p0;p011p0;8U 8U1p   5,0p   4 0S 0S||^ ^^ 00CS0 4 0004! 0|04!x 41 0 !0 0 0  !|uP@ 7U; 7U 7Uh00A1d7U! X7U41| R ٝPxPy006Uh  㑻k1<dH0 1pzm0&0p" o6U9 et6UK / 6U \6U<00Sp0p000p0V0 Q U 0 Q 41| R00 h 52D5U' 5U 5P lU*h0U 0heh02 P@hP h0  w0Q4U 4U 4U勗41| Q]00Z P 0SxO|4U :p40Sj0\40Sn0S_p 0   P (0$0( R|P P?3U ,<R R 20 0 0;; 0 0 2  X`(p@C PKK020 ; 0<p0 P@WP@P|2U@  QP7  Xx 㴥./t08t0 @8t0  t07t00@t08t00 t07t0P/ q0S S p0(0(S# @0H0 1P pKl p0 LP D` =P@\ `^0`0 a@ `b`zCT  0X , 㸰U0U 0U 000St{t rtzt ^t j7>t,@ot t t at nt Pjst@f@t@[t@wt@ht@@lfbt~f}f7>t8>Ztetvtgtt,D>@p; 4-0L0Œ@P=/Ap`@ .H0S`VW T/  P`0 p0@lf p- 40t 0LM"@`1Ps sP<0 p80<`.00@.0@lf7>7> 0-=0p 0"L@<P.0S00  Q0 0 0S000h.@lf p-LM= x0 2`<P.@J .0 p0191p 0Sp@lf 0-=0p 0"L@<P.0S00  Q0 0 0S000h].@lf -LM= 40 @2< H >P@lf -LM0@  (0 P0SM0 p-LM@P.P`H0Spp% 0  0S H0Spp 0  0S p, ,0HPP -p7> 0-L@PP 0 p-LM@P.` (Q,Q&p0 >;-p0.(ph-p0m h< p0ŒHQHP4HP(@lf x7> 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@L-p0P0p00hY- -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"gfff7>7>j7>& -LMp0@@  0  0HS 0S 0 0SPp0@0p0p0@0p0 -LM@`^+V0p 0pH RRb+VHP  D0^ p040p00H0SH+ l;> -LMp08r `4 ,0 0" X+p P(0 %  0"<#<3;8 +8Q  8002 ,0S , + #082 ++"|04 R  XR 0U00H0 S.Xf X!ڜ0PJH r=P`00Ÿ=p0Od P d eʤ0H0 SXl XRH0Cc*H0P S0"p!p1H8 *8"R*040S#*g4!?0PX]P0pHH0 S R1#K ḤP8  ^0 x x0Pu 0r p1m1Vj0S  `L( H0PvP8 < 0Jj7>; l8j7>9j7> -LM 1P0S@ 50d -R" B?D0CSY@0?0S x&&&&&&&]-0B= X?  8CRa4*p0 :p0>%p(Km = P@ ( P@0p 5*0p )-=`b0V``V=J `VZ0@   p0  X:p0\9; Q0-L@PA  UPE0 -LMPP2 )(`$pKP@ $! uP@`P@ $ dP@p0:p0w)0>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^zU?@0htU0 -LM@p0 ⴱt hOx,0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`}P,"0$"111;/"b111A|0St xQo @TPi zPPD@T50S8 S1 1R0 0l_$K0, Kᔗ HAN=0S 0 $00!0 $0 q?B6c$ D(N=0S(0 ,0 0 ,0 ( (0?B6c, 0p05c1 @R  1P2;P$0 <0/0"bT uDkQ;̍;;;;;$;?BHh8;D;P;\;P0@-0 5@5P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S0  000 8 80R000 R8 80R0Ph h0RS p-LMP@!(p0`(0(S U  'p'p 0-L@  0^ᣮP>U00  Pj4j 0->L Bb@ \P( H  800 @00 0@O0Pj4jd& -d LM0@0C0 R0 <00  0 (H>h̊4jPj -0  L0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Q4jPjXj -LMQP`/00CS &8&@&H&P&000 Pi8-p0l0h0PpT0T@ 0  pbHj8j,j@j4jXj-R Rt0t0\ \t0t088Q  p-LM@`P >㊉0E/V> 0` 0 0P0  ps -LM0@S0S000A?> > p-LM@&0`SC  ^P` 00c!R!l0PU00\ &p -LP`&Vp&0S 0\@l0% @l T@ ˧00S 00`d d0Vp 0SS 0 0[&h0 -L@Pw&`\p U, 0 ` \L 0 1S>0`Q1&\L0 Q` \L0 0H`F V0`b 0-@LP4& U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h% p-LMP@& `R2 R0S$ 0 0 0P 0  B\   00  110 0 0Q00  0%p,u P0 %p|;Rp@-@) 0/. PaCPN  10C00& 0b 0 R 000 Rp0a # B 0!0 0p1 ! p -QLM`PpF% R- R0S1 0 0V$ R! 0 @cR@cT@ ᠦ`dPp  00S 00 0V  R.% 0 A( +P0锎;-0S0| x 00QSCT0P0Q R 00c!0R#<04f@- T0R   \ 0L0c!R!@ 4f 0-@L$ PR 0S0 0 0 0 Bn \P 1S>\0S0 0$0 -L Mp$0S# 0S 0R $p @@`KP@K $ -`00p41P LP@U @ S 0U @yW -LM`00p41P HP@U }S 0V @XW -LM`00p41P HP@U \S 0 V @7W 0-LM0@41P P" 0\ 0\  0PU041 Q 0  !0 0 !000at qt @-00@41 00S   @U@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ Lll HLJP0hF \j4H>9>J>ZfHjDj8f`j&@jPft&,0 P 0SP\j -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am -h0LPpU` @ T*0S4@  T:PU\j p-t0LMP`U @ T*(04@S T:PU(0phu \j> p-|0LMP`U @ T*$04@S T:PU00(0aphP \j>gfff p-t` M@Lh 0\P@EL 0@=,0 0phj;Lj;(>,> -,0LM$@ <0h 9>$>Ljj p-LM"l0`PU @ T*,04@S T:PUG" 000p \jdj p-LM@`["T@@PLH0@P  1 0a1"pjdj p-LM@`7"T@@Pt l0@P4 10#3 a    $ ( , 12 !pjdj4 03  #   $ ( , 2  -LMP@  * p-LM`@!T@@PH54!40S !0 ;@0<H`8L`!pLj 0-@L! P 10C1( HPL0L0L H 0 1@ x@!0 80S 4@< 4D弄4djjLj P-L P Q-PL`%@0fT 1*4p)  !!0 0!p0P0 `0 ; -LM -LM -L M`pP00 JQ1V U0 0V:`cVP0W,0 ,K9Uv 0P@g YP 0!0fS0! 0C 0S+04004!H0!H01H@ H0LP1L@  W   0`pbVP`W,P !00000 0W1 0 fR ! E 1:)01o W400p,0 000 W ;ʚ;j,;P; Q-LP`p%R!Q U 0\: c\PVU @@lV@1  `dૡVpPl;;;; -PLM`pP, @Q R`d/ @PVW 00fW@1@!pd vW@` R WPʲ1 0 SP W010# 0"P0 S0# 0 0-0LS@P @0SU 1  H0S 0S 0 + 00 0"PP0P0P@-@ Q 0Sa0 0c 0\Qʲ1 0 a0b0a0 SR:1 a 00a1a^࠳\ 0S %*c\\ 0 0\ -1LPF0,0SA* R> 0S 5`1P1l0:L 00c|0 S01W01R@1@! ઠ 00 0 d dR0 0pd0 UX XP 000PXP` 1p  p :)014@p1 01@`j j Q-LpPa1; 0+0S6* R3 0S 5`1P1pl0: 0S@1@! A 00 0 pd dR0 00 UW WP&d 000P WP` 1 1@  @ :)0 01@1 01h$ jQ 0S cP QQ 0 -LQRQp`P[@PW 0\@ cTP 0\TK 0 S?P+&PP 1 p000 0X0j 0  0 S  0S0S  0S00PX_P! 00 000000g0  0P -LM@PpP 0Q@PcTx 0UTs 1 e8Z` P`  0j0    B 0 P044H0!H01H` H01L@L`000 P` 1:)010000h004  ,0 Z0j0Ó00<0 P@,00 -LRM(K@0`0*0ppA`dPPM 0W@ 0p(,0S7 0fS1!P@% P@! *,0S0 R0 00 0S  ` Vpd`WP, ៞v1 @  TK# @PP 0 0,Hj -PLM@ 1 4@ 04  r@T -RL@`P0p%Q" T S:0bS@UT  cU 1PbP0U@` ^ԏ;;;;!  H0S 4 0b000`0`4CC!  H0S  40@  0a 00c -PL M`,0  RQP QP`aUVU QPU Q U 1 0   H0S 000 , 0R0V0S  0  0" fZ00SLpfZ@ gT  0@ T0 Sr, 0R0V0SV, 0R0V0S kP00S 0 S5*PZ@%T   p凝 00g 0 0 0 0 0 W0`0@P,0S`B1_ @0g 0 W 00`0g 0P2 P00S 00 q 0 0 0 w 0P@ 0 S  0S0 `0`^D,; - RLM`Pp:Q1s @TV T 0 , `1@yP@ 1:)01p`40 0 0-@0TLPo~PP@ 0000 S00  Q0 0 0S00o~ -LM@P 0o0~PRP 0SP 0-PL @T0 }00 -@LpP`U P@ V0000P`U00 -@ ML 0@P;j -SL Mph1@S {P` 0S+0SD, EP0 0 @0  Q00 0 0  @ @@@8 `P@ 000W,,P) lj p-LMP@  0`@pp -LM`P0 p 0P@ 0S000U H 0UP80 UPSG A:> :> -LM@Q0 0S hl Pj -LMPB0p` @T Q@T @T F @T R 0 0 0 B?BS  6@ F㱠P`0 R 0000  0V`{P` @>9X; -LM0  0  -LM@`0pP  0   0 5PP 0P l; -LMP0- p 0` 0 8@q #P @ 0@ p-LMP@  0`@Kp p-LM@i0`9P  0%P P/p -L$M0 00 , 04 0P0D0 R< 00`p`W~00Sw 0@  0000@0 Y 0S 40040Q < 0;0 0; #P00:00P C03S; 0 0  < 00R0S9 00 B0cR D0 SH  0@W V <^<0O/R QDQ0 <0XX<,K8 aY ,@Tr̠P@@W00 X00SDZ 00X@@^d ,  T00R00S 0d0   垒 @8ZP, `p000;W8P ZD0X00S@ R0000lWPAH 00R  , 4002@ P0000,0KZ , < 80 00X00S60; 0;;* ,P R 0;ဠV00:0V, 101 1i D0S ,0S <1+`R@@do V@KNVLJ젠PA p` 0;0;; 0 00:0Z 0;0(#(40S'0#   Dj -L`,M, H Q @ , 0P L0 0 PP0S0040 4 0 44 4R0  0St707 4jLPZz8 d@T 4L R*`0R:4 @ T0Q 0S@03S  T 0S 80080@04p 4pL  , R 0 ,0@T~ 1SZW  R 0 0@0SL Te 1SZ T_ WXl@Q4 H  4 1 4̌4  4 4 T< D  Z00R00S 1S6 H0S 0H @00PRp <0lUP! 0D0P 0`UP!QR  0e0 D0`U 4 pD00D0 0\  0s0 0 e00 L0P 0e eL0P H0S W0eSH00@00> 40#s:0T00SL( 0S% 00#0X00S 3S0 PPd@T70778[07|ԞTi  Z00R00SuT^ @04 p< 4p4 5 L 0P0P00S 40  70778%0|7៞P 0RS04 0070778  0|7ᆞLWT @0 0S 40Xdlh 0Sl4p<  R< V14  4 40p@D @L  aL 1SS P00bP0X0,CX 1@00cX00P @0@ @d@0pT Xl@Xdhld@8D0 ܏P P8 \ H R KWXdhl L00bL0!RR P00bP0X0,CX 1@00cX0\ @0 Q 0 R  @0d0 d@c@ 0Q 0 R d@P L00bL0!RR P00bP0X0,CX 1@00cX0,\ @0d0Ld@@d4C  T T 1S, 1)@T 0 90 SR  407077L#8Z 0|7s#@# 0@@4 0   @Pp Q!  pZ00W00S@ PT O p-LMQ@P ` Q p T  0pQ -L4MLP3 p@033@033`3033#TK@040ɕ2[03,0(0j0 00S<003ל -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@St''''P 7jPT|PL0T@0T0T`@`00RU 0S@000 00X04  ` QQ!k401#8S#00Sd0W  H0WS 0S 0S S d>> -LM^P@p \ 0S*p 0,0 T` 0 &T T T 0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 T 0T 0T 0T0xP 0Ნ@ᕜT0 3 003` >> -LM@@ D0<㑈p@h 0-!40r@L$ r 00LP<0<080(  3(@03 0P9>9> :> 0-40@$PLt0S0t0  Q0 0 0S00t0S7070h40$ L 0  191# 3S,000`0Q 0-40@$PL0S00  Q0 0 0S000S;0;0hg-40$ 0@N cQ  Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6⏚LZ0S 0hQLI0S 60h3 -LM0@00 68 a,L)0S  -LM0@00 6. DL 0S  -L MP0L 2cC0Q0^, 00 m3#0 SfʤPD A0 @0 0 @0 @D@刀 <:>R33  00330(0 (, 0 Q 0\30C3( Q,0,0,00(,0   0\30C3  < -LM0@ 00L20S #3 # @Fꐵ9 0-3L@  0P03< @F0㈗P3 030阵9 $00-@LP303#00 (t( 0hf0< ;3 p-LM`@PP LP `0 S0`00S;0S p$7pQ@-L  0@Q  0$R @ S$:>P0L P07RLj -LM@000Q R 10S >  -LM @40 0Q 000!RR 000 0, 1@00 0 0S 0Q0 ! !101 Q-Q 1S/ S' 000!RR 000 0, 1@00 000 0R 0Q ! !101 0Q -LRP`p  10Z @W 0R@0@ N0aR P\\P= 0 0 Tp`Wp @ 0  1SS 000 0, 1@00 0@0S 000!RR 000 0, 1@00 0 0S@ ֽ뀐; p-RLM@P 0RP^ 0Q0`D F0aR \p0S 0  1SS 000 0, 1@00 00S 000!RR 000 0, 1@00 0 0S@@ @px됐; Q-L@`Pp 1 0QpW 0S0 06@TW U 101Ph闾0SJ !1R U# 1 Q U@ @ 0P00!RR 000 0, 1@00 01010@0@ \!1R0   00 0 0  1SS0 00U0ꠐ; -LM 0@S 0S p-LMP\` `U@\ W 0SE Pc c 1SS 00b0 0,C 1@00c 0U\* 0S  c 1SS 00b0 0,C 1@00c 0P 0S \` \ 0S p p` 0e  000e0!RR00e0V`傼븐; -LM0@S 00 0  c 1SS 00b0 0,C 1@00c 07P0S  00 -L @M Tp`PP0 T1@ @  0 0 000n0; -LMp`(P2r(K, K[P@0K (0 ( 00(0 @T0 (0$ ((00(0( ,00C,0((0,,00,r,Y(7]\7> 0-LM@ K(PUK0 0PP  ,00C,0(0, ĕ0$P 0-LMP KP@ 00$ @,00C,0(0, -LM0`Sp  ,KP@0K P@ 08 & 00< $P @S   3S 3S0@3G  PD 00 ( @ uq 4 K[P@V40tu0 tb@ 00 0 00! 00$P P@ Q% ,  0R,0  P@ 4Y0w\;(^q< 8,0( 0C,0 ,,K @T0 (00(00,00C,00(0 ,PD 3 0R3( D (00(0,006 , 婔 #@5@3Sn3Sl 0T 6F #P@3S_3S [5 50#WȺ\7>9; -LM0P K$0 P@E $`0A?AST $K0P@'$P@!0A?AS4 D 0p 3S6P!F0ےP@ 0 3S T0C3 000 ,00C,0 (0$Pt,j 0,  B, (0$w$,[,00C,0 (0%,Oꀵ9 -LM `P ,KpP@  0KP@t( 8KLp4K YP@d804 D0 0040 4 弑<K, 40$  YP@G<0 < 00<0DK<00 $ 80,0@0 &P@+0SF  ݏP@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 p,ۓ,ؓW<#[000 DW4[0,0 0P p,P~0,P@ \7> -L(M 0@` @Kp8 0 8 K4@ , ( @P <` p9 -LdM0DK`p  P@8 P#PPKP !<ގP@0 0c0Q P0SX0   X RX PP)X0X0 XK PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP,Α @ V05@1 0305 复0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$d @,00C,0(0, p-LMP KP@`*0 S@ 0S 0`S$V  ҌP@ 0 00 $0`@Vw0,  B, (0p,S7@1 0-LM0P K 0 P@) 0S 20$ 0K+P@ Q  R 0S R P@ 0,  B, (0 P0, K @K dP@ p-LM K`P@T(K  p 0(0 $ ɌP@ (l(T$T(m -L M`$ KPPp (K 'PP$0$@ep  P0PP (  0R(0  劌PP $0,  B, $(0W ,◐ sP -L M`$ KP@p2$!$P0 R5 (K ڋP@p  @0P@ (  0R(0  ?P@ $0,  B, $(0i,M )@,00C,0$(09,; -LM` K~P@  0$P1 0S4Pp7@  @0P@  0S-@@TP P@ 0,  B, (0, ҋ@ 0,  B, (0-, -SLMpP`$  RV@1  ` 'PPW@0`7R -LM@QP  0& S,0 0,0 -LMpX5 Q@`P) QX 0S%0Q0U00S3Q4\D'D'D'D'D'D'0E';;;j; -LM0@S T0S0Sp0p Sd0d P 8 =hP0 00@78:><:>@:>D:>; 0-0LSP% 0SP 00t0 R h0hk0hh6Q0S@|@g@j -LgM`pV0,0 ` 0BSPB[FOK a`0qK1 A 堡 嘁 _P`AT8_OKX 0|1  ˠˠmK.K0x z6P` 0 ,0S ,%A0 |0 0@ 0P 0P 0@P$@ 8K7P 0j ;ʚ; -LTM @T`PD0 H0 l p LP D` P\ pKP@`P80S&@ 0 0W6P@|pW? 0R)@ 0 ) 03 P- t P0  p0 0 0 0$  t t0$ 00 $@4 0x Fx=@0TS (ʚ; -LM@ 0)R  0S S00+ &̲,; 0- @LT P P0S S 00S00 @S 0S00  0000S P0hO塲<;0 R P0S$ 0-@LP0S0000hGg -LM0  4 0 0C#q180 1 `f4  < (}hZKZ<@ P,K  4!QP@(0 P,0U1W<@ P0PU,0   B A8 <W8  04 00  0(khf PUJOPUZZ( (YhaQPU<@P0,0 ,cPU lj -L M`P0S 1R 0 S 0B#140 @b @0Tpڲ 1 ` 70p40 Y 00@ (,K ង, M0PK\` 0 @D2 0s 0s 0  0pG0 00000 40 Y  @Y``0PK o0 I 0Y0C 00p00C0  B  @j -LM ROqa@0T0  0:0@T@T  ` * 00C0 0*S E @TPUh1 &me@`TP R Q@@@TPp  0S @TZ@WPR@TZ&e00$0S 0R0 @, 0 0 0, $Q \0 R0 d < Q  0Qjjjj9>W'P dW' P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VPP   0 S0*00 * jP-,, 0 0C0, 00C0Qj -0 0CSL0S R B02P0P  {yL;d; 0-LM0PS@ P0U* 0S PU:U% 8 0B6C00  8 0B6C0 R0000 0 080K0 88 00B6C08 1B6C19jj8j(j j|; -LM$PK`%|@0 000 K? 0D `0x0XPXpX@XFf 10\ 1 !Ce5>(jjj j@j -LMp`@PnU|0+ 0P @K/X0 0 @00D x@8H`4@<lhtpsD @0SP0 P/?0!CeH:> p->0L>0MK0 1!0`CQ6囪0 @0PP$ a :\000008 HP0 @R0 0 X 0S@@0 @p4ppjPaf -LM @R0`00 H R  R 0 0 0 8 (0A&B H8 vhjjPafgfffj$j0>0X    00K84@K@2PP400 @r4@ Ta\  < WbPp < `U0 @_@P 820S 8P <` V<@< 0 APP <0`TD@@ O8",1D` !H` !006000"P000!R !|2|BP000! !T2LŸP000!,BP0( 00! 0KH /XH08aff l0000010000 0000#0 05>0000000 -LM@B00p" 00:0000 U x0S H20SJ0000000d0S?H0S80K0 P8 0Ba 18RA610 S0 00000@00 10000S00 00500I0C 08 0$KB608 $ 00P,8 0B81`A6 10R000 0S0 000 0@00 00  0L @0K?88 0B60$j(j j@jj4jj5>8j0@-0 Lt0P@h0  P P0P S P00Sd0S00 jDj jDjHj8j -LP\` 0P 0 Q 0S Q $00$000$0S@T T  P0R\ \ 00 0 p( pb W),p@0"0L:>@j4j j -@2LP`P^ 0S[r"0Su@TQ  R0000 0 0S R00 00 0S  R 0 0 0 0 `VP0$0P0)0 ( ( z00  0P@ @2p1!00 R 0@0VV@0 0 80S ( RR*0.S 0P 00S0 0 0@ R )0.S@nH@Hz000L:>8j>DjjDj@j4jHj p-L MP@ @t0s``? `P0sDPP<< 8H0@vpDj>Djj@j4jđ;D6>Hj-000P0 R`` 0Q :0S $  0S0AQ*000P0 00@Q1 0 ! 0- -LM0@^ Q \h0 \ !0S<0 X0 彥v<>Pj;;; -\ 0L!R @0Q1S0!!0QV<>Pj0; 0-`P@0LS HP@0S0@1S@1S:>@-0S 1 1SL 0DS  @  0!0R0:>p>>Pj 0-LM@hhh 0P;D0D T@@P@.@T(P0h;D6>Tj:>:> -L M$$@ 4 0@p;D6>j 0-L@P\UT T 80 Q0(0帞0P0 0 Q0H;>j -LM@0[00C0hlj -L M00 1\ 0, 40 \X\ `P`V 0 =p,PY 010Y 0P@% 0`0 ,0Y000 0 400 Y 2PYo  @0ppVʹU` l -L M0SPIJpP`] V @ 0@  tQ 0CS,  @T! `(p 0 (, #P0R{@Q ( R,0,0,0$0( ,0 pT ?00@0W 0@  0R tQ 0S0^ #(pK'`@0K 0GP0`P 0'L'' ''0'T,0P0  0 S 0 00S/ 0 0S  0R 0 0R,0 P@00 0S0+ \ ( R,0,0,0$0( ,0( P(0,0 00 \T00,  ,0P00@ ,  000S0 @0 P0  00,0 @mT,0 P0 @0 0 L;>D;> -LM0P@T`K0&$pK  0pP@ $0DS ''p''Ȓ'$0 $I$ 0S B $0  0R 0P@ $0 $0@'@0$ $0 0 @ @0$  -Lp(P@A 0@1A 0 Ps `@0PU`P``0@008 0 0 s@0 p-L M0PK0%@ `K 0`P 0S 0 Sp p -L M , P0 ^  0R 00P,0  0R r0 S R :t Xʄ0S00 t0 0 0S0Su00Sb X00S rV tQ 0SR:X00S :t> r07 SRX 00S*0S$R"*r X00St0 0 0SRr sus0suu0sXR0S0 uq000 0scgx; -LM 0R ) 0 `R 0 4 P|p`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00z \0 -L,M,0$p 0  0 `P 0S 0+^xP@P@@T  000 0CX:0S/S X0h 0c #0% %0 0 R2  0 /R @@KT0S @P@x k D20<"Sa 0S0 0Z0SQP0K P@KH0 @00HK00 4 ,P P L D 8 $P@880[s@"  0 S?@#*R0@×0003@0/SI @rvP o500d㓚>@ $$ ;0 pLdHPDHX_:0/S U0+w2 g%TjLj -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < , 0 /S I  , 5R  /R  2R0 /R, KR, ,0 lR ?Ò00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@Y'P 00@060 !P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  008l00CS<<0S;T0$ 78 R2 T0$  3#0S @0S00 #P  80S   #\20S 0 0 j 0 ( |`V   0S  8 R|`V   "00K  X0@@ @ p< RT0$   <Q@@LX 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SW0S8 0Q0R00SI@090&Lj @ -LM80@0 p,0  g `0SlX 0 T w PP p 00ZT0$  P0  0`0CS ZT0$ ,0S T0$ 0 ,0S 0  "0@ < RP  ! Z;; 0-h0MLP\@PTT 0L@{8808 @0 @ 0h >j;D6>jjjj p-LM 0PS`@<P @ @@@qSPphSȒ;S -0LM`@Vp /P $`VV  vQP@P ` 0$0 P0 00$0$(0$0p {/Y 0t@:> -|0LM0Sh0@T 0S$@TP0 $ 阤f:>В;H- P L0S PP 0Rj p-L M 0@004L0P0 S000t ` 044 P 0  PK P 0 0 0 0L0pfhfj0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ1@0\00 .00,  0@S Hq R! | 0S; QV4 Q<0;<0<@;<0M0|0@0 S8 H0pL0S0S X R\0\0\00\0X  RX d0X0X \0 P\phgD@8 80RV`4;<;jL;`;@-2@H?0\ | 0T \80Qj -QLMp@`P$K40 P@T$F -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S @ -L MQp@@ PI R @1@T 0S $@T-T A@@P 0,0S/ S+Q'0@T 0S $@TT (ULP( k@($@ 0@ @nj@L- 0 i5i:>:> -PL M0 `L 0 0H!X P@ 1T0 0j04` \,  T0S ,KP! U`pmP@ ` ,mP@W,p @0 0j0 D0 R4`0(0 00 !_. j;>p;j-|0S<0  0 R | 0 S  R8 80R0S -LM\0PS@p$0  0`004P s 4 $0 <$0Sid RfSdRb01 K`ᄀX\ lP@( \0R\0ń0d R>!P@A0\ 0   0V0P@@T@ 0004P Ts0401K0 R 0S  R0\7@ \ $ \` olP@d0 Rd0 0Dz\j -LM@0  01K p-LMP!`@4T  K00`VPZp' p-LM0`@P  0p50P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  0-LP@P P 0S  TP @  0S 0@ 0S 0 @  -LM`@pT P& R0 U@W L受X @勗0 <P  p~j;; l; -L@q<0< R  0S hdx;j(j;; -1LM 1R  cp 0`PU 0 00S00`PUV Y'Z@t*@h00000ZW`pGY l(j'H:>  ;;0@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@fȵj;> -LMA\-P   -LM@pPp `pPH00H0 0mPp0S P- L p00Csp0 H Sp Hhcoc; -LMPp@`e`hP 8 V T0SQR1 @R VP T0S00000000  X00:00U@ ,00500D!0gmP@ lQ  V T0S RVQP   R T0S R T0S0p Rl0S c0 P@p0Sl0S  Nv4;@;X; -L`pjl@PT 00  @RW 0| l0S -h)00 -00000d0WS T唔p;|; 0-d0LSP@4d@800CS|00 D0D h0h S0h0hP 0t디; -Ld\8  R R000 H  l0St0QH0x0x0x00d0L H0 BL  R@0SXPP\0\ D0\0 X\ 0X0 X\ 0 2!Cejj; p-LMd`@VP0 P00S  R000   pp00p0!Ce 0- @RLd R000 00H hP l0St0QH0x0x0x00S0 00@P0H0lP80SP 0? S 40|0 R 0 C!Ce,<>VUUU p- LM@`T PP$  $@TL0@Q$@`0(0Spp:>:> -pL@`T PP $`$@TT  R$00@T 0$@R T0 :>:>8@P -LMP0@`XD,p400 `xd` p\ HLPx``p88PP `p h 鸔;H;;; -LMP8P1p ^0T|@10` @Lp@@ D0@Wh@T  @T\l@T < @T;>Ȗ;;>Ж;;@;P;X; -L M`$Q @p0!P 0PP<@@0@DH t`L`X\ Lp 080@PT YP !`\#100E SP`@TX@T `\#10l0E SppP`@T<h;ܗ;;<;|;;;; ;; ;(;<0;@;H; 0-0P0@ 0L^0 000(<>|ff 0-0 L0@L Q@ @P@H0pt t Rx0x0x0 H00H0 1t0S0!x Q01x00h(<>8<>|ff -<1LM 0100 p(!1 P0 S000@`T  0S 0S@[0S0C0ʄ0 S(| 0xjJ0 0z1f0PS(  lj8<>0<>5>(<>fP;j,<> -LM Nh0@P t T0R D0D 0<>4<> 0-0LM 0K@ APP 0%0D 80 P t0 P0?0S0H0  000 00jxftfpf(<> p-LM @0TPT` pd00S$0@@@0$00 T$0@0$0 ,<> 0-@P@0 SL 0T0PtQx0x0x H00H0DPn - L>X; -5LKM⤕ R, `p 8O P@PKZ 0hP@ ,0 S <,cuD0 QK A 1 @! DQ q rP@ 4 <0 TP$  T0 P OP@0 Q   0000jP@0$ 8 $ 0$00$0$4$04$0$0 0$0 Q?KpP3@ $0` h! $0$07T8$0$$0 0S G~@P00|PT-H!00000 R0PPP $0 , 0 P@ 0|`D}1y--u)0K0 ,P@0 0S BNP@0 Q  00T $0000 0pP@80SAjh;^5>j:> p-LM@0`S |K0 P(0PU @0S 0S PUh@P p0 000EܯjLjt; -LLM pD0hK@0 d h D PP  0 (00(0 ,00C,0(0~ ,e{ <> -LlMp0`$0 @)JPUK $0 S $Zp D0P dP `0 \@ jP@KUx@^T0L0T 8K0$PU aj; -LMC0,0 0 P`pP IP@ 00  \( AK K2+P@P HPK `P@`PF@ 0@K K P@` 80S-@ 20S 80S@ N P@{ 0cP@s  @KKP@ 00tP@b 0(P@Z D0P0D000 P0! 0$%  X0K`PK0 $K4K DK @0@0 @P0@0 )  090 ~ @ (00(0 ,00C,0(0  AP,0 S ,bo,d0S A(,P , 0 P@] j<>; -LMԀ0p$0 `HP@ $0 S $(o@PK _P@PF 08K K P@PK q @Tp R`j; -L$Mp0`$0 PHP $0 S $n@@K _PP@F 08KD K PDT@,0 P$048,0 `ję; -LM`PzHP@0 RC 0K@ 0 夀 P P@pW@ KbP xWK 20:#: Q0 <   Q @TK K0K @00  Q㄀ 0 p-LM0P@0  0K 0  @ sP0|`KSKl0|0 " ʠ,ʠK K0x p 0R 3p0 -LHMd@K` p@0<0 ` d @ 8p ;PUT@80Q0 `P @ <0 d 8p *PPT0S@ KPN P@KP P T0R TP -LMPpQ`+0ra@TK0 @  p 0 P@0@KSK0K K ˠ0ˠ| `L @H| 0R @Tj -LLM040 0XK0 T0 X , P H@4K<0DH4 K DN D0S b`z -L|M0`P p5$PW 0SR$80SN  S0R0D 6R pYX0@@ 0@ K0 P 0(P@`@ 5K01#5#S0 0SRK 0 Pp0Kp0 hd -LLM 0 p`P000 0pK D0 H0 l p L Dp P@`Q `l`@` TP@0 i @ -LM` PD0K0  P pKP@ 0 @T0rF0S<@ p ]0 -LM` P0K0  P pKP@ 0 @hT0FF0S<@ p ]0 p-LLMD0``K@80 \ ` 4 < PP  pP PP= -LtMp0Kh0  l dp ePP `HK80SP 08 0b00K @@KH0 D 0 4P 0P ,p 8 0 P -LM` P@0K0  P -P@ p 'T0$ @0s# EP㄀K0 @0  0 @0儀K 0 P@00CS@ -LlMP` KP@ 0$p T0S $0@0s/ {EP㄀K0 @0  0[ @  0,  B, (0 , a0儀K 02 P@00CS@ -LM0P#Q`0K  @00   ` P@ 0 p儀KT0@$  ?0x0 :#:0  0 @ -LhM0P#88S`4 K6P@ 0$p ST0S $0@@KG0 :#:|0  0 @  0,  B, (0,~` -LM` P@0K0  P P@ p T0$ @)0s, DP0 R 0儀K 0x P@0KT@ 0@ x0 t 0 0t @@㄀K0s;> -LM 0PK`0 0 0 P P@ p T0$ @)0s, UDP0 R 0儀K 0$ P@0KT@ 0@ x0 t 0 0 @L@㄀K0s;> -LlMP` KOP@ 0 $pkT0$ @)0s8 DP0 R, 0儀K 0P@0KT@G 0@ x0 t 0 0@  0,  B, (0 ,_@㄀K0s;> -LMpKP`P;,@KT` 0K40040  @0K0  ` P@ P T0$ @ (0 "c1, ah $ 1\ d0 ` 0 0q@,K ZP@,0s0,0 $0s0$0  -LxMpKP`PC,@K_ 0K40040  KP@ 0$P T0S $0@(0 "c1, ah $ 1\ d0 ` 0 0@ l 0,  B, (0 ,^,K -ZP@,0s0,0 $0s0$0  -LMp P@0K  0 P XP@  `@Q80S @T0  匀K @T7 p0K0 @ -LlM`P KP@&0  X "00  @$P  80S@ ZP@  ,00C,0(0,D^@Kh0K0 0z@ -LM` KPPx p  0$@ 0  P ,00C,0 (0, ^ -LM0!P`@0 dK0< `0 d 8` P@ATp18!Q K0@ 0 ` P@LP`U 80S> 80S@% W@W@TU PKT@ K0@Mx\P0|t?KV U@KPP/-*80S@@KPP,,Tj p-LM0 `P0 K0 0  P $P@@T|@K0|0 "0ˠˠK Kx `P@ pKP p 0-LHM080 0\K4 X0 \ 0 P@ LP80SH@ 8KHP 0HP@ <0@@T8 K'@ -LPP0Sp@K7$ 0ሀ 匐 _PPk 80S-P? SP<  L 80SP2 mPP-  0PP%  80S$  0SPP<0 D00D0@;<0  00 6@K pKP@ 00kPP   0@PP $p0P  00Pl 0D0$ (0PP -T0L$  80 Sh(|(|(h(h(|(h(h(h(<0 P <00<0 -`@p D0L0CD0P(w0 @1 -L,MpP`@3 @0K0D0 0P KUH P` 8@ 40 L@ 0P , HK 0 @R800 Y   "8 P00R00S@HK 0 ( -LM$`Pp @08 R 0,    , l P` `, -LM$`@8 R , P) PT0S $0 P,  p 0  ,  000c P$ -LtM0 K @.P@x0t 0 800C S6\($(4(D(T(`(l( ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$`@8PApQ((8(8(((8(0T 00S00 KP l00b0 0 pL0PT4! 0P 0`4!f@at $ p-LMP@`@P< < 0 -L(M    40 K<> -L,M   0 40 K<> -L,M   0 40 K<> -L,M   0 40 K<> -L,M   0 40 K<> -L,M   0 40 K=> -L,M   0 40 K=> -L,M   0 40 K => -L,M   0 40 K,=> -L,M   0 40 K8=> -L M8 0  0 $  0 ( 40 (KD=> -L(M    40 KP=> -L$M   40 K\=> -L$M   40 Kh=> -L,M   0 40 Kt=> -L(M    40 K=> -L(M    40 K=> -L M8 0  0 $  0 ( 40 (K=> -L,M   0 40 K=> -L(M    40 K=> -LM00 0  0 $ 40 $K=> -L M8 0  0 $  0 ( 40 (K=> -L(M    40 K=> -L$M   40 K=> -L$M   40 K=> -L$M   40 K=> -L(M    40 K>> -L(M    40 K>> -L M K40  0 $ 0 ( 40 (K>> -$ LM  40K(>> -L(M    40 K4>> -LM00 0  0 $ 40 $K@>> -L$M   40 KL>> -LM d  40KX>> -LM d  40Kd>> -LM@P0< z먛; -LsPz븛; -LM@eP 0 04 0D=> 0- Pd0LS LP  00;00H@00h 0-0P@L 0.0S 04 0>> 0-LMPP @0@0 - L{̛;  -L^z; 0-<0L @P P<<00 R<0 0; -0 L j -L M`|@Tpb  00S0P  00 0 0SP! 0S6   PU  PU  0!F LR PU 0  0|!F5RhP U0 QS0  Q S -@|@,K 0XPP(,000K0 MPPp ,v.|0000,PP  00, ,0 00h0,Z.|p; ; -LMP@0| S`p 0 0<0  0] PL 0 0#U<0 00| R#PP -LM 0| `P0<p0    0匱 @  00<0 -L\M0@^ 0 0| hKD TP0 |0hKD HP0~f p-L\M@P A|0pK0 `|0 RL |0 `A 0pK| \L p 劔P 兔P - L\0- R000S000 -LM`|@PTp* 0 00CS0 0 00CS 0 0S PU Wp`T-|P 0-PL|@T ֯ԯ<-0|00 -LM@y y;<|0 y ;0S S  (00S 0 < - -L=xH;@-| q  qL@H0 800@< (  3 03( 0XA>hA>jųE.jjnm99jk_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$sQjj99>;@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00ж9з9E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVMе90@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S з9p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 u<0>jj -0LM0吐pP`,0 ࢂx 0  AT 0U @$0V0W00S , P ljj@- @ $ 0 201 R 0\ R R $0^0T00S jj0S R00  -LMpxP3Qp`@` PU,0K m@T= #0P"<@l",0P, @ @8@00 `$ ,5P@ ,T 4p 0V 00q x0sk 4K 00K P@ \4 =B40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 80 0@T = :0 |0凾 -LMT00T0R@0lp 0K P 0! !TAT W 00 -LMRP`P0R0E4K, K00K,8@K 00@P@y8@ xpwg 8@4H 0 1WZ 00 s! x1\I %|1\ , @0h08@ TH4p0 0  H0.8 4H008@|H@4R 048 80.H 40 80.H 40 80.H 40 H40).8@4H 0 488崽 -QLMp`<0 0P 0CSV0 0ME4K, K00K@, 008KpP@jV 4Px@<1`VpTS -1T 00U*V8, [V0h08H0 0 H  80.H 40Y 40P4P P4P t80BH 04880.H 40 80.H 40 80.H 40 40P80,H 84 H004 P8 p-LM`@P@0P @dT:p^T*\^ @T1!p U@@ Ud@@T1!p -LMRPp@B `1 21T \ BT L0 PZpYP -L$MQ40 0`p@0 } P8 !!q*f`fPP 9DD0P@<0  0!10C r。aV LU00@C m P0E*< P@@ < PP@T@ T* 0!10C rRa1 )U00@C J P0"*< P@@ @< T:<0S 8\  40b@< 40X @ @0KjC,0@ Ce8 - LMQP`8 p=P0Q:0K4K0C, K 0,W 80Sz8@K 00@P@,pjT00T01 11x 1RN +1R P00 sPUP0U8Q, 84H 0 H0$"RP * "8 4H00x r804H 0@ 80\H40 $ 80 H 40  80H 40 804H 80TH 40 8呻 x,~ -LMP 0XPp, *0P p 0W:p0WT0U,0Cl@ CXP`XD$ K(0K$,@K (0@7P@,,x~ H0 0^  T00T01 11,P0pW. H 04 8 ,, -LMpt4 80 P4h02  q 4 RT t0,KS0,0  , 0K,4 00P@}8 004R c,04 08 t0S, t \00 00C B0 & 0AQ00 " h0@P% `X,0HC `0,0 d0 @@呻@H<0:Z0@0@ 00S0C00 40SR`Xd0` PPp`0X P c@~X` 0 P[P0  X0s0s), 0P@0, , t0Sg P@ <,0K@-P@Y ?hf@jjT;; -LlM0 p d ,0 0L X0   T 儠x 4T0dp h00 | ` 0 \  0 @P@P 48 ,0S $,GK T AP@<0 0.S  8K0mP((܆((p| 0x0 SS| P Pt P 0r S .St00CSt0 0P0 h0 HK h@ KD0KP@p@0KL@KH0@妷P@H `PLH0@\\Q|0UPd \0  `V h00꠹U|Pd \d 0exd QQ   00S0x #70R00SfT0   0 9P@X|0L,0d(0\;Q0 K X 060| 0 UPS 00 \P PH L 8K QPx (RP, |0L,0p x 0qTl D0lS`P UDP `bLpx x0Us@PR `x0\0P00S1  . v* 0 P@lt 0\0R00SpD P0KP@P0T \ 0P;0  X   1lt 0Q0R00S T 0 T   `pD P0KP@\0S  X  060P0T X  0 60pDP0KvP@\0S   X  P0@6 P0 X P0600 ` v 0 /P@Nlt 0\0R00S BT?pD P0K5P@7\ P0R T0 j X ~060 p$@XUPp0 0tH  LLL+HP {| *u| " R R0.Sbl DP j; -L,M(`x@ \p4:d 0a0X03 04 P@X0x 4(#x X40K<8K0 KP@(40D S\0D 00K80  #OP7x0 qD0 4Ht0T$p T q! (0i$T (0K$p -Pp( $\ W (0SQD$d 8@0T$p@0R괞;; -L MQ@p`d%X` 0D 30nR\050@ 70 0 `PP X 0\ H 00`X H a0N 0-LM$P 4@0  @0 -LM00(P0C4`p00 P,K0KX PE5 0P@600K4@K00@姳P@-4\0H0 R (0U  P 0 PE A\0 0S 4P@ 0\ 00U00S鐵4卵 -L$M40@0 < D <0 D0PJ 4K 0 K0APp<@00K408@K@JPp+84H@ `0T*PU  0 @ H0 `0T: HWD00D0  MP 848p682PD\ -LM4p`0K4K 0PP-00K408@K@P84H 0R *@T T 0S H0 0R:` 8 -LM⤐Kp  | P6P@$  ԁ0S   @T:$0@-@T4PQ @0(0$ ,P@z`80S|0" 0Q{0 0S $0 LM0 0MP@  $0Q 0V@ Tԁ40 08  0,0005x0s/ KP@  Q0@'P000\@KY 09Za30Y 8Za3 M| 300 05@RN K\ 0 0S10S`` X0 0P@  /q *f -L,M|0`p PP P07 V$ '0@ 0@@ P U $0000  0ZPP(KP!4 4 :呱PP, ;00i000,0 H@_  0P410 $8 !8 0 UP42 0 $" 04800 $" 042 4$ 2@S\P 048<,0 0$(,0 2S<0 \80S0 4S2 x0  048<80 0400020U 0E8  R:0B0Q 8\ 4@ ,0@0!@ x PrH 0,8<@D < 2B!?04 H @D0H00c:D80 4Qt0LP 3R3 H0 x0l3H tR880l0:0P R*l0 4p0K4 C@`\ d0Kd @0RX OP|0@@,P0 R0 jZ P ;A<ꪲ,姲0,0 |Q-P00B O:PP< VP ` PP$00100P0010h0 0ԡL P |04 "!;42 PPP,0\H@ KP 0|0,Z0,0 y$ KP KP JP{/0  4 8<0@C`P@V0  x0H0 ?"!0 #L,4$ 8<@0H&%0@ 4| 0 04,0j;;и9;00 -@L pP`0 A|`PQ`<L;I$0 :$0! -LM0K"@P0   p-LM@d0P0d ` L0 0T T T0Z 0,0T` &1Z "1MB| 1 D Jp p-LM80@SP0 0<l0S 0S `V p 00S0  -LMQ`0(  $0 ,` h0@Sph, K 0STL  0P$  $](8; -LM0@ 0KP0 00  00 00$   0-@P L@P00 4 0 0 -LM䑟0 ,0 @`t0 pS( x0RP#N*K s0\ KiPPC04 K0 !P0 PK  DP @P _80  < 0 0/&00  K0PP0  0  ,0 S ,AYpYLKN KO0KJK00FKH KP0[ 0P0Kjd;Tj -LM 0@XTj p-L M@0@SpPP `K70 004 0  0 00lj i000n00rp h0 0h0 -LM 0hh4`0  0 $  10 !   0.m -L M00PKp470 004 0 00000h t` Px0s@h0($240 h0 0 !1@00#!  "  004 ` 004 0PH` x0 @0~40 (8 Dh0@ 8D040Ld $ 4x0\ 00@ 800(0 Zi 80Ux0S 1\X `H@0L aP` 1$E,$P`T lj i00r0n0j0rp h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0P(0s] 4 0R #P \00 P 40 (0s (n0A00s 0rp 09h0 0 h0 p 40 Q Ph0h000h00 00Dp 40 Q PDh0h0 0 0h00 00h00s0s -LTM@P 0ST 4` X 0ST h0ҥ0D0 TpXx0 R0S*XX rP@0K0\0d 0L0 TpLx0 hDQ!0`Q!\H zp`0pX `K c r@pKT00\ p S; X`  br8@Kd0 P@>@0K\ 8d0@ HP0bSP1TL H &@8@T0SUD0SPpT0$  T000,,0STXx0`K pCrXʵW`  b9rdd0 @pK8KPp 4K00 K0P@00K8@K40@ث@ -L P.\ K P'@ PK K 0@ PKD @ P pP0  养0  0 ,0S ,:Q Qj;[0 [ 740w 5 @0QLKN KO0K0N0 JKy0E0FKH KrP0[ 0P0K5jB>;Tj -LMP` V$ "P 0@ B`T+)/P`{ 0 w@`n,  -LM@ - -dL[ML 0 ,0 d! dA P! h0`! 4l! p! >K @h |A  KKE(h ! P 0@ 0 6 ,0S ,9h1 `LA0X Sd1t 2R\1 2 x0s, h`V# `>K/>KX Xl`P@ld\d0x a0`V`!\T KOK\ `1QKd =KJPP >D1ROK@UPP HD1@ H0bT!S0!P1 0U*0S S0|1  Q > | >KH T1  @ 0 PU:KPP  lAT p 0Lp \0lA H}HǧHħx1s KtAtA?(K K?K 0 48<S@1\SX `H@ a0C`p  1HF,`$`h2 (K 0<|!MKg| 0@ HNK0Hz]`/>K<@0R@@0@ T`! SbV~KA_x0 s@0041 81(@KV 3 V) (K00000h!0S:MKPP @ 0l1S pA@DpA Tl1 `Vڒ @0@ NK 0(@KpKK,07@\0(KKK,020P!p1 l 0 pcj,;<<;0 <0< 0< 0-LM0 PR 040@0T  R00`0X @ ck  0 00 -LMPpd 80@0CSBXP0X`\P | | 0 D0400s@ᤩˤ 0R40`X  lj0  eP0  X|0sH<&X@%SX>>@; 0-0L@Pt $0@]T 0"P  0 0.$OT0X;; 8 80-#L@z0PSH0 - 88LM#l0PS  0R~WX0 0rpX0 $0S1 $  0$00S\!S :0S \D | 08 )`vV- #V 0S  9`"0 p 0  `@TQ 0 0 @@LݢFע$@L\#`*0  0  Q 0 0 $ᵢPj; -LM@%+D0S H0S \{f0`t`\0 hL 9 -LCM q 8 8#$ P @R `52 P$0 S $5,IK J/K0JPP(\ 0S@0SP0  K ~0@ (PM(j;0 S 0 4   0  - 8L8M#@`pa;0SP$h5T \5T{ ?P5T0;0 #<5T 45T 0S 580@S 0P080#@4T 4T004T000P 0h4T- \4T P4T@0@4T=0<0(4T 4TL0 4T0004  C K+ 9+3 ֡0@S0@@H03T 53T- 3T t3T0:0d3Tz00S0@0vQHrp43T00=0k 3Tf0Sc _2T0D000S0<0U2TQ ,2T$ 2TI0L0 0P0 0T0>2T:@2 82*@T @/0S0+ 0) 2T 2T1T0S 0S 1 0R R   Q  0P  P 0T 0T 0T 00T 0T :00S0T|0T*`0Tl0|0T 0T|0T |0kB @sB@vB hB iB jB@fB@qB@f@xB@tB@|B@nB@wt@oB@>>~fyBrBpBuB}BzB}fwBgBvtmBfBlB {B D> -LMP0R,(Sp@TZP,@(NᒠY ` VA ! ^$P]P㕠ZP,( -0L@pTP`/ 0S( ;PV 0R`@TV 0SPi0@V S5Lj( ! -APL` 88#NP@ > pR:0S 0S  0Ps $0S(0 $ \cPj p- 88LM@#P!1`s  p 0<@80 `00`Pߟ D> 0-@<L 88#P`0S0`0  Q0 0 0S000h鼟 -LM@< 88# :0S00 0 P -LM@pTP` 0=  00 @T(\0 y<0Spe9 R-L`Pp U @V@1 `VPpM; -QLM`p P 0 PR@T 0=00 0 @T(d\0 1<0S101( -LM@0 0 $K01K $@ 1[!0 ! -L@M 0(K( 0 $K01K $@ 1[!0 ! -L M Y pp0Wp`XP4  R400400@0 @ @5`0K@'000,0 j0  尡 4:0S$P X 00S* P0  $  Pj -LM@ GP 70  ?0P00  70 -LMX0@0CSX0P(P,PhP P  -LP`p @00P, d 0 `0LLj; -L@T 0` S V@0<00`PU 00S PUQ dp0S S l0SQ ]h 0ԳLjf0(@lfPj 0-LMQP-P P@K00, 0fP0S000-0T@K00, 0QPQ0 Q0 D>D>,0 P h0SlPPj -LM@\t  OP( h@0lSl00pp Pjl \p0p0p0 -0 @LT`P p 0S @T p0 S 2! 0W*!Pp Lj p-LM ` 0S 0 PU 0S PUp 0SU z@IppLj@-00 Q:bP, Q*@0R : 08 <4P 000aS a00R R 08< 408 08 -00 Q:lP Q*0\:00 0P00 0 -PLTM@`P p@@ @0S񟗱((((((((((((((((((((((8((((((@(H(((`((((((((((((((0(((<((((((((((((((((((((( (((0((((d(l(((x((((((((((((((((((((((((((((((((((((((((((((((((($(((,(((4((((((((((((((((((((((((((((((((((((((((((<(DpB `0K> `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh Kh0 \P*U 0 P: cR 0P*0 )%0\*W \*0 RUhl K9l000| 0 RUTp Kjp0v w0P:UC 0 P: cR 0P:0 } { `0Kw `0Kqs0àpǠn0<àk<ǠigpelcaP07*0qZU 0 P: cR 0P* 00A S@-@**\ *!00S ((((((8(8(00@S S S\!0S * R:!0R0SS `S0SS 0@S S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P D> - @LM >*h!ꄲfD ) -rL Q0P0 졟 0 R1S 1 R d 0R0!R0a50S 0S 0R%L\ 000R00R00  @P.0  0@ @P0@0@0@0Q@!R0 0@! Rm? s ^ l W0\0 H4D>(D>,D>0D>c; D>\j ; -x1LSp>(@4Y0X0H0P  (`00(@0 (70Y%X00P a l0R0 000 p 0xAU@@@ ` PE0U 0D>P) p-P0LM`%QU Ι@ 60x1ph静p0D> 0-L⽙,0P@T @T0h鉙Xj -L`㩙p_H0PU ,0SPUhp@A|\j p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`PP $ 0`S00@ ph G(D>`jXj ; p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`0SD$0 `0`00 @phZ jG(D>`jXj8; p-LMP5T";5L2 !$1D"D2(!01`$8> R0 10  0 PA A R0000 0 0SP 5 P 0R 00B 0B PQ Q0  0 0S0C 0% %01 $0@T 0 R 01|Q@TU=phX11< R@0@ <0@0 < @0 )d)l)t)H>jLlXj0D>\j`j -PLQp` 0@S` TV@0@S0 0C0` v000 p-LMK`L@T 0S PU  pP  p-LM@*P`% PP 0S 5P@p@˗-ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T 20S  @T2PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S $D>gfff, ,00S0 000$D>Tj Q00 00C0Tj -LM܀`0 V$0  % P"0 @PPPTU 4pK 2 P`PU@00T00S$0 S $*jTj$D>L; -LM0@S  P, & 00ah&\)>Q 00, p-0LM`PV @T 0  R @T`Vp Z1P 5 0S 0 S L1PpXj p-0LM`PV 5 @T 0 R @T`Vp0S %1PpXj -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z u&P  P 00 P$0  Q 0 Xj,D>4D>0D>H0Q P 0 RPQXj -pL W`4 @T 0S @T XR 5 0P Q 0P0PP*0 0#P:P P-L`Pp @@T Q P P@ 00 0@ 0S0C 0 @@\ $0\   e/P) 0-5P0L5 @T r@T4Q 0 S4181 <10C<16t0h: -LM5@059h -LM@9 h 0-@PTL @tT00000 p-LM`㐕p0P@T %5R0C @TZ80ph%(501S Xj> 0-@0L@PT (/P @T00Xj -LM PU, `@ 7U 7U 70SP7U ,0 S ,(Pp t7U p X`7Ul T7Uw cH7U- @7U \ p  0  0,5 @)̔-P0`0 P%   T&q<$ 00\5   ǔ@ᛔ㽔@ᑔ 50SXPr$1S  IPcd%5ATO PUL 0SI0FX0S ;S SK@  n r5L@K05 P3K$5 05x3K$5 @TR 0S 0S @TFzS SS 4Ua 43U 3U&PPK0K@ P"@@ [@ .\@P$1S"  \0S ?03U (3$3UP $P U<P $PPK0K KPFO35302U(2U* 2U 2U 2U1U1x X`001U" 1U 1U@K@ a.0K@ &\01U x1Ux`1UqF?Pv<3P @K <.0K 1U 0U:,0U42&#P?%ji$ii$zi \;FixIi i i i qϖ0D>i i i i$Fi@i$Hi Gi i Jii i 5i i ~i i 6i(i$KiŠi$xi i$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,%P0pD1XU.LK(  ! 0S7 U@` 0S<Kc$ PU Z 00pZ@ PETUXUP0 0eP  0 3 p<K P PE p jXjd; -LM@4Q 0 S4181 <10C<1q 0-@ L,PP 0 C-80 $000 $0(0P0`j -LM0`SMPU ,P7 PU  PP5  Pp+ 0@T ,P& $@TP@ 000@00 pp  0P <9 T,0P/S,0P9S`j p-LM@`TP ,P @TpT  R0000 0 P 0S P00CS00$ R( (0l0(0  $(0pP R000 0 0 `j -LMȀ 0R$0 0@T 00@T$0 S |$$@`TP 4pKV`F M, PP@Tjl; -1LM@ T$ P +P $@T$0 S $F$T  R0 @T 00@T@`TP 4pKV`Fn (, nPP@T`jjx; 0-P0L@PT +P $@T0T 000`j p-0LM@`T +P $@TpT  0 RP U 8$1 SPUp"p`ji$ -LM0@S SL ?+PT(  7+P h0St>: 0-T1L0MLQ@ T  8>+P< $@T(@K0 (0K'K/P@ <P$%P@D@K  /P@ <P %P@0 S Xd#0 T @T @gT`jj;?:; -L$M@0Q0  %2 800S80 0 S h3#<55P2K4 K $800CS80ʴ5<55 j;i -QM 0P P -Ѝ0 ЍP0  ЍY_ -L$M`APAUD` H` @ p2` Xbn@S 40 40 d0S @40  \Q 3 R*TA`@`@0 R񟗸#)H$)!)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)H$)$)H$)H$)H$)H$)H$)H$)`$)4PK  @0PcsP 1  5  3Qj H0S02K H@ 0  r PV 0 B0 0 XL 1000@*K   D0 S<K aPm/`@0<K0D0 @0 @:H(@0 'd@PA` 40 @'P80@0Cp80`5>ʚ;; Q-Lp`7 %. 0(   R \ 0S  R\  /)P  l))P11<<10P@   0@ "48<#H 5 㚎P3T  TC 3T 00S:0S50S2 3R.Q% 0 0CA 0tq P0 0C 0 V 1000 m7 l`ahnl0 , ! , !2 @p<0S `B 0R 000S`0`0`0000l0S000 0@@0)1T) 1Tv0, ! $ , !p1 @p0S ɍTA000 0@@05Pt{50, ! ' , !0 @pƍ0S ᙍ@000 0@@0̍  (P mlmkpm8D>@l<lj5݆LlH>@-@@:@0\#" 00  @Z00蜲f@D> 0-,0L@P0S0 Y 1X \ZPFxY 0 02<0 0h00@0  8000E  /?K'0 ) -LM"@R \0700U"R\@-@ *,  0!\ "0! ": 9@-^p`*#!^ ",!1 #: \9L9 0-0LSP@/ S /0 # 0S0S 0S0S0S 3000  00 00l d0ST L 0^ 0 000  0 ]D>cD>QD>WD> -LM@pᤌ@,`K4K P@Q,0[ 40[B iT  &0S  @&PP0 00P7 P@"    00 p20S"00?B0 " " &P2 02&4 "7  -LM@;@,`K4pK 1P@B6T - &0S  @&PP00CS0  R0700 , 20C 2 p&P20C2׋4Ӌϋ -@LMh\lD> - LP` X@T( 0 ;0 \0%0 $1!0 UppX0Z Y@0S< 0( dС;4)<2)hj -40LM @P0 0hj -LMp`P@ <P 5T` 4 20So 0@/ 0S\ SAQPi 0R@000Sp0 00pph0 .!  !41 @PD0S p 0@P 0O000 @@<000i 7 (t:i/`@~i40 3A0 vW9Ll@l<l;jء;Q0X0ḁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0\02i 1i i 4)i -  0@  -@L`p  P-P @  0` pP0 8; p-RLM`@PPU@p 0-L P@\p 0  !:0P \ 0 P8;<; -QPLMpP` J WH 1RI 1RD 0S?0@S000000@ PU P@U 0S @T1!  P UR*01P UR:$ W0U0P00S 4@ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  H 0S  0 Q  0SD> -LM 0 -LM@ P`P, 0  xSPc0JSTU00U0S X00X0S40  ([- PpA X1  Π L0Ap,0HDL (P$P` ( 0$ ( 8D ( P0380 0< (8 00 S 80S <0S Pl0  )P04 | 8 80,0@00 oꫪG> P0- L @T 0S $0PS 0,0PPP 0R PR* q  000 PH0 -!40 00 p-LM`0@PT@!T 0 S 00 0 0 0d0 00dS00 0p  00 0 p-LM@PTP` 0S0S|2 v0Sp 0P*S~ 0Su |Rk <2R` 0SJl0SGVB VV  2R V6 V1  0V P|00pV p0S p}z 00RpD <00 CD<Ax 1R V00|0SP0S K0S 0  pq0VV0 DP |0( 0C&0BS0#< q c0#22c !kpG>B p-LM@PT00P``V,0Q#8Q<QQ([-$`pd0( !$D ( $$ ( $$ ( $p -@P0T@!TL0dp` 00 S   0 00  0-D$ <0P0 4 PCD@L<A|D 0x0 00 0@Pt X0dPTPlP`P0F>G-$d A?L0CR0`@0ltAp0PppP00S M,0 8, .!0S 00Q^Ѝ0 S0R 0R 0RP 0R 0R 0R 0R 0R 0R  0R 0R U: 0e,c0 \CRPEڈ0Rh00S0 p-LM$Pl@40d 0a`SRQ` v`F $00A?C0CR$*0S d00l  !l00Sl0 d00 P @0L<#0@0l0 S0 Rp0 h0d TD< e0eed h0T 0rSe \80 0rSe \` 0-L@p0p`l0RSSd0 @ 0PL 1#0,< @00`8 `@0< 0Vdz $0dA?C f0CRs0S dXX l0R X0RWh B al x0X `Pl :R80@X0d0 d 0@P L2#0< ,@00` 80`@ 6< 0X00CSX0d00d0^ Td P00 `0d0T0L0 Rd 0 0d X0@0P L2#0@000 )l0d 0C l0d X l0SW S^Td P00 `0Ud0T00 R  -L@pl0SSSd0 @ 0PL 1#0,< @00p8 p@0< 0X h0PW\0p XP x0R*$0dA?C g0CR0S 0dXX l0R X0R0S R} p RX0S,`0Sl00C ` dl000 0 SP Td P00 `0d0T0d0l 0 Bd0l 0S\l0 a0 BA`C}l0  Bp0 0Cl p0d0PUdP0 @ 0PL<#< ,0@00p8 p@0< 0p0CQpd 0 XX0d `O Td P00 `0d0T0G0 Rh0 0c S}XP{dy l0SZ S2`0STd P00 ` 0fd0T0"0 R d 000 S 0`0 p-L$MbŸB 1!PPPU  Q 0CA 1Pڨ1PPUQڀaà1#0CP!\1P0PUQ8 K0QP 2[PU02K00Z pP2[PU02K 00\U 2[P02KU00ڔU 2[P02KU00X\FX`PA0  4PUp騺ff9f9fff0f 0-0L PR t0l0d0d ;`0$;X0X 0;T0΅&MK(˅0h D0f999 0 R0&=  R0ZL0  R0Z000 00$0$  0t G-0P 0T@T`0 .T0T{X˓ 1 Q:0 R@0T1 Q:L0 R ,00@ TT0THPG-0M  @ 0"00\0Z01T+!0PUE1T P0`1 \ P @ڏUZ0 d`H0 RL0 R 0 0A000J0CZ0X 蠟0P NT;PE! S`P\Ѝ0@ S c0 !! 0l0000PnL0 La0 0! R $00" 4 L6  -L$Mp@`K 0R0(P00"Ƞ@TQ0 @RT000 -L M, 0,  pt"t2pŸ Q0 `@00 PR 1 0R00!0` Tk`0 VŸ 0SW,00!0?`V `FV0Q⨑P 0Xk!T0C 0X l0X0CC!1TkTD!0 0000 Q0PP X[ 0PSX˔0,0C!T˂0.0 oQꔐ`唠0 Q1ҵ> 0 0 P 1   B0^ 0 0 0b 0 0Sڃ=LHPG-@TpPpP1^`ᶀ&^@\ ^ !000 \ \ !000000T p \pP QpP ^  Ų000t G-M 0Q  ZP C 1Z00\1 ZAl~dep@0dQ.ڰ010   !0 0c^ B Z^  Q  00 S 0Ѝ 4 010\~ \" 1. HD0nPk40($000 "$ 0 0c\à3 B J3c@0d^@ڰ3 3. 0 "$ 0 0c\à B DQ8ßJ0 10 #0#40 0bP B2 yŸ J010q2 2. Ÿ0   ZKl2Tb@0d^:@P2 02. 0 "$ 0 0c\à B  QJ0 10 !0#40 0bP Bl J01Td1 D1. D1$a@0d^:(1 1. 0 "$ 0 0c\à B  Qژ J0 10 p 0#40 0bP BV< J01Z$<0 0. t -LM@+, +&(uD01>0 R@P 0000Ժ9 -LMR@ \`pڈ,A0 B<0(0#40"(0aR# A  R PtF000 0#40 0bP B Q \PڤG0<0 0#40 !0bQ B PU"<0a0 P$0 1>0 0 0"$ 0`\à @PU I& o0 1>0 ` G0<0@0F   00 "$ 0 0c\à B 3 0S:3s`P0fU\ß+050 0 "$ 0 0c^ B  3 #Ѝ+0 50 0 . 2嬢` 1+ 0nPڰ0000 "$ 0 0c\à B <2^ ,2  nPPaoڸ0000 "$ 0  0cP B pGW113<`ӗ`Ӆ!0tQ0nP?ڱ0000 "$ 0 0c\à B  1^V P1 nPpaڸ0000 "$ 0  0cP B 60 0 000   0 0 00   vf9ff9f- 8Q Z y8Q ,8Q .\000 0A Q 0@-@0SP Sp 0 0"$0C0 00 0"$ PP0x00t S00 "$0 04 4000S 0 0 -L@`Pp0 T  0 &Ġ`00  0"$ `Fv 0 `Fv00 -PLM0 @\ K @@@ 0S0000 0-PLM@ \ $PU 0 KS(  000$P P-LP`+ (  P pp0V p 0`f 00FS0 `@P 0&SP t) P-L@p 0S `P 0S0t)t)Du)u)u)4v)|v)v)dw)Q 0 0A ^ 0` 2 0P0 #20S 200Q  0A  00` t2l"c0#22cP` D200  9Ws |k \_   0 S00000SL  0C00< 0 00Q: 0 A0 0 80 PQ) 0 A0 0 40 00Q 0 A0 0 00 R ` 0h00W  00000` 0000S0S 0霢;;̢;B;; 0S p-PLM`  Rp0S00 00\/ @Q Q0#S Ra\00Q00S0 d0Q0 @PW 0@P0ppSp 0-80@S<0L0 P0BSR 8P0(U 00 0$040<  (! $ -LMPp(@  P@  ( `P0@ <(` ,0080 ($ -LDM`4T 00L PP ,0%T%0`0$p PC2a \ qz)|)}))))L) )\) )U XU 0uPUP H@0 0R {)D{){)|)PE@0qPd7t00K4 K80K,KL,04 80~P   0qPE0 $p PL0 0c P  T 4 LP j07sPE) 0qPE0L $p P$p PL 0 0c L0 T4$p PL L0 0c 0P0  T4LP 8U X& 0uPUP H 8"(#8RR00Pp 00L( $p P0 0c 0P0  $p PL0 0c  T4XO Y, TP> Y @ T@! T @! T0 0dP 0ST00dT0 d0S00CT 4 P LP 40T0 0TS, %T%, 50c0C2l P Yh(0Q ST0 T%0c0C2a 00(S QT T%0a0C2a $p PL0 0c  T41 U X 0uP UP HI $IR@2P0L@TL0@(  P x 0 @0 'wPE#50Y*U XO 0uPUP H  !0#50\qPE: Y p0 S000L0  ,P0@0(" 00<0YX@ '*@U *X 0uPUP H:ğ 10!@P 0 Pd7t  @" 00<0QX@ :L@0@K0 HK@  LDK<0K < P@tL<@D H0P@W L (!L0 $D0H  @0 $p PL0 0c  T4P LPP O LLL4 T 00P R,0%T%0b0C2a 0LS$p P U0PEJ0T 4 P LP 40T0 00T S500$p PLLHjLDg$p PL0 0c P  p $p PL0 0c P@ dL (! L0$P@ P U *X8 0uPUP H:7tPd\!X@ " 00< 0RPl7| Y00PQ P  1 ^  00 L0 $p PL$p PL0 0c  pP L (L0 !$ 00$p PL L0 0c 0P0 0 ;(;8G>$9H;d; 0-P@L,0  C(($(@ $0 -L M0 40`Rp<0S7,0b$0,0 0XP00  80Y @1@!S   0P00,00PU(Pde0PX,0$000 00 0c  4P<<0 S00  -WMLMh , h d ` \ X T P L H D @ < 8 4 0 l% p5 =K hUp h@K1hK0PU1h0hS0@5 B hK1S@T|E Q1 Ph K1SPU5xU S0!5 004T5 *hK1@^ JT:hK1% R% JEUK0LhK1 L@PU `E dpK 0PU@@QKA ApP @T! E0Q00hPU:|x%PPdU P ubU |Eh0K10Cst5 E| ^\t x%| j% 0@j$ P !R  t|0a CTh0K  *@T*0 R c@T:`(  0 P ` 0 0Y0K !   <$%  `5B%05 Q=K  E| ^ʘ%|hE1hW <$?0#0#% 5 % *l%QL*QE` 0 %  p5H0T *K1@T:|%0BC P%@8P%0C !0S %EbI80C !0StN~t P|xP| Cx%E0R0T00S lE0np!P  % 15 Y PP 0-LM@P 0 P @xp p 000000鈣;; -LM`P 0pD SP@ p0 p 0@0 x0 8P@ pD0 p 0@09h9ԣ;;ؼ9`9 00a0G>f -MMLQM $ P 4  0S0ʀ!QxxxaxqGt1t!JNK4 $  @D01Qڐ 01Q4!Q01Q!Q01Q܀0ԐMK00J  01Qڌ`p0 0 p`L 0000C04 4 0$0 4 G>G>$f,f(f0f))9h9ؼ9`9 0P0-LP 0C(!$T00 -LpP(` @ P 0@0pP` -LM004, 0 Y p4 ,0%0i00C20i $ @`80 0 S񟗑T))) ))())))4)68 4R \Z0 00 0 T *4\C 0 40@0CT0 40 :&1010 S0@b8 0   00 0 0@ 0& 00, $ @0 0c 400 0 4,0 o} 000$ @,0 0c  $ @,0 0c  4, 0@,0 004 Y4 ,0%0i00C20i $ @80 00S S 00$ @, 0 0c 04,00 T *4\ 0 40@0CT0 40 :l4! 0 0@n8 T *4\ 0 40@0CT0 40 :#101 @b80 00 0 ]@y 0#aT *4\t 0 40@0CT0 40 :T# 1@n00 08(0  0cS, 50c0Pc00 Pa S 8\, Y< 8Q 00 08, A8 0U0C(PS004,0 0 40 Y,%,50i00C20i Y80 8\$ @,0 0c 400%(0R S0c00C2c 80 58 %00(S Q0a00C2 a 80 58 %8 R, Y8 80S 00 08  B8 4,0 i0 40 Y,%0i0,50C2i 80 58 %Y 8Q$ @, 40 0c ,0 (0R S0c00C2c 80 58 %00(S Q0a00C2 a 80 58 %40 ,00 400 S $ @,40 0c 00$ @, 0 0c 0$ @, 0 0c 0$9;4; -(0L $ -400P`U,0@e0 T@!0d 0pz00 LT008S\ 7X  ,0PU 0P4 (PR4P 0@e T@!0d 0 z008T00S\X  P<  <<  <G-M0p4`04 V0 0f00 $C2,0%f q^0PE^ 01 \ 0 H0b02 U  XQq$ 4 @g0 0c 40P0 4`Ѝ0c0*@ 1 01 \  q$ 4@g0 0c P0 41q0$ 0@g 0c P 1 l0^p0 0PE^ 01 0c0@ 1 01 4 0q0$ 40@g 0c P0  ^*0PE ^: 1 (0 0aSl0 g :b pG 000pW0`c,0 Wlpl0\0($9;4;G-Qhp &hQ RM @1Y 1!Z j20J `0` ``@`P0` ````` ``0``Z`Z 0Z`@Y7'cb2"`cbq0S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:00ljG>`;[f p-LML@0`SP P0  hpP @fp@-2\ \ p"Q`@0  n `&"`b.bn  n ` &"`b.bn  n `!"`bP. b0n  n `&"`b.bn  n ` &"`b.bn  n `!"`b.b0n   n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn 0   n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn p0 Q| 0 n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn p@fy7 p-LM@PT7` \\0 FXPL P 0 a!0S00@@ pG>G>xj -LM@00yN R000 h 0 xj --1LM@0T` ,0 p !0R @TW LP 0 XP W0S  G!R 0RP* P!W 01GPP L  0XPFpW0S   P ,Pxjʚ; -LM Q`Pp0@X S 0SUTX Qaп))))))$)D))P)))))))))0 WFT :9 0S EVVV 0S80 0 0pV p 0S 'M--P@  @ P <뼥; - 0L10p NPP X0@T L` R@TP0$j\j,j 0-LM@P0 t@<"d0d0P0 0S0 0P p 0ȥ;,j`j\jjХ; P-L@P p0P`  PP T`p`` P@1Sh(p(` ! zG>jP0 ,0 0P0!R00G>j -LM@ \ <0S 40 -LTM@P`pl@ %gP0X P@Q 0NWl  40 80080 fl0 lK `Pl@ 80080"l@T 40  hPK@ 0d0  \ 00`0 <0S 0 T @0 P <04 ` W 0S h@K@ 0dP 0S  00 0j -PLM@+ 800CS8040 00  B 8Q@P 0S0C 0 f 0h h';|j`j;; P- L 0SC h ; -LTMpp `@Pt@ P3@# 0 t0 '&30#0P00Sl 8 0 0R* @\  T00R00S T !000hK@cphK\  t0d `p L A Z000 c Pll@0SPl9Tl\ 0S 0S40+  \hK@) 0l p`l KhK\ 8` 4P d `p lT\4`@ '40 040l0 l `A@jjj -LPM\`Kp@` `@` K 0X0 0P 0T 4, W@-0 @ 0Q!0P*0 00P:P:`@  -L`lM"0,0 唀 ppZP{ K@0 0`0 p \P F?PY K 0 ZP` @T 0  80S>ZV"@T 80@ 0CR80 2@0S$ 0S0C 0 @P 0<0 0 S  0 P1 ,0S D,]  @080P` P@K""0NK P0KOKd@ Y0S P@w 80@ 0CR80q Xg@Y3A?P7 @ 1pj<;`; 0-LM`P@\ T 0L@ @@0 <@40$000^G>jh;Dfj)>p; 0-0L PR  iP@0 H 0QP  00@0G>j p-L M@PT`"  R 0 0 0 R000 0 0V  \  p 0S0C0 @T R000 p0=0  0Jj; 0-l@LTP  tR 0 0 0 R 000 0 0  0S0C0  l@T0Ħ;j -P1pLMD!P0l@0T\0` 0S& @T P@ wp`Pl00Sl 0 0l0l@ 00@@0007 R 0 0 0 R 000 0 0  0S0C0 0 5>5>j;-00! j,j 0-L@P0P   0 -<1L M``$1pPU0 @T* 0 0S% R 0 0 0 R000 0 0 \   0S0C0 @T 0 0SPU`L0i,<B0  0O5>jj>; -LM0`SPp@T  P8 @T0S `2S$ 0W0 P@  ,,0V0r,0  ` 0@@`00 @@`08V#x 2S ,00,0G>P40 R  2S RG> -L lP 2 S R,00CS,0R00000-G> p-LMP`P@ $ #P `!Vp) -L M<0S 0 0 4L PT# -LMQP@` V 0R0U00S PL00C0 P4000C000C0_Up21 R `( 0R0U00S V1S000 S0000 0   =M0@00a_q` 0   j lG> --|LM 0,  `PSp` `  K 0SB1G  R 0RF p00 0@8 R3ڤ0X0S 8 V 0 >0QFU ll(l8SX@AD,0 S D,a!?{=PV %r=0S S+pWR oP`  0O>7 Q80X@@00XS0p0  P@0S p@ V W0 p@00Y <PK@ 00 K 0R`0 % 0 S"0S 0 SPuP &LP p0@S񟗕`))))))))0SpK K0Pp R L ($} 800C800D <0500 KKP㘐p80080 00 0 00 D 7SF x | 00 <0S0  0@ | @0x 50@0p0  p  0 K 0P  P@ ]H` K040(00 L0 0@7p>P@K">"0P0KP NK d@ -p,0P /p$  P@ 0 p(P 0S 7P 80080Q 0 S00R0#S0Sg SKPp R|PixPa RUZ @ P P 0SD 0S0C 0= @ 00 0<20S 4 0 0 4 $(L <050@0S 0S0SD0d@T $0T  T $000 T @F K   K@4 P @@ LPP 0S0 xP0S P 0 PEpw dSbQS M {P@  0 S:P 00 u7p` FKRKP`#l=PP7 a j jG>G>G><; l<; 0 000 0-@PL000 00 0 p-0LM@`,P T*\0 T0#03 P00Sp@ 0B00R@@ -LM 0@`SF))))pm:PWP1U- @ pp@1P 0$ 0A0Q0  p <@ T0S0pᴠ0::1@:PXppp -L Mp 4 , P Y YmYf ,0SX`L`U0` P@1P 0$ 0AQ0U ` Pm@ T0X0U00S 4 R 00S 00S 0S P, 㔾P`0SP040 0UX, UR 00000`, R00U00S00` 0#, R`T`,0S`` -L`^@PP@ Z p帀04 0尥U 0 0P  0m jG>G>G> p-0LDM X@KRP@pP`Xx @505,P0  0 jG>G>G> -LPDMh@l \p P `hK@WV WVWP 0   hKT \ H P@2 $00  h0 0WV WVZ!  00hK\ `0 d P@ %0 4 l0 0h  X4 0,0  0i`V jG>G>G> -0L@M \@KR`p@MZPP( @e `$p  0< jG>G>G> -LlM80 SP, @ K@!< 00 D\0  @0|0 x 50p0 7SU0 Pj0pS `V 0S.0 PZ0pS \ 0S,0 S ,40 0T $X0(0<0 0P000040L(080<0< 0 0P0000P`K""0P0K<P NK =d` 4 0 xjL; -LDMhKP @3pW  R 5R pW @T 0 T P0`S X 0S0 P0`S Q 0S^0T0 @T Y  0Y @T0P0 H0 \0 P 0 \0 0 H P0`S P 0S"0  P0`S P 0S  00$h00!P000  00$h0 0P~0005050X  Y00Z  [00\  `00l Rh000h0 0P]0005X05x 0h0 0 PI000[Xj -L$M@PPp 0AS^DK` 0`U80 D @ 0 < Q vYD0P0CS))))@]P0 VD K# V! @!T3Y,P80K  X8  000hS0:  10 ?A1c0_P DKD0  Y  pP)gfffj -LM0p @@ LC≻P`X0 :P00@ X00 0000 X0   L$$0(@4@L80 -`LM  XZ2 i 10FKj !O0p00P@0S2PU@ڐA1 1R!   7<'(L!L0Sd00d0c41 @*0S2 ?2`"5h%U 0 (P$00j0 00 = S000 0S000 0S000 "=" S000 >S0 00L*LNlH>h;p; -LM@5M""vR222 `h 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMj.S@ 0`?C0CQCD0T T(0(0 0 ;Ч; P P111< 1N P PP1N  -LLM ğ0vP@`,0 !0 h dKh 뒯hP#0S5WPUd0[pWTK8h R h5h0A0D,0 S 8,pdK0  @T@p0d0[WHǖ 0  0 0  B0 HǖHǖHǖL2 1l0 0Hǖ|rh _U 0pWp p 00  t0 }P@pp0W}l0 @0\Hǖ5,# d[t Qd K0 R QQdK0 d K0 h Ð R h B02 0,Hǖ 0%Hǖ 0Hǖl B0l 0Hǖl0 0Hǖl 0Hǖz@BjL;P9 Q00S Q -LMpP8S ySp S p  Wp!0S7 B `<` ` ``VW x1@ R4p@TT1 R P47 ST7吗4S TgV *p*|*p*|*|*p*|*p*D7S "=" S NRD**h*X*`**T 1S1 RP P7S 90 1 SR9 Q-L' QQ[$P P  P  P HP 0P `P lP  0@*S **$*******,***********4**********************<*7no; Q-L QQ20@S ******** `0lH$7P  P PnP P, 0;0 0000  p@-1 @^PT * ^0 0S0:W0!0CR  101 ^00S0 00p00d0bT00!R 0S00 000S10C1 ̫ -LM@*N @ ht| -LM 9@S鑶0 900S93  -0L0CS|**************|* B1 p-LM@`0P*0 S& 00CS<*x*X*x*x*x*h*x*x*x*x*x*x*x*<* YPpYPw1d000+ -LM`PTp5P 80 0C 0 U`- 1`000  0@  #$<0 `#  #(80!<4>0@",1P -L M, P0 0  4 0, `> 0@ P`p$#LȠ4 P`̠0@'@| 4P`0pdP0`SP:,0 0S:0,0,z2,w24`,0 -LMP`pP5P 90 0C 0 V. 1P0 00l#$<0    00 #  #(80!<00" 0@0` -L M, P0 e0  4 0, `> 0@pP`$#LȠ4 P`̠0@'@| 4P`0pdP0`SP:,0 0S:>0,0,1,14`,-0 -LKP)`*< `K)K @%LB -K@LB @0@L28BS@ :P^P ZD,0 S 8,yj9D; -LM@"`P 4K, @2 0@1 @QX2  K*%.K000T2 @X"00C\P D2 p*4K K%K%K@8Kp`\L0\@o_`%KL$  @i_` 0'0| P`^? )p !4 P `"$' =t%K M_`" p(@ p K$< =KP)`*D `KvKKD K֏DK 4Kn<K Dj%.K@0P0P \DLD :TPT Z` 4K7L,0 PS 8,j9\; -LMp0@W,0 0`0 儠KJPK@ @060#0@?T@@ ᎏ @㛏 T' Ώ@ @0\0#0@?T @@s  ၏ } ᲏|,0 S l,[1  @j TꄠK R@K _ ᔏpjx; -LM K  -LMp0@W,0 0`0 删KJPK@d c@060#0@?T@@ ᎟ @㟟 T' ʟ@I H@0\0#0@?T @@s  ᅟ 偟 ᮟ|,0 S l,1  @n TꈠK R@K c ᐟpj; -LM K  -L$Mؐ`pA0K@0  0V,@ A0K@PpV ,0S t, @@K 0@]  0 PRA0[`F0VA0KPj; -L8MP@0 T0 P P0@ L@ D @0 H0 P4  @` T K0<` 0@ P8@ 鸨; -L8M†|`p 0TK@ԩ;;;8; -LM 0`S@*)P`q  @K t2Q DO)?0[@0 S ;*=*=*=*<K 6K  0A 0D0 pXDK7DPUP&P@F 1:)01P-40 0 PgU)D0S0    B0cc  0R P M( 0@pXT'D`Y 1@0C8#8#$0$ &1@0 0<'c&P@ 0 0/'D0K<K 00K"'0SmPUjD(hꪪ -WPL@ p`0@W0W X V @W0SH9 `0H9W@ W00W0 m& -LM@T`PpP7?*X?*?*?*?*?*?*?*?*X7US 909  (X7USW 57V101p90p9⦺(0  (X7US7R 0  501℺ t\p0(0h P`  ##00'l0l0d90d9D;x;;; -0)0SL '̀9 ^""  000   0#20 0$ ZD7 42S0 RT9 0T90 RT9 0T9 p-L M@KP " 0 `KS 0S PB*XB*`B*hB*pB*xB*pppppp Pꈿ99 p-L M@K|P  0 `KSP P0 P 0p Pꈿ99 -LM@ `$Rpo@P0U0 0P^ P@ @T1S;0EU8#XC X=Z; P @T1S%0EU8#X!Q 0@Q0 $Q0BR8#( 0BR8#( 㘠堀娐 q0EU8#X@00EU8#X@-0 \ 0wT9 0T9-0 \0LhT9 0T9 0-LP\@  0 S ̩ P 0   00 -L -LM82PS@ pP`\  &K"[9 S 5 Ⴍ2[ (LD0R 5 s[ 0(xX+ 0Sx0|000  B @R0 00 5 00(7S,7$0(,7 F( ly85 7 8(j5 - ꐫ;j;;;T; -LM%@: 0S' $ 00P ꐿ9 -LM`4@Kp)0 , 80 `XW@#0# <0 Pa T {P ,0 S ,Z 8KP7D7 0D7  W@T 8K P<忬( H8K P01  4#⩬( <壬➬<嘬(@ 0 `⋬ 8K ^P t t0T (@P@TP0PPpWP@@yj;;;h;Ь;ܬ; ;0;K P@MK 3S  S00M/K0 3 0 Z@@@Pڊ 3$(RP 04 @R\ 4\ ,4\ 4\ 4\CH7@3PQ>D7#500#0053\ 3\.T7DS >1(v.  0t3\ %h3\ `3\ ㊻PpK! ジX7S 3} P KP [OK! uj607P0K2\T *2\D7傎 00`9p00P0SZP@p@1`V$80$(DP` (2\{`?Pp 0|S:sK | (`V0|00Pp| 0S*{Pp  0|P`PK! ㄺP`P0[ S}N @ P ['OK1X7ST'R D7  ݷf c#jii iiid; l9i i i8i i >t;i|i|ii !i ii5i i 6i(i i i|i8i| p-0@LM 70'7 0'7 0v' Q'0 0Q0vn ΘPP\ H7 p8  㿘PP0P4 82@@8Zp4,Pꐑ**̑**hH>L*;9; -LM'7@R'7RP707 0-LP@T 00l0600050d G 0W; -LM7@S\P4:Sh07 -@LMn  Lǔ\ l 0jRl -LM<7@ 'T7<'SD79)00 D7)95(` D7X T0 Gip'0(40 ,0 = h;;;N -7j~lPL`pPU_Pu1n>0@nT@ D7 0  7l UhZAVnN@0'00lP ( -5L`@WFD70D7l@z OW⸿#p ⳿ 㯿T7SD7 #00#0!0} 6 6 7➿) Vp00303D7  03P7Sr007( 〿( ; p-LM`lP1=0l@T@'0@@R l0S@T7S+#D7@ " @ 7@S 6 R @D7 p # P @} 7P  # -L$ML5 `$  D70#,3( $== {NRD70D7T7PSu PpB 1@S ^ S!YTPW0  lx2>01T'R  7W R (<' 0<7 $0S $:s ⤼T7SD7  7SIP <'0S -000s0 <7儼$PWp 0 RpVPP DpKllA 0   PPDK0=0  R! 0S1 \\ "Z1=0  R! @p \j;;;N,;7'sX X7S1q 9 -LM@h֖ 0-LP@q/0h# p-0LM@P 013T7`S{ 7S07lphd3 p-LM`@XPUd90 d9p p-LM`@GPUd9 0d9  ##޽7l l p p-LsML`^K0@ {N ˽U 0S 2pj@; -T7LSP` 0 G73000 3/3@p3W $30002T7SSPp WW ㈽,2S   -LM K`@GP9 2 p@P2U 20002T7S" ePP 0Q #OWW J,2S20002 G20002鶿9 -LpN@PT` 2l0S 0S`3`#0S60S`VPq2 p-LM7`QP1 \G0 92C{70C7 R xQ 0 Sx0|0 00C08–\7S7p0  jT; p-LMP`O2@@D@$2T1S pC2@ph2 p-LM@52{^`o0S 2Q ph`p -LMgP072{QP@ ('7pR 0S 0`S W@i1T7S ]9091 0 1 -L@`P1{NpP@ P@h10@-\PW@W Q 00S  Q Q @T00輿9 0-3LP@0  Q  P-000Xd'0R00D76D73 D77D700H7 z -@1LMP@Q`'v>0S8\gp9"Ƞ2C3 ,^v> R&) 0\ǔ9!2C#0! `R ,2S0  01  0 i,jN 0-3L  P@ 00C0H7 T7S= D 00C(0D7H'6 D7D0 -T7LSlp@P 9RbC \ǐ 16100,0 R 012jNh;0@-R9)Q4:4:  @$,  0 p@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @OP00S T0 0P PPP>pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMPT7ǐP@ S`` 0SF S p 0PQ Q T7S # PP PS00S긦**** T7SS# PPP00T'R# 00T'RPPV 0Sp8D> -LM`PAAP@p Q2  P 0iSS  0i+0.# :5 T7S PZ lPl@0*!(0xC007S`7 g070g5    ` 9l9;Ю;Q0T7SP1'= 0 RP****P1'= 0 RD9 0S 00S @S S`SSʠSS -LMpP` P? 0iSS;0@S)0&00S!@**@**Pp 01pG -000,pTi( 909Ug W 00 0 SD PP 8K WPp 01D' =  "[82R i@<  0U  "[ Pi:0 0d 0 U] 1000@ 0Y0 I <0 w00 021  T7S**Ȯ**Ȯ*Ȯ**Ȯ**0#0 2K   D7 0@00`00 2K  ޶#00 Զ#  ж2K[? "!909M P@yܮ;-T7S SD  l0  ˌ,40 0-0@0 LPᓶ@0 0-0@0PLUP#P ჶ@0 0-l0P @L 00 p0<0 '#3"$ @00@r000 -0@LM0l00@ 0-8*^L@ *4 0SQ*0S Q3R 4*0SQ 0S n00 \0  )=  P D:S<:S0004@ 0D 0 0 00 0@- 00  x0 p0B0 022 00 0 " 0^#40 N9*00 40 DǑ R  R    .00  00 -SL$@K(@K MP` 㱵0 0 P 㨵00CPS@*H*P**P*P*P**P*P*P*P*P*P*P**|p00pP@E7*$4@0pP@ $40@ :#40P i (P00"H ^P00@ T (P00"H IP 0 8#H P<@@000d9g9 ; -00LM0 @ 0b0d0C0 -"0LMP(@K0 `pL  00  B0f0C0d9 0-20@0PLPEP  @0 p-@LM T`+PTPpq1P$; p-LMlP`J2'0S   S00C0 }P@  000'0 S00c0 0p -LMPpP'W60WQ00RT7!S00 0Q DS00C0.0  2 P` 3 @00 '72 " Ǖ 3#4!06 7P7S0  T7S' 0 R 0SD7 0 0c0 0'/D7'D7-M N p-LMHX] P%$ `$H%X 0  `P@p -LM("H=P0  0 000L -LMW0@S 1 #60 T00W  0pS`D00C0.0  2 PP9 0DǗ   l0  3  ˌ,4 0 T 0@#40@1 6 7 0@S#DǗ =  00c0 0'e@DǗ@'IDǗ@v@# m@ -LM`W(Q010#0Q0p"X C D7 ePW@( 00 0U%40P  00#4000 0SD7 = 0 0c0 0  j -LM("HYP0  0 000L Q-L`@P} (000U(@Up 2U' " U 9P09 Pp 0 dPPZЧ9 P09 U 0U("(XPpU* PUU U("(Pp 5 ┚ (08#8((yPp T7S("(qPp 5 t ]@;l;Ю; -(`L"xPP0  @0 0K00p @_  [ p-LM@8#hOPP 0 @0 0;00`>p -D'W0PS 1 #60 0 P7WST7  S00`1L 0RS000C.0  2 !PpG @00x 岀 #  ⶁ᳨2  3 #4!0"5D77 6 G RP7S2  }T7S)0 R 0SD' 0`0c0 0 D' D' ` )N8D> -LMp`$ Pn0 0C 0 Vd 1000@10 ㈱ ㄱP0 0 00 0RD@@$40@0 0C8#8Cc0C#$@a b00 *& ` e$;;;; 0- L  @W0T* 0Q1 R0 0 PA4 e@ 0pH> p-LM0@0P @0HW`↭P" 0P 1R 0S* 0^ , P0@0l, ວppH> -LM`Rp @t%  P`F @pT`常嵸 -LM4@,Kt 0@  @ P*9 -L M0@(KJ 0  @P*9-0 Ƞ 0 S sQ90 1 SIR9;3p@-}As8X@X`!X # 0S  0\pUQpp<9G-0 Ƞ 0 S sQ9 p-LM@l0l 0` &T0P HP0@\ R 0RTpheH>>Pj5> -LxßP0@S0pH`\0 0R0H00 <83,4 T < X0S\0 S5>\f*>;`jTjPj`jH>hj;H> -LM@ p, D G0P`. P 0@0@ᩝ:K ᨝02K<;04K 囝 ᗝ P⒝D ᎝0 ;0K< K< K@0,0 S ,3j8D>4; -L`!P@p _   ^00 000  00QZ HXP TXJ \0Q p!0Q0S5 5P  P+ `\Q 40040 R! !0Q \ 0 000Q 40 040\00\0P@0  <JN R AL m P@8D>5>H>H>@;t; - aL0S! p@T 0 S00 00C0yT 0 S':P "48<S 0S 0 00 Q : "48<#8 S  SP@P@H> -|%LH>ܷ;;D;;8D>; 0-LM@Q  80S0\ 0PS 0 啴0PP4004000; 0-LR@M0P @ 0P@ᒲP 4x08 0B S800 R T Q0 0 0 ZH0tf- -@LMH< 0 <0 *- ^ "48<S 0 000^: "48<#8 S  S p-LMP@ "48<#80CS<*<*D*P*phph|0 R p0 h`Q0S 0S< o( k00匡H>H>H>Xj\j -LM0|,0 0P`, P 0@0@E:K D=2K00<0<;004K 5 P0 ,0 ;0K< K< K0 ,0S ,ҫj8D>; -LMⴐ0PSp%0 ` @0?0x m#P@Dt0@S@ D  , 3H>H>H>>\j ;Xj -LM K P0-LL @P<$T,@T$ T0h;;k<^;Dh; -@LMTD 4(h ;,;8;D; R h; p-L M`L00\48 0  0<|<0tS( @`@TDdH @Hp,ꐹ;;ȹ;й;ع;;;;;;; -LM@,T$$  ~$;<;$* 000fhj 0-P@LP  0R P 8_zP  0 0 000S  f 0-lP@LP 0S P8 8zP 00@ 0 00f< P0S  P 008zf --L MlP000, @"48<#hdV000Aڲ1 0S*P0P00 0p0d 00 ژP0000! 0`d0 0`0S S $ 0,0 0%Du@ RT 00S 0005ppY t0@<TYT 0 ,0R Z @ TY t0@<TY4S  X4R R00CS+++++ 0S8=Y4 00!P 0 3R3Y t0@<TYT `0 ,0R Z @ TuY t0@<TY 0S04S `<##211@2 `SU000,0%M 0S 000Z0R 0Sh` R 0,S < R 0,SR00 0 R( 0,S < R! 0,SR t@T  0S @T 0ST 0 0   00CSH+H+@+@+H+000,00%< 0S0R 0S R 0,S < R 0,SR00 0 R 0,S < R 0,SR t@T  0S @T 0ST 0000S :S00 Rlj`jhjQ -@L0 4S`   5P 0 0h0sp p <$ #211@0 pQhj00CS + + + + +04S0 0 \i -LMq0P@S0 @TP  t0`<@VPTV R BQ0 00S U` PViOT t0`<@VT0 R  00hj`j -LXH0 R <0S Rh#00S0f -LMp@P`: 0 0   0; 0T0@0 0P@0C@ 0P00Pၖ0 0C 00  0,K0K0 +PKP @ 00 0Hjlj -LMQ@P`p 0S T 0*@@@pt@^ 0 @$PhDH>lj|0 R p0Q ,0( 0S <Q00Q 400 0S <QH>`j0S  S  0 S   0 R010`0 BS RA* 0S RR0Q 0Sڂ 0-@LP᝕>1P P .  b -L(M0p(0 `^BP' 0S <P! 0SP tPU 0 S PU 0SU000 (0 S d( 6 rPP 0 0 @T? 0S <@T9 0ST4 @ 0t 0 0R t 00t0tP0$0 \80K7 K4  H K P  R000  0S0C 0 6 se6sj`j;1i -L(Mp0@ 0 0`0CS0  0S 婢 R000  0 PS0C 0 U 0, /0K@ K$$6rj;2i 0-P@0L 1\0 $ 'P  010׽먺;ĺ;!Q Ƞ Q 0\ Lx0("S*d0"1@ 040\ L(0("S:0" 0j -LMDB^` 0㑸P@x i2" 2 "00`@) S` @@ @ 10S!0 0 0 A(P<.$4<,(, 4 "x %< 0! 00 ! R1@(P<4(<"4%<000A(<4,$jK>K>K>K>; -LM0@,0 @`0 l3R0p00 ,0P4  D3 Ro 3(80" S 0 4 ^' 0@S岀0S PX (48"<#R*0S`40, P @0 r 0X80/h0L2L"` @2@"`Z V. @V&T@D!00C0P P*` 48<#\ ,804Pᾃ1X4y`@Y T@D000P: P` 48<#\ ,804P/4P0zP` 0`, 0vPs @0 Qn 0zPd 00G PUたQo5 l`jjH>H>H>H> p-L M@0@ `0PSY h0 X 0SQ0SLPG @1Q 0SH0= s6 80S S0 1P80SQ 0800(0PSjp1P0p@0 KHP`80P1 p 0% X001p/pp5p媻`j; -LM@0@ Q0(0 <Q03%@0 ht>: -LM@@00P,HP'h0 ! w  R 0 0 0 R000  Q00000 S $hN;ej p-LM@P` P00P30800p p-LM@0P `0 R @ `00`30(00pph6 -LMPQp `V @T h0  @T(0S@0S W@  -LHM@HP`\pKU@ H`忍40L ,0 X 00T0  P 4 <0``嚰40 0ụ鏧 -LMH0@S鮥0H0 -L M` ( A"(4 P 0, 00 Tp 3S @T, m h0  ,0S00S40S80SQ 0S0S0S 0SC , 㒦P0S 0S$0S(0S$ 0S0S0S 0S  tP34 SX 0 0 XX0 ,@ 0S0S0S 0S 0S0S0S 0S h0 (0S Z S}34 Sy80S Y SYZ p-LMH`@VHP p ތ@0 Q Q0S 0S$0S(0S  00 ,  a(0S 00( 8  -L@\P` p  0RpV 80S0C80O00W\ <0S 0  000 ( が\" <0%@`V 00S DX R 0`V 0S <`V100V@`KtP` V@00`Vet`[p `j -PL`  R 0 0 0   1S0 0 0  0 0 Q3 0P!0 00h  J (p(C< .$4 <($, 4,<"0!Ƞ  1S0 00!P(p(<4(<"4!<0 0 0Q(  <4<.$!4(, <,"8  !80!  mq (p<,$4.<( , 4"'<0!Ƞ  1S0 00!P(p<4(<"4'<0 0 0Q(<4<,$!4(. < ,"80@-("HP$$,(%Ġ,. Ƞ"̌ , P h0  P0(0S3S3S80S0P R000 R 00 -P L.("hp&$,('Ġ,. Ƞ"̌ ,@T h0  @TZP3S3,S  NP0T R000 R 0@@G-SMⰡ(<"4( K> -L`MVp#,0 000 20SA# 0V0R00S 0R:0SS S S S S S S S Sd"000 1   8P "48<#8SPPXP@* 0@TP:UP! 1 RPP@ 0S^T 1 0b  0  (VpN\!V! 00 0`,   V00 VZ0S 8#8#$0$ 0 14 0@S": 0 @0 000P 000@0 #$0$0 0 2020020f4L1[ @j$;0; -LM#P h --L M`@p "48<#XdU%մ00Ҵ0՟ 0$U$S *P\%`000 p 00d 0P%000 0 0 d 0 0(Sl1  @(QbC+C+C+B+D+D+C+C+E+C+C+F+(F+4F+C+C+C+F+C+C+C+C+C+C+C+C+C+C+C+C+C+C+C+C+C+C+C+C+C+C+C+TUDC+DC+DC+DC+xD+DC+D+D+D+D+D+D+D+D+D+D+@1E#U(0 0U"R 00S3 0)S 0tß0l3 h3!10S   CU00U0000zP0`00  00000@@ @T@19p2 R T#U  10UR000 B  00P(K, P0g,P 1 RP1 ^,I1 R1 001 000 ! 00 0Sz/000qT@ҍGT@1 Rf 0 R1 U00, 0 RS U r R t0 QF ` pPB 00h  0S 05 X0 0jDK>LjH>K>dK>TK>K> K>O+K> K>K> -(3LM p, 001 CP  0S 2 @T H0Q 0% X0Q <@T@@KW0 ;0K< K 080 ڞ@\ L0P@ @@@80S0C80yH0Y 0Nr0PD0 `@` @QP Q TPU00U0S DQQ @e`@ Q> T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD1 <1.X0 ,0S ,咘0 ֆ 00 0\P  0 0@מ, T00T0Tz\j`j<;hj -L M 0@p@A`0d` 0p0#!dP܆0 0d0  0ppH  -LMKHX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@P`90S S S 0 @`廄*^  0[Pi銅|p0 p[d`P PU/P(P$K>jK> K> 0-LM PḝP@" 40P00 KPP吟0SLL@808 `P000K>N+ 0- L"48<P#HP1 T X"48<#HTQ00ADT@Q<0\@| 00 T@ RT 0hϝJT:<0\ T0T0X0SSX@0DK>tK> -L$MȀp0P4`K$0 * 4P0S T00X0 $0S $I 0@P  0ppD0<0. 10 S 嚲jL;LjH>d; - 0L oPK>K>j - LMR 40 S 0 0 ͞n됻; - LMPP0P0@0@@ T@* 0@Tlp`K*1[ 880cH$H 0 \ ffK> 0-LM0P [[@[0[ P@圳0h; -L(M(`KD 4pK24 .@$Ÿ$ 0@> Px Q eB!2b2c621b1c \ڼ0P*0 RP 04P:1!1!@P @@8hQᧄ2[S@ ` B1 2P13[@S `,@"!@00Q@0   0B0\ eB!2b2c621b1c1\ 0T共99̻;@jH>LjJ>K>L>`jjjjԻ;jػ;j;LjK>K>; p-LMdP0S ` @T 0 S00 00C0T 0Spj -LMu0@S pe000 ROP "2SX00X0 oJ0X000 0X/0S$ 0S!  t 0 00t *P000 "48<#Q000 R000 0S  b84X[ P P 0%0S q Q 3 R(00(0  o/30Sg 13pW 0Qx pWp0 #$0$ h("("4 4Z0 "48<#8  `00`0i $)-"("4 4Z00SF 2  Q 儒6ʘPd00d0I 000 @PP@" @00@0P "4 408#8#$0$ 40"040 0 10 d00d0W $ 0S 0S~ 0Sz}<PP@i 00 0 R 0S < R 0SR t R 0S  R 0SR@|00|0 $R(00(0 t00t00%p00p0P@P000P@`jhjL>K>?jL>K>@jLjH>@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0R`j K> -L M p0 01 cQ E 0  0 R6 0Q0R  R  @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V  "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V `) R000@ ͪ#00C00f8#8#$0$  "4 408#8#$0$ ,0S , 0S00,00 @ T,  ,@ "48<#Zk @"48<T#, `V_0@00 001SO pXP`E8`y0V0C0@  P`n00C00V@ 8#8#$0$00 0 0 000  R000 Rc0 0 0! 0 0 0!B W P 0P U  ! h00h0E 0S0 0 0 0z 000m 00C0Q Q00 cbP h 00S0<0 0 0 0 0 0  00 00@jL>hjj - @LTp l` P/ R0P00@ ө0U0C0 R000 hbL>@j p-LM0` R |P00C0@ T T@P 80S0C8000phYØ 00 0jhj,j 0-4@L0S $P0000S0jhj -LM|P0S ppp00/"?CQT`1@0000S 00/"?CQ@TjK>L>hj -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( %gP H 000P PD @ 0D"P00P00iP0iPT T|2 R8 PUT0 0gP, PE0S P T P 0 0H000  R H 0D0 P gP gTx D XPi4@K 2 [R3[Q0S 10[#0 210K[8K@  10[0S% S 2[0<KA <0 20[020K@0iPpS20[3 [0Si t xd7gP. 20[020K20[3 [0SX0L0@ 0gP H  _K>L>L>hjK> p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 ĖP@pH0j,j p-LM@0`+TP p'0D #10PhL> p-0LM$0 (K0 (K'K1K᫖PP+ 4 10 S 80S0C80p00 R0`V @T 00 Q @T`V80S0C80pP80S0C80pۖXj -PLP& &P` 0@10 0 pD00 P~@PE0U :0U0*00L>h p-LM` 001PC@ c~ 0!0e 000e00 000p -LM1P `@,P 0P  l$(00(0oP 0S8tX  0R $P 80S0C80ß000 00 0 \3  0#$(,"(DRD #0Pp 0#!DQD#Np00C0< 0R 8#0 S0!0# P"(00(0 ",0S$00$0p ,00,0WN APAn+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+n+ o+n+n+n+n+n+n+n+n+n+n+n+n+n+n+(o+n+n+n+n+n+n+n+n+n+n+P, , 001 R lP 40 80S0C80K>K> -LMQ@` R0BSvq+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+pr+Pq+tq+|q+ r+Hr+Pr+pr+pr+r+r+r+U 1 R 0h"{ 0Ph{d`q0 p{0@S 8Q0S PUaPۙ^P0媙p0 pz0@P L 0`^k#R 0pp{-UT 0Ph{ kȵjK>jjK>K>K>LjjL>hj -LM(h`( P@6# @T xP 0hjʚ; --LM0@` hA~ ;00S3*P)0 0C 0 T7 1P000m0u 000 !t"4 408 Q H  0`N @(QQP0P 0S "48<#8SS0S 0 "\00\0"  440hj p-LMR@P;kS5dS*S 0@ph@P`  0 0 h000pP 0S`P 10 Rh0h000h0P -pP m0CSP pP  -LM Q`@0pP 0Q0U00S;Q{+4+L+x++x+++x+$++h+p+x+x+++x+Ug0 pX1 PpTPPpu`UJ f 0@S pX1 R 00CS 0S80tZP01p 0S0 R 00CS/p0(00 j9pD0 V8p( pV0 X妟-pQ` i ;M>M>j,;Xj8; -L,qM1d\aP0@ !00T紀ᶠ@. t.{tQ Q Y 403074<*rY  01 (tr갿k j -L Mp|, @W`0 q &P P U0  00aSPUY$ 0!0@`T0TX#,0P00 / Ě,00d0   "000/U 0 0lQڲ!Qz @ R0000 0` 哚TP, Y 尠ᲡpX 0S06SPU  0S00L100 @ 0Tp0000 0 V  |P h0  HP%0 0  TQTP 0 R  0L0 0S   c0S00`0 a!0 0 X  0R X 0Q" PH ,000[C X R0000 0 kk -L1  '\ 0z29 --lLM`ϟx0 0, x0t K 1p      0#2S S00   Ο,0 S , 0R s:Z  0lR 9 R ""!R00R0S8 000 bR 0 0R%0% :Z  A Q   0S =R 0<,4$<,!4 $,. $<%, 0 P} Pq VK R 0RDpW7 6S  R?  ! @0a8 S,!Qʌ R tK  0PtQ lQ P!0 b0b S0l l0 P  T@PL\Xa!0lS0S0 eR 0 @P  G PC0 S@tQ L1p 0bS00eS 0 00 Kp Q  L!R p00bS0`cV0ڼ\ !0R00B1ʁ ɓ`F0Vt0ʟ0t0`: 0O|ʟ 00 0 f 1S0fӲ1 Ӷ0 6Sڀ^0 0`bVJ V000 /0S 0R*  ̐ Qt00t0bW |0@  t1S S 9A @@0 t9At00t0  f-0 f t0S pL1 0cSX0`S00 "  X1R 0R 0R60CS++++++++=( 00 0p%00 t0 6S S0lSJ'6S 1$!S ! & 10cShǟ000d7d `|Pfp07 l Pot ǟR` l R8 0!R 410cS 7b;1P 40 A$1TvR? 62S 1 W |P h0  HP 0S0@0b0P;t 0h!0bS5t0Ř`1S`5 0 0bS6 0CS ꔫ++ܱ+++U 0 M 0S  0bS'Q  P 6 S 0%L00S Ƀʁ 0 0cS L0 b00CSH00@00Q/0008[P0  0S 6 S^h 6S SI8C80CS+ ++ + +++0 t1S S \t04  @4A 0@3 %3Pa8||3Pa-|t0 0 t0 t07t0m 0R   0Kt07t0Zt00t00S6Sut07t0Jtt2 R= ; 0t0 0HŸ0!00| @_1W|0 |P h0  HP0  L@g0SF  @L@G `0d!t0{ 0 0A S  0bSQ0\0S 0R @ 000 S @1 0P<000| @0 ?0Pl{kjD; (M>k,M>$:>|kM>kH?kkKJIPM>kkHM>tk>k<[fkkkk M>k$M>kU &(L0Pa;{tUr 0Pa,{V?@0P0l02 h_" 0?0 {>{ PU  0R@ @1 0c0cS000070 Q V20 R -*p000  6!06 8CR 6S 1'0 1p 0 GP!tP$1`z0Q0'0 !\@0< H<M $!0, 0cS `000"0"?08zt0`0`S  t07t00K t07t000C0$x3x#3R 020 60  000cS0#LL10T13@_0 0p0 0 R000 0 0 -00 Bh0O$T!00bSL0$0/4K 00-@SLPJ 0SP@cU T0DQϠ 08 0 0  d Bg 00C 00岔Eh;-N(CJ(1R䠣 !N000 88 9N7c8# 8S  Ӱ  0a8#0(B)A("8Q00Ӱ0N? ( O/0N@S01S0#8 CP#&0!̱P ü&40 N80 20k:F -LM|``"P@8P t!*LM>K>t1 S S(t0b? S  p-LM|0W@@`P! 0\0C:np0 \! T\@ n40 L\! php  P$:>Q  Q  cp0 BP1P 0 R\ \R:0 R R: (0P\ 0 -d0L M0Q H 0Q0 @$ 0@kXM>k|;k -LMX0`S  U0S S 0H0(THn0DA4, p RP@0  9R09D0 001 0 0@ 0Q000 D001  B At00C0PQ P 80S0C80G ss0#90000S00S000@' "0?0 s\1R0S\!00W/0\a 0  0`@0, `o@ sw}a"0S:@0 \ @ 0 01R ! @TR@ 9R09D0 001 0 0P 0Q000 D001  B s00C0P P 80S0C80 csg"} 0 \h@W  !1x0x X0 0#!H @0 80긿kXM>k`M>xk<+hM>>Hk+\M>`k|kk -LMp919 S6 0!0S.*!@0` P``s9!09100S00S000P T!0?0 riDP$ r P0@)QD0 )0 01 000Q000 D001  B r| 00C0P P 80S0C80D ri|SM>khM>>+Xkkk<+ 0-L@P -0h꼿k -LM\AT: q 9R09D0 0010`  0P 0Q000 D001  B r00C0P P 80S0C80 HMrOrV@0 \1o|kk<+ -0LSp; S* ` 1lQ@A00@T H0TS @Tm |0Sp  |P^l0l P@  !a000 0 0#!XM>k|kk -LMPp Y, K@P`V 0 0R 2   0bS@000c0CS 9R09D0ğ 001 0 0ğ 0Q000 040 D0401 0  B qx$00C00/P 00@h @,h00 h0s0s0030S S,0S H0 0Pp 0 0  cP P 00D@D0t t 0S D3! 83 ` t9t0=t0Pxg P0RP1 0 0062 ! ,!0"?08 q"000:S?9 S7 100! 00&?0q@Q  10cS1X!P@ P P 80S0C80ڴ 4p4p zꀿ7< ᷿P P 80S0C80 04p4p@0 ozY PM Q0  ᆿZ .h0 N H00080kP00kkKJ>PM>M>kPk<+k -LMP@`p K#PPJ 0 0bSE 9R09D0 001 0 0 0Q00`0 D001  B jp 00C0 0@P P 80S0C80< ppyfkkhk<+ -LMP@`p KPP <4<("4!<S D) 9S090Q9D00 01 000Q00`0 D001  B o 00C0x 0@P P 80S0C800 oocyMkkpk<+ -LkM PLT\`P@F n Tp p! ßD W pU`@ #t0D SD K1nK @P 0S o/K "PP@ b@0a X Pl0L0Pd @0 0@0d t PP  ! `` T` p`I᠀a0\0r U 1v@p l0L0D= SY `0`S6 000  10dP P P 80S0C80 Lnn81P@ xꋽ0d@  @ dm0[ 0 " 000  QʐT0S0 000  QT0S909dPD`XS=DQ 7DM>kk<+k -LMU0SP`0  S(  04 ,0 0)0Spp4 p0VgᴼP` 00SV 0  `U0S S @ <4(<"4!<0<4(<"4!<  0 4#$0$ 0 0 :#40  0 R 30(,!$#, 9 2"0P<4(<"4 <0L<4<("4!<0U 0S_ SI 0S|0S8 S# 0S S /, Q<$ ,  0<"0S;0, PE4 0`  !4 8<#` #8 0U 04^01t000 04 d0b!$(," "( 4 U 40!c 0"4 40_\ hx h00(@/0 X0@0t 0 0 % 71!71@c`Q^/ 4 , Hj PM>K>K> -4LdM0| tp,0 @P p `+1S' 6t0&< r 0 Q1 !0npP\0 tp  Z  S2\ Z h hX0G0T1!Xt \ TL0\p G P0c3R Xx  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx Rژ;!;xp0 aS0b0bS ^ tp0 0bSt1Sd   S(h tp tp00L 0S% J? dh aX t ɃXh  r X00R00Szh00h00!0bShd:HD0OLzDٺPp (ʟh00SW  0h  X0h0\ ] 00 0\ 0Sy h0| 0x0SY ^x 0  0 @C t0 1R0B0X401 0,$,!$#, 0d,$,!$#,\ 4 T0x#Q7Q8ȟ 2Z`ZZ"("("4 40 0CS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 0St0 0t0 1 0cS 01!Sx7lǟ 40!0000@ 0R @'0?0 k400t1SV uSS ` R.d1l\d@00@0tp 00 0tpZ1 0cS0Xt0 tQYD6 ,0S P,o0t0k7R `0(S `p2WAW6S6ópt0`5k|x7 1!"4 40| l t00| m0t%00 |@S;0 0H @` S!@( B"40 0l 0|t|00H =:0 ya ckFZ 1 0cS!S 0d0 0 8#8#$(,"8SIkHjPM>>;FtkK> J; -LMN? @0A9O?d 1\  Q xQx< 0?0i&6 R06 守:hM>>; 0-LM@PP 0@@҂ 0@ʂx0 h0d0d\\0 ;Q<0< 0R@+0h>,wpk;4k;kdM>TM>k`jHj ,; -LMx`PV|pV tP6 P # 0 0s 0 0 P p1 00 00@, dd `dl0P:0`0#$##   0 P0(@Q@ Z0+ 0 8 "8((<"8 8!("(!0QA"@A"JP` t1S S 0\ 0 00(0S㧷1ķ0 0S(0Hj -LK> -LMD廁PPL Y,1@0JϠ @70gq`@ `gV@^ g 020 0(B)&QN?  P0O/t0|6ڀP ü&h0 `1d1X 00 t1H0H0$! !  s t DP4k ,9,@M>:DM>?[fK> p-LM6pS0| 0@`@P0 <U Sph40 RP.+d ,k̼;kK>r , -L0Mp0<`K@ 0 V4KP !| <t1S  | 8|( KB0 : 0P!0\ d g|,| (  000kjkkpk;0@-dd0`@S =0RHP00Q=0P(0$0/ b 0kxkktk>gfff 0-@Lt0P  0ht  -LM4@440 (0!nj hppkPM>xk|k 0-L@PCdPU@Z0 -L4MP0`,0 ~tv |P h 0bS700cS60(R6rN/(00(00O/"9C1 S 01&6 SƱֱS0ü6l"0@?0cL2 R |PU 6S6S@0 R mP 40 T0tY0 8S ʰ0 G P!P 0Qy]PV$1 A@10@1# ,0S P,f|Z(N0 8)0 0<@KU0;K<0K( 8 P@ T0 m0T0a 06$0 0$0Q<0P [ [/ 5t0%K>`PKdK(0D@XK0808( jk:hM>>K>;FrDK> ,k -@Lt0`0p hk, N? , O?Ɍ LQUP1 Q 0r00r0P0,H0l <^*40  ^:00000Wk:PM>kM> p-L M@Wt0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LP` `0 ?08bph<00<<0  k|kPM>k>xk 0-@L t0P6 S \0P\ L0,  a R 8 80 ?0tb0h|kPM>>xkMЍ -LM` QpPo \ 0Sc, @0W0T00S cV`U W W 'TD0@ 0 WY0,(,,,<,,(,8,d,|,,P,,,$,,,,T8` Y 0,k00A 0QP`0 0Sx000Dh0   ` Qh0< P`0SF S) ?Px7`0T:0 #08000#60 ?0a 0 0010IP 0S PQlP`} WP`w`t0 S0S0S 0S 0S 0SQ0s Q<P`S _ 0S 0S AP =@0= SP:02 /l 50,H0H0S0@ 0 QϠ 0#` 0 0\1  00# 00 B0aR  rE5 0 0 0r 0`r0h0   n h0   } -` ٯU֯ 0 Q  0o 0`ofkM>>E; -L M`@pPB, 0 S_ UD 0 R R/ ,   0$5 0EV, V , W W *P >P 0S0 Rڰ7R'P 0S0 Rt0t000t0 ㉮0W 0 W* 70t0 0V 6 P  p-LM0PS T0S0 P@|qP@ p`EP Fh0 00t1@00w0@070pM>M>k 0-6| SL@@Pڲ0 0S vL P@0v@ -LM6@S ,,,L,L,X,06@T 6S|0@h6P S000 0ό_060>|k -LM⬒X`, P P0SR9 Q㍯K"!: /SP@/D2(K0S S| K 0 P@t 0KMK P@l1X ( K0SZ SM X W DP @0  @X,0 S x,b5W @ 0  000 @ 040 X/ T040 00 0(K 0 S S WkM>k0偿$N>k -L --L∩lM 0 0p, 0 @0#2SK S iP, ,0 S  ,a\0G0K` 0S 0% :X000 0S000 V"48<#X 0 dR U00U0SbӮV xK000 S  0S 0S0s 0S0S 0s R 00 0 0 (000G[Y} Y_ P 0S V 0S ܽP DP@ T= Q h0 ;@ TU2 P h 60S%V h0m@HKL0 jP @Lu@0ST  O 00 0FK 0 K^(0007#0R R} ,0S00S40S80S 0, hPPa 0S 0S$0S(0S  qhP#0RU) X%0㢬P ! 0S h $50S3V h0(@0LHK PKP  00 000 @ P0^`<@L@0S  K 0Q K'( R 0R8 R 0Rh0 5pQm ܓ 0 |P@) 0S00  h 30SV h0ᖭ@HKL0 ᓽP4 @L➼@'K 0 K'2 $00Q$0'  0P@000! P 0 QxK00  0 @UB 8 0d(  0 @HPKUNH@KGK0K dPK6 HNd@KcK0K * @HK:NH@KGK dK$K 0D0 1Nd@KcK06K0`0 o0S 00 0d    (0 0(0 0 nN000K (00(0D000 R U00 dRP0dU|0K Pp | 0R0% *0` G0K{kj,;kʚ;P; -LM@0@@L⿻@0 \h鵻 @0 -LdM̂0Q@,0 p`P㰢 0S ,0S ,\_0SP0@ShP P T2 R Vy Pp 0t0 x U 0SYdK \KdK0 PYA p0t 0R:l@KhM0 pt唫@HK@PK^M0 G0KHKVp HK00 PW [&[xdKH0K .[\K&[0Psx0dK  dK$M0 c0Kd K\KpnL  dK0\KdK Pp` x` Z|`j.,8;.+\fk?: 0-QLMP 0S0S 00S P0@ SAPP T \ 0 0HBP @0S  0̾.,L>.+k --LM` 0 pPY (@#*X (08 S, 8@}r0 ᱽP@rhPh0 0C 0 V7@R 1@0 00L08#8#$0$0 08 (00310#1L1!0S1 00 0! !48< (#( (!(!8#8!QA"A" 8#8tm#$0$ ,0H 0,0@0C>P@X , 8 嶽0Z p s`0d(0S9@N>kMЍ -LM QP`@p 0Q0T00SQ5,P6,\6,8,6,8,D7,7, 8,7,8,8,8, 8,8,(8,T8,8,8,8,8,8,T pZ 'X$`p W2 Pph0 22  s t h0  p ^ӻh0  0S 0S$0S(0S 8pmp ?W(0S\᛼h0  0S  0S$0S(0S9p Eh0<<,80 000zxh0   0oV[ 0o)-h0   \ Xh0  Q(M-pKh0   0 po 0 o鞵PxkN>N>[fK>t>:H; 0-LP@ᶼ0h p-L MQPP%0S S S 0tPPbIp*pT pL 04ph0J( 0@p N>kj -X0L \<1  %( 00 0(N>k --H0L Q 1(   00 0(N>k -L M줟@+@K0 0 Pƨ+ ["2S& S (00(0ʧ( 0S:"2`S0 S0 $(,<4<#: *0KR0S0000 㓨+ ["2S S( 0S:"2S S0 $(,<4<#:*K) K)0KP 0 $(,:0# # #8 0)[ 048!,!$ <0# #$# 00S 52 R 2pW @T Vo 0Sg @TpWd +[ i0, O\`XjkjLl@l<lT; -L M`)0K pყ@6) [0""S) K  S1S1S1S1S 5 R 5,  , s700,1S01S41S81S  Q Q Q Q 'P0 (0C( 0 W 10(00@`00!( B("("48<##804 I 0 |B 0w)P[Ui U^40K (40+K,$,"*)0+ K00*K *0Ke*[ 048!,!$ <0##$# 00003p R 3 R 0 R ß ( B0@ ( B0@0 R   B0@  B0@¥#(0/0(0+K) 0ᦦP"7000p( 㱥pW00S SG000C00S= 00S S30 0 0/ 00S)ᆥ (0/0(01 R(1S 1S1,  , nPa0 0C 0 W 1@000 @ 0 000!"4 48!0庀(1 0 !   440)P[U Us00K $00+K,$,"*)0+ K 0嶀0*K *0Ky*0[0$+K 0 0 P0#$0$ 090 "4 40 p %kK> k-QM P PR Ѝ D00 ЍF* 0 ЍEk(N> --l2LhTMd 0 Q,0  pP1  00 0 0@S0510205 :x0K ឥx [0S 000夤 ,0S ,Yw0[S 0S*P0p00 HKHGdKEG0 "bV< V |000@@0K HKdKc@KG@K^\0K Y tKPo 0 `J1/<1t [000x  F`P11<<1@D0K GKd@KH@KcK) `0K,N>$kjx;@k8D> -2LM0`SS@ S"2QQl2 QQ Q(p!08#x VPPt 1:)01!0 04!0@ p0$00  g0O!0S- S @G$0K $K#@KP@a0` 0 !( B("("48<##801   @OK O@00@00  1#$0$0 a   440(! 10D 000刣7$ 000倣pk%$k K>-QM P PR Ѝ D0, ЍbE* 0 Ѝ0D$k,N>G-@0 !0P8< 40#0   0 ! 0 8<4 0#R 0 08 <40#0 (0,$ "^ X 08 <40#0 (0,$ " ^  D@Ÿ@ 1, !4  ,$< "1  . , !!8!$X!l0p $(, !0$0#0# ! 0#0#, ! $< 0048 P8A0!0$ 0#0#.,0#0# 0# !  " X0 $ 00# ., (0P 0 !x@0$ 0#0#.,0#L0# 0# ! ". X0 P 9 9 -LlM, P0 0 10 1 0@ !0@0@ 00L0 0 T 0 ,PU`E00` 0p\4p 0 'L 08@ `#X&&ĠP#l#4Q'(.'D!!|0 80|P 1P!<0 0@ !qA 1@ X !lp p H@ \ t 0 4`@P`P` p8apdp Q< AP`0 aXpd A!ppDP T` lP`h p!Q1|`!`Hpa0#` `q "Lp \ph@q`p tpqxp pqD`p Tp \`pAQL``p !x`p "0# ! "0#u, 9 9 9 9 9G-M8  P< 8 4 ȠLD, P ̉H4< 0 l  $ H !D!0@,!Č(l ,l( @$.($@ `, * p(,( $P&' .h1T)̠)$$ĠƟ)$%801*(%|05 !%5 * !*  1şq|ş`ş耍@  唠 ! "   "l@嬠 !0# 0#l ll!T^T 0# d "! "`\!l!0# X1l! \X.(Xd1`. H\#d,8``.dX D@,`.Ġd l.\X h01 03 !xh| !` X0刐0\T0@H 1D4 q0@ ?0@0c80 !<\ P!TP 8PtU"\@P P<; -0LDM@hK@ ? p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ<0@- 0@0$0$ 0 0 0 #EgܺvT2 -LM, `!>?@1p@d Zp: T@P U \:,0 l oE ,{@0 SP,0 E,0@k -L4M0!> ?P@Pe`!8P '; -L|M@@ hK\E0&h 0#00: g{0(d 0#00c9 fk0)`P0#008h 0*\0#0 0c:pi 0'X 0#00=`j0&T  0#00c< g{0(PP0#00< fk0)L0#0 0;h 0*H0#00:pi 0'D  0#009`j0&@P 0#00c9 g{0(<0#0 08 fk0)80#00c=h 0*4 0#00<pi 0'0P 0#00;`j0&, 0#0 0c< g{ 0L0000< fk 0 0X 000c=h 0 4P0000c<pi 0d00 009`j 0@0000: g{ 00P 000; fk 0 ,P0000<h 0 \00 008pi 080000<`j 00h 000c: g{ 0DP00008 fk 0 T00 00;h 0 `0000:pi 000 000<`j 0pmvmz0fk00 0#000c= h 0 "   b-p 0i0D  0#000c9` j 0 "   b* 0g{0| 0#0009  fk 0 "   - 0h0` 0#000c9p i 0 "   )`0j0  0#0009  g{ X0 "   , 0fk0 0#000=h 0 0| 0008pi 00 000=`j 00X 000c< g{ 00000: fk 0 0 000c9h 0 0 000c9pi 00, 000c=`j 00 000c9 g{ 000 00c= fk 0 0 000;h 0 0` 000c:pi 00 000;`j 00D 000c: g{ 00 000= fk 0 0 0008h 0 00 000c<pi 0' 0#00c<`j0&,  0#00= g{0(0#00c: fk0)X 0#00;h 0*0#00c:pi 0' 0#0 0=`j0&|P 0#00c9 g{0(0#0 0c= fk0)0#00c<h 0*` 0#009pi 0'P 0#00c=`j0&0 0#0 0= g{0(0#008 fk0) 0#009h 0*DP0#00:pt 4i 0'P 0#0 0 lPnpP  xlP : `j    -/LeM0p @ lK,0 5p0l p `b?!0@?PP@ ei/@Pn /?0S:@P?0S: -Lp M0`,0 @4K  b!zt@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,@Tj;H9; -@LMT $ '/@(!/ 0 L9G-(M$$ $0 ```( 5j# "< "0  0#   D 0AiP i;,  0 0  ^   `00` 0 0Q%j3 0# Ƞa,0# ,e). @ @$ 0Q." p  aƠi! " 0 @ iˠ "! 00`@P?Q  ` $0 ` `@`P@` P0` 0$` 0  @P(ЍL9 -RLMp+ >?A @` R,: (, F.,!P`(` pl?W `\ @pG0@?W@W( %.0@(.0@ -PLM, pX 0 @0K- M >}. Np >.~~΍.1@QS@@`aq  ␀!N01`$P~`Pa.(LQxh ,00)&$a9%G%ᨀ.,Qq匀円(nx%Th0vP.#^PLl G )ጫ7᎛ '(P!`"p`p`P , 0 0Ll\$1l(C|@厏 ='pp*C(`~P%`&`P`Pa0#@$^.T= }` 0`lppPCq(,ΠHD@l| 0q<`^ 0@N0lQpCpa`3` P``` P%00`&! "= p P `.M.  .0@~>. N~ ~0@TO^t^0@10  a0@N~ Q0@^  0@00 ^ߍl9 -RLM`pG @>0A! c RX:P *!0@ R: @0S*H0P@ P p`i VHP  0@ `FRp @0 S*@0 VVP h*!0@ R:@0S*H0P@ PN*!0@ R:@0S*H0P@  -@LM, 0 0@K 408@_`pP`4%$\'&dts?s_`  0 @ #Ƞ8!(0p$HP``,4H[0@UP` !4%lT"$ K?K_`@8`p0!#^8'$Hxa ) ,0 p\P0\,@PPP~),p00@ ,oA,0l P) Ppl), PP,`pPP)0P0 -PL M0 , / ^0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,ob) -@LMT@ , R)PL)H0@ 9 -PL M0 , / 0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o)A-0PpP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0$ 0# 00#@$$Ǡ$ $,1t h!̒0( 0# 00#P%%Ǡ% %,1t h!̒0, 0# 00#@$$Ǡ$ $,1t h!̒00 0# 00#P%%Ǡ% %,1t h!̒04 0# 00#@$$Ǡ$ $,1t h!̒08 0# 00#P%%Ǡ% %,1t h!̒0< 0# 00#@$$Ǡ$ $,1d Ȟ0 0#@D 00#@$P%0A-D0P@pP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0< 0# 00#P%%Ǡ% %,1t h!̒08 0# 00#@$$Ǡ$ $,1t h!̒04 0# 00#P%%Ǡ% %,1t h!̒00 0# 00#@$$Ǡ$ $,1t h!̒0, 0# 00#P%%Ǡ% %,1t h!̒0( 0# 00#@$$Ǡ$ $,1t h!̒0$ 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1d Ȟ0 0# 00#@$P%0 /l9H0@-@P!0\#0 0(S"Ƞ0 -L0 M( @KP"h0dp 0 8#x "W 0@2K,0 (0 p,KL,0 0("x(0W0p@d;08 (#H,0T108#xW -LM((KpPj@"h8  8 08 #8 "S80 02K40 00 80 4pK z400# 40 s0 0#080 40(0"(8 R00  8 80@ U400# 40 N0 0#008 0#H40T18 08#8S80  p-LMH`P&$H ph; (-"xPUL`@:08#XU@: (-"xPUL`@:08#XU@: -pL MW@)*0K0 8(<, 4$P`  0P `b0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@)*0K0 8(<, 4$P`  0P `g0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@2*0K0 0#0P0 8(<, 4$P`  0P `0P,`p%%<%(& &Ƞ&W0 P`@: -CL0 MX4 @CpC0K20K0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`0 0#0QHXpG@D0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`40 0#0QG-08@ <4@ `|Pe%L%ȠE q%0E吕aP@8 < 4f `D0`&! 0cqS%,,E%̠ 1%E0n 00#H*j apQ% 1%Ƞ % 0 0#0a L`& apQD% 1%ȠxxD % 0#0l0P* apQ,% 1%Ƞ  % 0n 00#T`&f apQC% 1%ȠC % 0 0#0aX* apQ% 1%Ƞt % 0#0l0\`& apQ,C% 1%Ƞ  C % 0n 00# `*j apQ% 1%Ƞ % 0 0#0a$d`& apQB% 1%ȠttB % 0#0l0(h* apQ(% 1%Ƞ % 0n 00#,l`&f apQA% %Ƞ %40A1!c \p*R0 p0 0crSl% 1%``A%$ ! 0#0`04t `&! bqR%1% %$ !0l00#8x *j bqR%@%%$1  0!0#0b|< `& arQ%1%h%$  0#!0`0**<*(*& &Ƞ&`0 : :::G-0@P`p8 Ƞ<̌ W4ČP`pሕՈU< |0 0crCpş$ 1$(dT $L!0#0l08x P%e bqBş$1$$$  0!0#0b4t `&! bqBğ$1$$$ 0l!00#0p P% bqBlğ$1$`$$  0#!0`0`&, l0 f 0crCğ$ 1$ $$ ! 00#0b(h P%! bqBß$1$$$ !0l00#$d `& bqBpß$1$d$$ ! 0#0`0 ` P%e bqBß$1$$$ ! 00#0b\ `&! bqBŸ$1$$$ !0l00#X P% bqBtŸ$1$h$$ ! 0#0`0T `&f bqB Ÿ$1$$$ ! 00#0bP P%! bqB$1$$$ !0l00# L `& bqBx$1$l$$ ! 0#0`0H P%e bqB$$1$$$ ! 00#0bD `&! bqB$1$$$ !0l00#@ P% arA|$1$p$$ ! 0#0`0`&&,&8&% %Ƞ% P0`::: :G- R8M0 00 1 S`@Pp0 q 1ѷ< 1 R Ե@ 18 1 P յP 14 1 ^ ֵ` 10 1Z0 S$ Y N,,,, ,,,, ,,,,,000PTGTg#Ġ#, #<,!q 1,A.-Q0#Ga. "  "P0# "0# A !04 f"Ȇ",(1&)V0# !0#0#05 41*+|f !0#0#0# 0 Y ',p,p,p,,p,p,p,T,p,p,p,,  F 10# 1Pe  0腟0#0" 1ş " '0 !! Z ` 1 !0 1 00 0Zj( 0 1 1 1Z8Ѝ   10#% 1  0E0#0 1  " 0T!" `弄 1'0# 1  0D0#0 1  " 0 `` 1 0#P 1  0@D0#0 1  " 0( (4)@S#,8,̠ a!ßC04p!A! -2L M PR@0 0HŸ )2*  ) *$Ÿ 9*  *,"Ÿ 9)  ),"Ÿ0* ) **4) * )0* ) < 8 *" !8",P 0 0! 1 S=-᪠00)*000 S)4<0P*JP@*#:)< 0AƠ*g00`0 *+? Q8 ?@ !@aRvp1Ñp F 8#8,, 800"(b. P, >P GPe N>UUUU8O>2:P -L M@|q@*) *))* )**)333 *))* )*`)0PK@ဠ*) 0 , V   0,0 )*))$* )*x*!)*))(* )*T*"))0)$) ), **$ **, UUUU3333 -L MQ00 Sp`9 p4 0\ * @ 0 R,0\@:w`VY w 0!(K₂p 0 P` ,00 @0004夕4堕0 V Z  01 R Qw 0!"0P pQVxO>|O> -p0LS`P, 0@S$*㎕1B 0S0C000S 0 0S PxO>|O> -LM0]A0SM 0PUla0S00S5 PU0qU(U"l P` @!"`X † 0l㌐ 0? `    0 000 l },`0P0  )|O>xO> -0LMpQ PP1P#U@``0Sݔ1 0!01Qt 00委|O>xO> -`LVP p1p#W@P0S㱔10 !0 1\ 0@000  00@p|O>xO> -@LPጔ0p T*` R 0ES0  0SNU  00 0 SQUQ 80BPU 00  P|O>xO> 0-LMPBt 0S@*X0 "000 @\0,  &0n|O>xO>k- -LM4\$ 0 l&kx- p-PLMP P0Sp` P *0@0- 0S* P:0P   0@ Pᨓp00ᜓp0S 01t  |O>xO>O> -PL Mp (0S㧓$Q lP00 r<1 X)*1 00C0 0;0S  0@ `0O  P p$4 R 00040S $0K GP0@K#00z $xO>|O> P0-L@ <$PQ 40,$0R=$QL=0h0kPk -LM`!Pp@T& l<PP 0`FCv a<P`F@8 8$0v40$@ڒ֒ВPD0 0@;40 8@w;00O>Pkk;; -L $03;k -0L00( -LP@-0@ `R P0Tp0 t0 R0^@0S 0"t0 AQO>|O>xO>O> -LMTCPß ^, `$p6 ",3^ $3^  c,0 S ,W%P@ ${2^ 2^P@  0S------$-$-$-$-$---$-$-$--$-$-$-$--@TtPK$P`KT$QX'  0t0 p 0R0R *hPDP L,L) L|p ?. ! h P,1X |KR  P`p@PK` Po`L`PK0O D 0h00`@ @`P0@0PPK"\XTPLHD@jecic@fc;gchcPO>O>O>P>$P>HP>lP>P>P>P> -LM|4P\p@,P 0S \  P 遍 $4@$X4$dPP 0L0 @0U0 Q00 0PS,PP ` 0S 0$@S,@ 4<3  P`, R  ,0 0,@0<  @010Y 0 S 0 000 00 000$  (0100 02(0 pP{ Yw 0 St 0,@ P`D0  1 0`0 00S ,@TD0,0[  0S*1 "0@ 0S P` @00Ӑ0@. ᦐV `10S$0S!QQ Uv1 PL 0, `0 P` `0 ?0` `0 S Y 00 0 00 0c0S $3t p X l h \ -|O>xO>x ; -8 0L0#Q 00hx -L - L0S`0S񟗆!--!-!-!-QR~L T 02 P0000p0P1  0 PQ6UڸP ~ `0L0A CP 0UP`0\!P`0S`P 0^ !0 0AP  0UW 0@0PLP@PUZLP`J 0U P`QRzQRwQRt0-;- 0-$@PLP R0000 0 PL$0 p-0L M\` L @ p0P00K K@TL0  000X $P  (00(0 ,00C,0(0, ndcO>RP 0SP R R RQ000000000 0 00  -LM00K0PK @L 8 pP1  4^a0K>A$ <   $  (P@0 | 0-0@L=P$LP <0LSL0 -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `dVP<< ;(;D;\; -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `dVP< l `q0V  0P 3 "R @+ RTd 00 R0 0#0Qh`0l 0`0  `eV00 Q030"S@VL5 ,0S <, < KY\K<K ]h0Q0 0#0QP 060#0 ?.P ?.&"(  ?.!@ b("($0/>P 0j0#0 ?.P0 ?.&"(  ?.!@ b("(0/>P 0\0#0 ?.P0pm7r~r|rl @@0S l? {0S 0/>1 0 ?.! # 0 ?.&"( 04q0A,ql @K0P p 00@p(p&p$@00 l,P`X  P@0`  ! l0 S00O>O>O>O>P>$P>HP>P>::::Q>4Q>Q>Q>lP>Q>Q>R>P>PQ>lQ>Q>P> -1L PP|q0S 1SP) @ !00CSX;-X;-X;-X;-X;-;-;-;-;-;-X;-h;-;-;-h;-X;-h;-;-;-;-X;-0 Sll0AT`PP h lVb lPP `PP O l=O>O> -PLMPe $QY 0SV 1p WW*l0!R00*0`Q 0AT; 0 S @T4 0ST/ 00CS*t=-t=-t=-t=-t=-=-=-=-=-=-t=-=-=-=-=-=-=-=-=-=-t=-  0P4`V 0 EP0 000 O>O> 0-L`M<@0lPKSX0 th h0 h d ` \ X T P L H D 8 4 @  0 , $ 06O><<-4-:-; 0 0 0- PL@l00S00 -LM@ ln00 -ML0  -ML,0 0- @LPl 0S 0SP00 -LM@4 l"00  p-LMP`@l hH$H `pH -LM@ l00H   p-LM@P`l < p -LM@l00   0- L@P(l0 0- LP@1S @ T(l0000l  a V p-LM`P@l zA .0Spp -LM@zlv00 -LM@ |@ht p-LM`0@0  0A00 Q,PK 00 0#0Q 0S pj; -PUp`L 0Alڇ! B@'0\0C  000 -LM@Al 00 (-"(LU (-"(L (-"(LQ (-"(L (-"(L (-"(L/0 0  -LMXKpP0ȐK` @ 0@T Z2"VXp 80 4 0 TP l P0 pP 0/ 0VL0 H 2 P#0AV} = PT0SH H R*WRl DP  0L D 0p @ PHP 0 S  P@Klp 0 @SV  FD0l 0 Pp V7  0`S@ 0QE 0 W  E  TE 0l00 E 9PE 0pc@0!R`0E :0PE00l p Hh 0 `PkAl _P 0@ 0pT8I-HI-@R>l Ol -LMPp`@0@@T@000` 0@0T000@-@T`pP*000  000000 !@T:p@-@T`P*000  000000  @T:pQ0@-P @00 PU@  0 000p@-^@P%*`0 13R0   "7! 4<4 4! >! b1! `` ^:p p-L M``0@P$K 0 Z0$ $0K  00 Q pj;  0 00 M-LM , , 00 00Y P4  0?00` J0-<0`O+, !0d J @ 00S@Tg D/,0..P 80<4S84S0 0E,0 D ,Gp`W, 0 R h00h0 ,00ğ P@0, 000P/,0-4 0 |@4 p0 3`3 0 ?gJSψ 0Sk4 4h-;;; M-L8M000@KS@0 0@ K,0 0P0PXP U<  ?`  J<-<0`O+, !0d $J @ 00S@Tn0 0 Rb 0 8@01p0 PO P <0 0@K00,@K@噃P@,0 P 0 0 R h0 0h0 0@K  0@0 @0T00 'PQX <l@0X \1P[2@,P D@[@0K00U,ꗄ0,0 PPXP 0P<0s2,0 RHR> -LM0,0 00 `p 0S J  TP 0,UP#  T H#0S 0C0Ÿ 0 PP@0 ,0T 0Pq0pP 0S  00/ 0Sh0 0S 0Sh0Po0`00 `0 0 R 0h0 0 0 P 0S00d0X0 0SPPl0P0S 0S' P00SP0 P 0S (P 0SPPl0P0S 0Sl0P0s  0S0l0P0ll00Sl0 N`@ 0Pb/D#0H#0S0^^PKHr-;;;;;; -L$M ,;< < @_0 F?p`0 ,` F?>p`0 0` F p`<0 H H0, !,?/#?"/C1@B!LH40 8 A40\!$尔4D 8HQ\4 V8 @ 0@ 0@0` 0UP P@1@#Y@  P@1<T@Z L2D`"S 04 S08 SH3 R6<0P PL2D`"S 04 S08 SH3 R P<0 Z L "0,@ S<`P PL#0, S PH&,@E 0PH0 PL"‘\0,`S00`S ࠡPP PL ‘\0,@S00`S ࠡP P  -LM p`P\  P  1PJt0 0OT S 8 0# X 1P0 ?@E@,P?@ ?ETL3"0 S\\L#0 S\8 0‡@80 -L MPp  0,P ,@`VPUPa0  0` ,@V,0`VP0  0P`,0UPV p-L MP O> d  `D@0 @K@~P@H H 0 S 3 Sp頀圀U -LM PL`8 @ TdQ P^@08/@ 0O ?S0 4 R P, ,@H2HP 0O  ?DTp`0< P̠\ 0!O>P `0/0 00R#Ac 0 \84@00d\ 0t!O>P `0/0 004@R#d \<0@P!L!40\0C40 d!40040T00Pà\' 0 O>Q `000 0$00C$0@0 L8 0@ 0\0C 000,  ,5>U -LM , p,L< 0KP P00Uq , P8 j 8 H`\00Ua "0O00U T08 UY P !40 SPUUJ 0K  PpX; ^0,"O>Q `0000  ^$0ˊ0i$0L 0QO< 00i 0 40Y i0C40!400400, 8r~8J\ 0K 8J p?C0 K8 Y0K 0O>Q `004 00 8 ^$0i0ˊ$0L0O<0 00 0 408040~0K 8p85>U -L$MH , \P@`0 , 0`0 ,C 0 ?P (0@_,0 8 0 K00S4@(@,00K` BP@0 ,0 ,  ,@ B  0@, L#"00C0\\2Qc dP0 K B,0@ ?B 28 R^ ,2PŜ0H H <0 R:00K B ?C,@@K 0O @@K B,p`@ _ᖄ@K 蕖,)B, @@K` FP,% BHp` @_,0, !?B<@@<@ <00C0 08RT000T00C0, 00,@0K 0,8 PH X000QH,080 a@_B0K ,00K` BB0 ,P3 AU T -LM Pp `PP  !P0 0H@, h$%0W 0S@T, @G0 0TC0S@DTP3 A0}Tʼ0 K 0O0@K  B 0OPX `P/,>0l,0@@p0!,@<0 N<1PU`^0 0   R 0S<0^<@^0,0O`0 b s@#T**0Po 00 uPQ80@T0} Q80Kl  A` A`P)5>@; -L M L 0 `PP  gP, , Hp 0S 02 0O帐  ?AX"`PΠ^0 \000?00S1B 02 a^ Ϡ\0.aQ00/ aP  1PR\0/ `TPX 1 ^\0`00 /1Po0 0PΠ P`P*j)!0^ \000/ 010   B  0@0L0 : B S  ,P|0  ?   0@L# 2 0 20 0  r*|H5>U H;`;;; -LLM 0PSp` 0O0  0O*)8T0 LU#0O  0ORQ ?@<Ě 0@@K\ 4 84S 0&* 0ȟ R00p  0) 4 ]P0  7H 0O,  ?@00p`U( 8, 0L080 ?`0 X78@`Q.,@,`0!08`00?.8@l, 04S1 bP0 d T0USY2 p K@00,@&>^ /, `00 0 S2p K0@!>,0 06^,@ `00 0Y10,k$0` 0$0L 0O4r 0 0 080`@ 5R,8`0`@00088?.a 0 bS1Pd  0Y ,80` S"05@_Q,`0 0  P000o{,0 $8,@`$08LÚT  n ,j,    0@L# 000\H4Q 8d@P,0 4R4 ,2P0p ppP8@P0 0` p p0 00,0 p3R ,@0T000,T00P, p X0 ,00pK0@ 0(` ?P@,2 R,`0 0 P ,0 2R,,`00 N 0 ,,    0@40L#"000\1Q; d@ >P ?>,1 R2P0p N pD0 P; > ?(?P K PK0O P@K >@p`_$PK`K PK X,,P@KX ?` FP,%`K?pp` @_ ,?!>D  D D@ 000,0 R0D,T00HP, p X0 ,000 0'(,;; ;$;;5>U T0;T;t; -L M p`,, Vc*0 0 LP> x1HP 0OP1 AR\000?0`0S94 1R\000 /0900 V 0`5 L#0 @,000 Q"000 y ? B L0S @00" B"0 8'=S 0 ]&[&5>U ;;; -L M, p ?9>O^P``!>@ .2Qd, Q8`0/00. 0 b  B@b020!P,2 8R`0/.P @0 b  B020!P] 00`1Po pǏX,PN,0840  j0S200 OX40  S> `000/>0@@!N1 Q 0 @c00\0^  !0S  ^ PoXW, 0p&l%W,0 <&8,0,/>pAYU PR>4;:X;: ; ;@;`;G-M$`PPjl0h (Qpdڥ!> 0! 0@$p ?> 1^ࠡD T! 0  S \ d@E? >i1^࠱D T!@  LP \l 0 \ 1( Q0 110b1Z 1(0l 1$5S!0SL\0 P3Ѝ!> 0! -LM d= P@0P 0 < K`85堐00Ȁ Zᰐ = \00^4PP@0 <p`W "ڤ0S0X0 Wڬ0X00X00S@TڠKKx0KPP0p 0C0 X0K`` _   Px@K000`K`uPP\HpK 2 ^` `   P0`K@K 0 @"PP: 20 ` xK 00PPx0 d @;X@0<H.0@PwPP@P ?ḀU00SaL  vFwwK\Pq\ 0@K 0 ݧ0`T *00/묐00 T`:^00 V 0 0 㼧D/0렐h00dh0   P xK00@K@(uP-@ p0KH   vv@K0PɯA#w K P@K2P`ɯ0PK 0@KP @SPPk Y` K00PPw d @; X@0 @0P帐2a ;vv0<HN0@Pv \  @K00@K@tPP%0 0P堀K00w @d :X@0K P1ɯ0PK`@K 0` @PP謀` h0K00PP\w d @:X@0K <H0@PuPPp 01X` X0 0  ]P U>`娀@1( `j K P t: 0S:0S: \g  P@K00P"tP `PX 5v`D 08%@0L 0`V YE K00tPP 0<6 0K(0@_ 堐K0 K `PP P`01(   `K`0P  : 0S:@0S=*@5L 0`K(0a렀K@_0pK` pPPa \ @K00PPv 嬐00V<` d @9 X@ @0<H0@P꬐0`( 0%0@_ K0 P ~PPP @9@0001(  Q >   t8 0Du4 V& v9렐 0S+ 0S:0S* S>0R-LK ?@K  0 K0ؐ00 0АK000  0S:0  P !! l|;;- M Ѝ -L$MP< Tp$ 80  000 8 00R00S 0Ke0 0 R 0U 000O 0 R U0D0 0 R 0W( 000O 0 R W0  @ \0P@ 0 0 R 00 0 000 O 0 R00  $ H 00 0\%1RR 0帀0P@0 ;o0@%,p"0@ Pox'`0d 0@84@K00 @@IrP@@0Q x40 H 8@T <T0$ @ 4sZ4s4>t,5Sʰ0G@ W0   uW 0000fU0RU 0000CT; -LgMNKTQ`UP|a *p\q 8 0BRS p 0S XA0S R P@ >K\~p`,0<4 D@ 0 pSpq  0K0 TPLX!1RHpATa45S:05XqS*NK `PPS?K 0`P 0P@ 0 R 0~K0K\2\  Lr000  0Lws0K0>K\pAXa85 0 R 0^K000p^K000P `P7~K@ 00@.K@`Kpq8Kt 0KPSo`t0尀 p0UOp0 t $x! t!t1 僑R00X0p@K /0SutLQt PC@KBZ 0S1( ? 0p0 `aQ  d!P 0S!0(0 0p0p`P U pհ000  0PRoK p 0S㰀1( ? 0p0 0 S0p (0P UP@K p 0S㰀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0]K000TaVT+0\ @ 0PK  p`PtS/ PKpA pt00QO0@H KP㰀tQ 0S tAKℑ00``lhh@K 0 RXtPt Z`@ 0T PT 0SJ 1p0.Kl1hA0PE`0O TdS`Q5 0S da.K1p0l1hA0( `QUpQ0 0S ^K000`aVDpQ0QZ @aT pհpq^KT0`Q3/nK 0| p尀Č| 0S" ^K000 0 R |qg /0|00 / 0 |ah00fh0K0dq WNKpP 6 p 0 S# 0S:0S*pa LS>R-0` .K a0000Q가 0S:0 }K0uda VhNKpP 5 0S" 0S:X0SU*pa LS>R-`0 .K a00B00Q; 0S:0 3d!^K1( 0O$ 0S!0(0 1p0p` U pp P01R/1 0S:0S :p0@>K 0|a pdఀ|a pKS>0 pALR-NK ?  K00@가 0S:0 1( nK0Od!Sp1X@KnKd 0055@K Kp` 000tQ p P%|qP1 aP`pa R|q @ pp 0 R 000pNK00 b|Qxa p尀P|Q Y0t 1X ta1X 冑>KFXqW0K0 tQR000X0p` p尀x0K03pa~KP 4NKp` PPS?K 0! 0P@ 0 RW 0K0Wpa0@\\80S L1iH L1<@ LoLUp Vp1P 4 p 0 S# 0S:0S*pq LS>R-0 .K q00@00a@가 0S:0 0.K00-K0K\q 0TS( /& 0S :0S:(0Sh0S 0S 0(pS   0 R 0 0`00Z 0S:0 0TaS鰀X0S0TS l; M-L`M`@0 00 Tp`0 K00X@ \@ 0P@0 D@ P t0PXP 0KP KHQ P0`KO P@K 3PK@00@0D  T@ qp< 00 M3 ,00,0<00P@KL R-@0K@ KPKD 0@K0 0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018ĠPR>4;:X;:p@-8`PL\ -0--|-----0 Rp!>0  ARp" @0O0 \p @0#O1A-8pL\ -(--X----- 00!> ,A "`P?HA0?`P@0A-8pL\ Ա--ı-,-ı-ı-ı-ı- 00!> ,A "`P?HA0?`P@0-8Lp\ 괲-ܲ-------0 R!>0 R! "A"!?`P0HA01 ?0`P@0 -L; -h1LM`Q`!00p}P@<1 -LTM|0R 0p@0 0`  \ \ ~PP }P7 V @0\ @@P U $00X0  0IPP\@0p0 K趙P00XF(0̠T0 0T sh < 4 H hPxPK ? TJ\/4K:dgPP45h H\% R  L0SS  1sP|0@@4PX0S\ 0 <\ <A{KiGP 1s 50 Q 5X^$0 L5Xs00@  V<  h<p4\%R0 0< 40Hh h0 S4 00:004h@ i<04@ P@K <F=4S505XT @P $5hST,0T T PD XL,- 80l 0P@0T S40h lT d ,\@ 4KT0fDT PPD 40H?4h4P 80PX$%R ,0DXP ,0X$%<@ L 0S 0SP0 0 P $0(%:( $0@@<0@`t0<@$0d <( 80,0X@Z|0 X^HCR 80K!*8p@Kua<SΊ>0 Q ? 0` Kp O4 `KP05S`KX R 0 0 $0005<I  \0,PP LH, HL| OPlPH\009004h hh 4 |jhd=:T`;$;;E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎G-HMO<@C@C80@?K4,$@( @@\ 0Q: `$ ?(Pp 0O/ 0 @? 0O@<0o 8@Ǐ 4ɯ`0 ,0 (0  $@ 0 =0 5\#HЍT-80\%R0$Ğ4 0T -L M$0Qp `@ 4P@ҭ Z 00#00A PP@Ѡ H|0 t 0]~0Q Ŗ@$yLyvs$0ԑ:$0  -$0L Ppԁ  yP@`@0 S@`V yP@P D %0 0 '@  -LM, \0d Po740@ 8@_<@_,!*`, ,0T0C0,Ě,0YZ  ,0Z ,BMl ,D  Tt; p-LM80@SP0 0l0S  w`V p  0嵖0S0 劗x -LMq@@ -RP` =S=T8 K8 4P , 0@  x8` $0 #=0T00S<K !<0P`ST  l  0p0S  `E @ =SP` -H;; -LM4 ԑp`8 C8 PU4,0KP(ß Jv@Tx R0"h0H w,0 ᄠ,002 0`pBP@ ,wT kP0@o%,"0@ PoJxV`0d 0@)0@K00 @xcP@ ,w0e8@ @x#00 H 90te0xt1 4,0KP@A 0S@@l0P0S 0S1 ݉P 0S@@l0P0S 0Sl0P0s ,0T $000\%0R ,08 0,5Sʰ 0p00t0 0S0l0P0꫉l,6w80080PXkk;tR>k\kTkT@-@1T0, T:F@ 0000 0S00l0P00 -LM, p0 40@4 QL+- 808 0 S408 h0`,Pd ( 0e PH <0 RI d80 X4`V,dT ? l(,4` h0``ze `0COPHh L5HsP5,5S,pS.>,$0pW nd4c4P4 SHŐ 021HXc40P040 5> p-L Mp@P0Td``  pH@`/ < 80`@& Bph8 hD6>k;;k@-QM@ 00CS --- - P0 Ѝ@-@Ѝ $  T>T>HR>DR> -L4M0 8 04 H0 <  45R805 R8 P 08D0 ,0 \ 4H0 L L 0S404000@TPU<0H P0 P0 T (<885 0p T`b V `!@  ? SR`P 'L  0SZ 0S 0S4 $0 S$0? ,@K0 0@aD DQ04 $0,@0pcWW `H@08 PD ,cD8, 0SP0 T0$  40 40 4 00Dgc,0S,K0 0a 0S0 Tt -LdM0 0PL UT p 80S S T t  0@t@ R0000  0SH6d @6X 0S 0tS00S 0St@ 04 S$4%R:05S:8 0P0R00S T 0t@0 S:0S*^ X 0@ KS0000T00\0 0^P0 ` t@4P &@K4850 aX!RH P P t00@P P P0,K00P`t0 Po 0 S 0S:0S* 0S t 0@ 0 R0000L , 80` S@0P`400` eHH0X P`t\\n4H0 0SU ,bX00V0SJ000PUXQ0 0S 0S 0;0PX0Sy L@TuV T0@0K@\0@t@X t b0P@0XP\Q  0`P1 R 0, $R0000 g,a,Ma,0H@Hb<@ Tp@@K4P % 0S) 0S:^0S[*4 LS> 0@KR-`0Kp KK0`K@0@pK0@; 0S:0 2t  0S :0 S^ t TX 0t0 ;T>; -LMp80S 0S _`lP@ 00300@TlP@ 0 1P0S+ U@Xl 0S!0cxw_ PP_l0`S YIg_ 0S00 00@ X T0S 0S x0S 00 00SP00300H]0030009_Y`Z_lP` 0Sf`P  |00Sz $0w s ;$j; p-LMP`P@0$SD @p@ kk -LM@h -L M@P0  00 0R@@ -LlMp T`P| |  @t0 p!Tㄠx  0|4J@ ThK@  XlKp 0 Pp\l [x0 ( 0SO 0 1p0$t@ 0St0  @T @0P`V U  @T x ,0Rp 1h0 0S 1p p0R0S @0P` 1( ?R 1$ 0 1( 0 R @0 100LSl0 @ Z   W{ T `@0 0|40 p`00@ M l0H 0 1 ɯ 00R00S% 0S" 0Popx $0 0SR 0S Hx0!,0 0Q P`0@Sl0  T_x0  ( #@t x(  #00X 600;|0 ,00,0lbPp _Xp ;`Px0 1Xɯc l -L,MT,0 P0@ @K0ZZ@ 0 pD D0S~ @@$0@' "p X QDYLD 8Pc@KD 0S @ S/@00S@D0K ,0` 00 K,@ P 0@H0 ,@ ;D@4< @\D@ 8 @H $@ PH 0 k#p0  d#0 #P0KP@0KPo7, E",'$`PP0 K00K0D@ 0PT, QH  008@S@K0s@ Ypyi -,0 L 00 0 >hkdk`k-X0X  00P0\ P0^Phkdk -0LMxxpP@`0 0P 0T P0U  pP  lhkdk -hp@L `P0 0!R 0U R00 R 0@@0V hkdk0S R00  -LMP@`Q 0SN 0S 0S0 ]Q 0SQq 0T $0pP! 0 00 0 R0(p 0 p00 00000  0S 0-PL@Hc 0P0p -LLM p\ 0&l  ` d  ,0 h \ 00X0 P8 T 0: S 0@` hP@lp  T0$  00CS\ `P@d 0RR<0 4 D0 @0 pQ 0 004 D0 Td0S1 4A^ / 0S 0Sc0S_`H ` 0SL 0@; DP \ 0\ @,P=,0K /00P@|`40S;;S48 @ ,0H @0S 2 R 4 R P  T0( R00000cCQD0Q 8 < 4 P T0( 0R  R 0L0 0L00 PRP ` \ 0HQ0㐠AH 0,Pid RRp0S 0S0d#70P00S\  ga0` がP@+4P+ 0C R    0@$;D0P 0P ?0/;?00 T0+S  Th Ǎ060dQ 8 <P0QP 8 ;;S 8L@0a0t\T>;; jPi H0 S04 0000T (0 S000000 0S 0 S:0 S* c 0 RT0T0((    Q00Ŕ0000@000,'\ld70Q00S0?00d R X d0R0P00S pQ\l ,0S# T0 K0P@ T R p0Sh (06000\00 V\  `m\h 00 K60T0P@TQ p R h P0@6 0mh P0600` lP@0S T0 K0P@ T \0R0  0;0h Č06p0Sm 0` CP@ ;;SL0`00S6 T0 K0P@ 0 ' `0^# 0Sp00^ 0 0 R00p  R amT\P Th w0600m\ 0 S:0 40S#@08 0r@0 @ D08 R08  00b4 <0  KP x%/; ;L@DK 0 `@崄P*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPP]P@@T0( R)0[*0[S""[0R0 0R@ R uj@00T@ K0P@ @P T @Pbj5@..;- -LM@ KP 0 0 0-@DP L@nP00 4 0 0 -( L0S 00*h 0-LMP@ KP  0S 0Sl0P0S iF0000 0- D0@L \ PP0s 0;> p-LMP0 @B 0  B P 0s 000Hp @_ 0S0( 0p00i0@8@j@p;>0 0S00D d< X R  0S 000 p-L M0@ `Rp K0 R= 0 00 0 R  00 0 O0 0 R  00 0( O\0P@ 0 0 R 0  00O0000 00 0 00 \  0@0 0 5> -LM`P@2 80S . . . . . . . . .T0$ $PV 0Sh0d `0X 0S  0S 0pSt   0l  -LMp0P$K`K0 R 0 00 0 R $00 $0 O\ 0 R $00 $0( O\@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST04 $  L 0S 00[D080T 00h/4[8$0\l0 00 $00\ $0\0@0  0 KK5> -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0$   0Sp00R P R 0Sd0X0 3 R 0SD0D0d0X00h00D Q  0 R000#d(#X R q T0$  0P|0s4 00K R000080Sx uSn 40p0P\4,0S:00 S*(0sQ T0$ K  0S00p  Q P \0  0DŽP00s000(0s T0$  0 0 00(0 0Pq T0$   0Bu  00sT0$  S0st0s_j 0Sd0X07D 8#8S2 0Sd0X0#8#888d0X0  0S  d0X000d0X0#ȵj -@P 0` R00p  LQp ኿P,Q 80S  % 0 R00tYP   0!:0 000000<  0  x O -LM`p q4 @   w 0Sp00Q ?PP  0St000 0  0Sp0,0 ,  0Sh0ɯ0,004 S \4  4 PP 40 4  0 R00tpp 0 R00p@@PP64 0PP,4 PPPi00, SR000,\ 0S 0;00 R 0S 0;04 0v 0 R0000 t  0 R0,0, p \P 40 J0@R RJ 0Sp00TO 0St00WQ jPJC 0Stpp7 0S  p@@-;E p-LM080S 0 R00 d X R  0 R00 d X R `T VeTepme 0  0u` st n -$"LEM0`,0 8 Rpy T T0RpW  aPcP1 RW 0Sd X 10S W  *eT1 ,0S H,000000000 0P 0 0C000C00000v w MOK $ 0:P ᤃៃᛃᖃj;Tj -TLMM`0 P,0  0H1 HQ9 H1L 0RD0R `3DH!0SH L 0S L10   R 0S 0R H!  0SH1  p00S@( HPvcLsccYD!000@!8~PD0 0C0 RD  00C0D!00008Rc0: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u $b`; -LOM0,0 `#0Q p 0 KKI>KPpP1P 0S 0 0  p   0 R  0S00t000Pp Pp  0 P4a 2a2 ,0S ,J0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000QsT1H 8 0Pp3TYPpMOK TP 0(pW y ۢ P10o0 0C000C00000000P`T%  0S00t00t07jTj;T>T> -LMPp@` Vv |0S m`k`00S Bu ㌢Z`X` JP 0 R00D!d>; - L 0000 ,=>j - L 0000 8=>j -LM0p@ `R1!0$K0 R= 0 00 0 R $00 $0 O0 0 R $00 $0( O\0P@ 0 0 R 0  00O0000 00$0 00 $ \  0@0 0 <>j5> - L 0000 ,=>j - L 0000 8=>j -LM0p@ `R1!0$K0 R= 0 00 0 R $00 $0 O0 0 R $00 $0( O\0P@ 0 0 R 0  00O0000 00$0 00 $ \  0@0 0 <>j5>00CS ;.;.;.;.;.;.<.<. @00 0 ; < 0 0-LM0@  0dPS00000P@S0 -LMP@p 0!#61080S#L=.L=.L=.<.<.L=.L=.=.L=.4 0 R00(p [P` 0 00 4 \]P`0$KS<00<0\$@  0P4T;>j -LEMŸp , @00y N?KPP81` 0S  0S00t 0 R 0 0  p  PP PP  0 8:\ 8\1 ,0S ,P0*000p1"818  R00  0  0 StP5  0PPMOK X 8 0PnPP 0  [810?; [00 00818 8 ɴP 0;0  0S00ttijTj;T;> 1s s 0080<00 s00(U>U>U>< 0S00 Q0 0 0S000-<0@Q 1 ! 04  Q000   dR ,0000 0S0@Q1 0 ! 0,00 00@Q191 0 S  -LM @P `Rp% Q 0R 0UP#U($@`p6 P ڰ6 $ 000  (G.;; -L0M0 `P0Sp: : S@ (@@ 0P@' T0 Pp0@Q !R"A0 0S00505 0d0 L D](@0ˆ CI.lk5>;;;; 0-FLPD\ ,0Sq 0 S R 00 -LM^ @ 00Q0 \ R1S  RZ(@ #00 -LMPp  P,P F`VPUPa 0 P` FV,0`VP 0 PP`6UPV -L M P,r0`P 0ƕ6 ,@K@EP,60 R,G$@,0iHP`VC i1 S2`@ P7 iz!0bR0S) PP0S P  VP@ 0# 0,0C 004 0C0,TG$0"A  -LM `,劂PBP00  0Ɩ6 ,@K@gEPZ,0UH(@ (@0 S2P  e?> Aq P- 0lQ0  PP:020 , B 00*  R0C 0,& 101,F(0Z"p @P;  $ ,!GH;;<;\; -L M Pp``$0V:  , 6 $@K@DP$0$`H@`0 S2  0,0 00D 00$F$F; p;$;0;x; -L M P`A \00\0SE(g,6倢0 0 6,@K@D0S-,0(H`BAp Q ;  ' 0,&0 00 00 Q,& 10C1X0,)F`< R,pF;  ;;; -RLp`$P@ $P`A0Qd P 0l1 P0P'LP @P;  H;;@;$; -0LM ; ; -LM p`0 W 0 0W 0` 0 ~ڔK x0K{P p0 1 B XP0KU0 ) `xK06KCPPp@K Hp2VQ U` E 0OK0 0P2P"P0 0x K6F 6X3O H<0@DP  R0F0 0Q D8EE0@KTPI:Q &0`0V@xK26@@DF 00`:00fE0VU  04C0  00 0xK26@K@0CP0p KHp2  DD6TP:UB"0K0 0PP P0 0 Q! jD6 /```E 6 3XO000<Hi0@`DD  6 /@K@BPM0 06/E 6X3O 0CK0 0uPYPh0KPP 6{E &0X2O 0K0 H<0@CPp0 X 0X0 0  V} A0(PU 6 @K@TBP0 fD(0 K0 0P0 ` (0006 E0 &0 2XO000<H0@; -L M@^ 0    Q -L\MT@t p t x T`@P儀ԡ 04@x pThpKUlPK/ 0PiP@}Ql ) (!(0p1@  Rp@0 P` V@x0S ,!$0(0Q ` 0 A1QXPl p< U@o T4 XC0 0t 40 /qD00 C  Hl@Q0U0T00S 0S $0`V * x0^1 ,1 S 0DSl0 pXpC(0S0O@0p00$ `V*x SH,!0 0Q (003OX 0tP0 ,00,0FP@  -LMp`W q8 0BRSRJ P<  K0 W 8V50&Ɠ0F P' /K0P    kf Ef 2A000 0!A6P &K /0P 0  F6f f0eH0<@ @@0Ɛ& P@ @4 6#!B0 6(#1D `, 6< 4|K0 @9 4K1S01X40K!@TZ @ T 01@D T( 00 00K(< |K(< K)Wl"0  X @ 6 #1 c< 6@34 a B8 00XPU+4K1S @TZ @ Tڰ0!(P@DU T  0\50#0`00000!0(06 @0K&4K"1KN4K1P  S0  0 0 X0V@: 5Q000 0T0(P0OTSU@0S~ (' @ l -L,MH L 0 40 8 \8 < @ ` @VV%1@@ T@ 4pW@Ap0 0/JA00TDP ]2 ,00,00 <80&Q0 0OX q -CP4H\8 80< & 8& "!g! B ?LP<L 8@ 6#1@CT b`Q@DU6@T`4 RP@QpU< R ~H0L00 :00 @80&L0,K"0XPL,0HL H  0R08&",K@H ,0LZ  L H H0D 00H0 ?0 Po lD; 0-@PLB/A  0000 000000 -LUM0 ,0 80Q p h! 0l t t&@0 B0PTkUK @eW?K T1 @ P XA DA @d 0Sgd 0  \ goP` -D1dQ0c0Ux1 $*@MKT0 P`1  >K0 \  P` l`P tAt Q`l x!U:h1d㩠0@hP0S:0S:PP R `Ppt0l0 `x,0 S h,P0傠 0$ l!t Οl 0tlp jh; -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `nh@h0@ PP<0 X@ \ h x  4T0$  00CS4` APPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 4A0S*p@L@ pP it t0 BOK|  @K D x;; 0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@;;;;;;`; -LSMh! #hA0  ,0 6(@Kp1 34  L0S㄀ `0 0#60C Sw.\z.z.dz.z.lz.z.tz.z.|z.z.z. A?(K h1KK  hA 0R 00l1 Lp@pLEh_SK 00LKGTK@l`X WKT lUK MOK \A @a 8 D Pa KYP@`Q0 0R@`pd0S0@ 0Pp@d ` p:0V`0MKS >K>Kp @Pl!)dm0P0@00S &0`P/VUh1 0#@ J H F D B @ > A?(K j p-@ MLPPP` 0DP4 00P@phD6>;pk;0k p-1LMt1t`HPd1dAHP P:LL K(GPPC RPP200 R 0000  1PK0 L0S  ,F0!8p@@ֶ? 0  00C0F嶘yIp f lPjxfj;8;4n;j -LtMp Kl @6PP$= ԑ< R  2PP  4P3 U < $< R $0 0 0S3 S< 033#  Q @0(0$ ,0CPPe`80S||0" 0Qr0 0S $0 LMd0 0fPP H g$0J 0VP HHUԑ0K!e aL0S`"Z @0KY RZa`!0S 3PST1 0  0_@`? 0K @a ,PHHD K!L` c0 0 fPP  yg) tgC0 aPP.03 3 f5>@; -L M@@T`I0 G\0  0NMP0`@(p@D᷽,V0Rࣽ$寽6 6,@K @3@T 0$@⌽,0 H 㢾,5 G|l; -L,M$0H L 1  H L0MPL@ K0 eP@0,(  ? /DK ;3PD0$H@P D51p+S0 c@=[\0EOa.6 0`Ƈ& 6V@f(S@$V( F!XP(6 S DK/ B3P&D,0HDN5 6PUL0H0 8 K40 0 8p , GhdԎ.; -L$M|0R 0<0 0p JP@ &IPڤ3 W 0TLP@$00@0  0dP@0 K80e4K ;4@ 8@ 2P@40@HHP@ V㩕8  c㤕8+40H垽448 @04@ `@S<8 3S X2# C 0 c@r[\0EOa.6 0Ɔ& 6V@]3@($6 FV( _ 6PU,6 S 4K/p2P@*&4,0HA4|44@ 6PU8 0< L $ *<0P(0$ 80<p68#1$0&0,0( |0,Õ4P a@ 0R c {e80S 㪕8㧕0174jhd -LMp=P@+Q<` R% 80 S|00ba< Q0c@F,mjg$0 :$0!P303 -PL aFP@L p 'a0 0 )d@ e -1Ld1#pR@R(6L 0R&H d0E PU0S: RP6SS!/ Sa, RPQ0S6 0&U  0`0f 0 , 0T c 00   TZ Z  D PQP S; 0-80LS@P0 0l0S 0S  D0S 00  c0P0UE -LMq̠PܐY@8 K`'8` 00 , 4P EU 8` v`  0zc0S `OdT 0S80 0 -P`.5>H;; -LM4 ԁ@8  I8 Z4,0K Ÿ PCPUxp~` ^0hP"PM,0 `,0 0pP p@ HPP ,DU (PD o,F0 B[$g66 0@K@0PP ,D0280  $ >00 H@<C. P02! '0807!( 0S-0 ,0K4gPP ,D80 0MDd0S,0 0S005050d0,T0$ 0008 PP (kpk;0kkklk5> p-LM`0\0 \@@TP (0&\Fp0  KP @p00 R Qd 0R "D0F0pp 0000 d00- -LMpP ;pp@2`+H嫺U 1>1p -L MP, 6Y pƕ ^0`/02&,@0H},0S 1 6pV0Y0X00S 1 -0#LRL R0SR T0 S5S Lv`0 Qd0 S;;- 0;> p-LMPt0!` 0 zP@ 000Hq0(bC08@D@p;>0   0 0S  -LM      1G -L Mp0P(K`婸0\ 00 (00\ (0\0@0 H!0 0000@ 0:#:0 10 00 (0H00 ,( 0 40 0 <8 0  D  0100D0 d0@080S; ST04 $  L0T@$K48 8$05> -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s" T0$  0R ရPM 000 0D0 100 0 00 00D Q 0 0  qn T0$ W 0P"0s[ 80SV SSL 0pP(0s> T0$ 8 0R 5P \0 0_P00s000(0s T0$  0 0 00(0 0`Pq T0$  000sT0$  S0s0s -@P0 LRp` ݚP$ R 80S   ᲚP    0:0000   <0 0   TO -Pq@p@`0  v`SL រP  QR0`00R@ 0S 0;0Q 0S 0;0TV ZP -@L80SpP` 0 00   U hAfAA Pp0! B! -P p80LS`P T T0RGV  \P:@1!R/ 00' !000 0nP 0! B!tV  <`A P _____Tj -L\MP@H D `T T0RpX \ `  _H0T @HP _ @D@@@ \ T0R0 0"0   P X D L 0T0 8!R 00T0 0 0d0  X _0: S @H0 T P S0LP0 0L! !L L0 0Ph 0 D^hX D_T` 0\Q ` R  R XEP RHW@ TLPA0 H HK =P6H0P ST  0P0 P R P T0RL0R P0L 0R T 0  . 0 R* T0R& P0S! P0S@T@@YL000X DC[P L 0! B!L0D?D@P0 0: S YTL P` R00 S T0! B!T ?P0Y 10C1 P@ 10C10 P 0P 000H?00 0 0y DK  pH> >D>00 0 0P 0DK 0 E; D \;;0;;4;T;..p; -LTj -LM @Q?B 0S00 h 0-PL@/ 0P 0,S 0s<0kpk -LM@Z^hN -L 0!&R0; -LM@! 00CS hײ; p-LM@ !VU`"S  Px P 0apm 0!R  0! Q0 00;;4; -L 0!Qh 1S 01 0@^ 1 ! 10@0_L;l; -P@0L` 00Rp 0V  Rr   0h -L@L\p`P \ RU 0V  Rr U  0h000h` 0-8PML@,, ,0P40hk;D6> -LM! P@  !è$ $0S$00(@( k -LM@b噊b㖊b㓊 bPphꉊk -LM$0  CLPH0"v!& `Q 0Ss0n0S Pp W a\0!011 ` g0T  P 0 Ss, , 0 Ab ᙉb ᔉb ᏉY00X0S@0 bP` 0 40 , @! @dz0 <0 !< r A@ * 8 !8 d  @0  R !0U 00@  0W aP0000 !0011,  ` 4b8bމ<bۉXxbӉ g0 X bƉY bZ b㼉 Ab P0 l b㯉0 0f -LML`$ 0C#6PH SpP@ 01@ST0S @ T0!@R00R0S TH0!P  0-0@L#$PQ(0(0( 0P0!P!R 0SC Q 0U0000h0{; -LML`\p0+S# $ 0l#6S <$HH0#X TXU:U : lH _PL 40040 ?$  $ 0S $ 0C#vP@ LP0SK \ H0 0! ! !R/\  l!00CS0 0Ss40 040H L@0S$0 $0(0@($0  CH"&0000000 0 ! 00040040  B ik -LMLZ?0 1,0 Q@TO 0S04\-(0`4pW0  ```1\W  0 .00C0 ,0q0!!00( A ( !! .ZWX]80!!( 0 ( !! 0 ƫx;;; p-LM"V@``  00b0eS 0S 000  pT;; -LM@b gP 0 R0 1  0 0 -L@ MT, p PnP1``0@Sd\0!10 l1R0011  0S@SM !R1 B 0 0 T@T+Q1``0ASdQ00!a11\00!11`  J 0T V00!11`Q @T, 00QP00!11000 @;`; -0LR@@``TPp X$ !@RT01 0@\ 1  ! 1 @ 00CS0  Q00Q0S@`F -T1L\M@pT`P9 TK0K K(00@ ,0 ( $0S\0 $ \0K((0$0\X0 $ ^ 1!0SV ^0\Q,0@(0,0\QX0(0U00P00X S000 0RP0 Pqk -R00LM@p@PAU0# ̇ Aa0 b0  @0S b0 0S0 b P0b 夆b㡆0k 0-HPML@<< 0P$0/"A0hk;D6>k -L P00 k 0-@LTP 40S%T 0S 40 0C 40l0hU(0 0  !(  ( !0S1@k -LM0@SFA0 S p00Cp0k-\ 4^ 0S(0 0!!( 0&( !! N4  p-LMP P` P p@ A`0  !( ( !D+ -(0AL0$1@TPop 0S @TP \0@S000@`p@ ̣0Sk p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000 u k;; -LM @R)(0 Z$$ aV p@P0S@PUZ0`KV$ ZcF|o?T@p00Cp0@T  ;h;xW> h<;`;@k 0-LMl@hP0TdT 0LL@H@@P8 440P@hD6>k hh;;@k0 s  -LM0ps6  CR 2,Q000000@T P(` 0!!( 0 ( !!V@Xi000f 0!6O'/ M-LM0 00@K, @ K ,@00 K6pǏ8  ~ 8 R,0P{ `80U00S <8X 0!@@W e 8\N $ 0`RP 04S:R 0S* @ 00CS񟗋P.P.h.h.|.P.40S0QN),0S40S00S(0 0  !(  ( ! 0,!6.@ K@:XW@0K,x(`U0@K0@K0@PK,j(Py0,P0 @0K&0p?@PX0 W ,06pǏ0K,P0W@#&: DFɯ#oZQ8 BY?8 <;; -L$M0, 0@40 Xp`< 0 1s@:4`p X<0 ^ , 'PP (0! X  < 0  !!( 0 (  !!Q00000 ,&&0 @7, 0@S, 0'^"0, P^,PP 0  !!( 0A (  !!  , !(0 6(0 !!U P0140 \p` 1S @:`40pX X  &&:80 @ ,|'PP0 $ (0!0!!( 0 ( !!QQ 0!!( 0 ( !!!0,PPP+PU|[ 0!!( 0&( !!Q, 0 ,0@S,8  06Py(0  !!( 0@ (  !!wQ =P@ (08 ,L=0  !!( 0 (  !! -i 8MP801/2;; p-LM@`P) 0!6V00,0  @T  p - LOPh = -d0L@pT` W PU,0@RTM h -L@@\p`#(^$PP 1Q  Q R \P^Z0P P U 0!R00R0SP UP 0-L MP@0K K/@@ @ @@P0  S <0 , !( I(, !o&0 000hh -LMŒ p, WP@`c 1W` 1W] U[V  ,0pO @ PjV ;000 -LM@\l 0 F R$0$0$0  h鵀0L0;M0Ѝ -LMp4, 00 (Z,00 p14  b2 0 `P<0 0 ^8 p0#20# W00 S @:0Pp`WZ ҁ04, 08|  < p& 08 0 ^P Z ⯁04N04 Z ⠁@lf$; 0-LMPC P0 4 U 0 00h@ 40 U 0 00; -L℃M000 0R`00 X3 <01001P@0T,0 40ST (0! !!(0 0(0!!000 Ru V 1",0KVp 0儢00   0R0p00 p,0S (0L0!!( 0C ( !!( ,00SR%W V  0Hc P000  :00P*W V ր{ W V Ȁ000ᔤV ⻀ ,  0(P@ 0V,0  ⤀000 s:0 nV ▀0H005/c @>0 <41041.k l<;H;T; -LLMD R * < @ 0   DKP 0@8P0SD0Q  S 40R0 0  (0S  8BDKX000( L Q00RP b0SYP @ $0  0l ` #6P`1`!0CS00Lp Q   0Ka0  H 0 0@P 0V0R00S0 P PUPP U R 0 0,0cp @_0 P0Q  0! 0 fp XP@ĐKT D0 KcP0 1@ TZ0(^00S  0S 0(R00S0 8 0@000̠ ,00 @0K40 b 000P0@ ĐK 0 0 0 S  \ @P`1sS@ TZD0 aDK PP P04 0R0 p 0p  0S W 0SEl000 0R0  D08 0 Œ@0P 8)p h0R  - P r#8D0"0  ! (( !]T@101P` 0& RVV8~V 8p h0R000 000#0  ! (A( !0@ 0 cH000C0x 0&P : g#M@P 400C400P0 !( 0&(  !"`0!!0( &( !! , !(0 A0(0!!#8k~E U P`  ` 004 ``@Tg 6 <01001V&1010 40 000 40S  jD00 8 Œ@0P (00  ! (C( !8~p h0R|ޡQ ]"(00  ! (C( !8}D0弡l! (0 0  ! ((, ! !6f (0 0```%P 6 }"@0!!0( H ( !!U(00!!( 0 ( !! 00 &0 & V ](00  !( ( !!8r} # 000H =P` @| 0@@N% Q00V@@T+ | (0! !0 , !( (, !84}V[ 2Bp h0RU S000 p 10 1 !101!0 (00  !( ( !@ S!0@ 0 cH0 à0 <410418| 0000 ,00 P0K0@0@4 0lp000P0 0 0K PP PN, 0(ҞHW>`;l;x; l;;;;jk 8000z|840 4S000 |0@( 40PS(T;(0(0  0 00 $ 0 , !( (, ! 60@ 0HcVP T@8R|T0  x0 00040 D08 0Q 000 !( 0 (  !@0ĐK p 0DK PP*^ 1S0ST01O aP 40S(0! D0@Q "000D0 00DR\8 00@T (040S00S`@ p8{8{Y Q-Lp@`: 01PPJT: T    -pL@P`t{ h{ -LM` KP@ P3 T *$pK 'PJT: $0T: $0T*D0S d$0#&R :0R *0a !b(0 P 6'k; -LM0 P 0 pWP @`4  P 0$  cR 540 W(@ 0 @{ { 00U W 0 {  {P 0  *{P000  z=: -P`p@N@RN^``LP@z 0@zW>- ^$  0>0>0 S  $ -L MRP`@- 0 00 0 80 0  0 0 (0 06P@k -L 0p;(j -0P@LT`p 00"  @TV 0 R@X $0m@U50S SL0 Q* Q$0`0SpPܯjkX> -|0LM\ d \0+ KKx5%#!jJ kTkk; -LM0S4 `0CPz:vp0`ZC%Z0>0>0Sp1x#  n0X< `80  40,K<  P8   W00 P00S 0~p Wz3XP8@e,T@! & 8 Pd0` @000 壛0 yP0000,d0 00Kw H0 0P8 R  yW>=: -LM1` 0 P.p@  @0o `@^ K0 n @`P `@@@P0phTkl'W>; -LM>\0ǠȠŇ@`P'0 ` p P`P000U 0 0 $00 0P( PP 8;p;; -P`LMY'p  1P@ (0%Ơ  0!!( 0 ( !!@:P`YXJ""X -PLM`@ * pKt CPdJT: 0 #Q:b 0QQc05$ 50P !Wlk; -.L$M 80 0 8 0(0K#̌4 @# 40`P `@@oPZ8` ,4\T \1,0  bp 0^`/ P  04: @T( 0!!( 0 ( !!40 S0 08 @:pj,0 0Vx ,8B8 \0 h p0S &,0 0I,pW>;lk 0.  07 -L M0@p` P000 0 xP0000 . .$0K PP ᖛ0 $P[ 9x=: -L$M0(K!Ÿ@00 P0 p`@ PPl1, X004  c`p P P@0 ! (0 V 0!!( 0 ( !!4!0㏙X^00S,,4` `@@@R@T 0!!( 0 ( !!8 044@:ʌ`4 pH\0@0T Q %,4p  a0qTk'W>;; l; p-LM΁T00K! 0@`P `@PpTk' -LMPN4A@Tp`0l,K, T0   \ 0,0Tk'4;0 -L`@P@T@@0p*<@  p-LM@P*`*ph -`L0S 0 !,B$ R; 00S000@T dpdP 00@0 T00  S,<@0hrkkfW>kk/0 r/@; -LMp@T 0R 0q@ 0TP`P @TPPU L @ 0P000S kkkW>L;k -LMP|`|p@lT l0dU @l@H 0S ݙ0 0C 0kkk;k 0-8@PL]((  0P000h`kkk -LMP` ps 0@ 0-@PL0p4 0x P(,hPlPP u|PtP0T; -LM@p`0 P000| ×0 uP000(0K 0 (P*v=:p00p0 -LMp 0 BR@p 04 ht -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P 0R4 $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P 0Z0PS 0h0 p-LMP@ `0QV php p-LM00PU*  `Px@T P10P1x 0T0p'P  X0,P0 0tt? @ΜP `WX0 P L@TP80@$XafTkk1jW>\;W>kk; -LM@T0<<h驷 ((x  P1x@0CP1hY kkTkk0T  $ 0D0 b-$0  CHL0"& a-$0  CHL0"& { -HH!LM@ ;kk ;hD6>8;k@;kH;k -Lp`g(0 S$b ,0 @P0L0 S h0 0h00  `0`40  ( R 0S(mHH -LM@p`& @(0 Sb$@ ,0 @P0L0S!gh00h0 p `0`k40  (0S 0S(irHH R -L,M@P$8 4 P0$, 00 , < @ 0OSF; 60` @000$0 pP0000 0@ ,  0@P D0U t$00S000 w @$0\o ^  0R 0, 0R $0000 ,0R ,0$ 0@(00404(  40(040 0404R88`<<0@0@D`PL H   ,1H`Lh00h0  @0@0,l Q00\00 Sl $ 0 600 S 0 p$ 0R@%0Z (00SP ,0  b0 R|Sz40w804Ss<08 So@0<@SkP0@ SgD0SdL0S 0S^ ,P@ 0 gp!00P00 00S, $00$0 #0@,l T00\00 Sl $ 0 600 kpkkk0@- 1x@P \  ^:\ $0S 0000h0S \ 0^5:$0 ^%:\ 0x0\ $0S\00x00 0^:kk -LM @T`pP 0D @ 4 Q0#03QP U 0U 0S: -LM$0@0A@N@N@ -L4M00 40 0@\@K@ P*0 40\h\ , KYP, V,$0 D V* 04  Q0#03QP D0 0R 0S:Dx4 Z  @PK0@400  D`@pK00K aP Q, 0S:0$ R:X $0R *0S!* R 0S!$0 S: 0S* R 0S!, %*Q $ 00\*\0 5@pK00K #PR,0 R/*X $@pK0 00K P0D 0S*, , R 0S, %*0S05,0 5:$@pK0 00K P4`Z0J0 0  @  0 Q0] Q[:D RQ 0SD 5$50 5:J,D 0F 0RD $0 ( -L M04`p V `1Wp!V`!, K00 PdP,0@r 0 R0%0%0 0 T0,0 = 0S:*$WZ: 0Rc` (0S$ 0(6C0D0SG0=40 (0 r$ $ }x0S0x0h00Ch0  0l0, 0h Vl0 ,@ @ 0S:,00 0 $ X0 $ 00( cc40(040 $ x ;$,@ 0Vx0S0x0 lW> P0-L@P L0S40 ( 00S0@"T0(N -LMp0`\8`5@P0 0 ,P  -LMP$ Kp`@P* $ 0S $0S(0SLQW# 0 S xp0P 0$i$0U @p h000Ch0$?@PTU0 Sx 00h00Ch00$ 0$> -LT; -LMp KP`@|PT  *R 0T :800S$@ T: -L Mp(@Pᨪ 0`0k -LpP @`y00S0 W 0p0Bp$0$0$ 000 0-$P@0LS $P0hj0 -LM$@P0Sp  0$8iR `0 P000 !嗇0 eP 0 0000- 4 00 `0 P000x r0 yeP 000(0Q04p0 ie`e=: p-L M0@0CS0#0` P000 ;0 BeP0000h0SY00<埪p04 P0KPP =:k -L M P` @008#0   eP 0 004 00( ,` V0 4 p 0S @0S? "S 2C@L0DpS$(P 00Sh0(0h0(0  @0@` V0l l  e 0pp@uL0SU(P 00SK40p 040Dph0(0h0(0  @0@L R 0D0S  0ppL D0S R 8R 4 <004080$ 04 <0 80 $ 0 $=:p;; -LM`0p40 P@h@$U, ,@PT( ( $0,L H8040<  @0FT0D  PF T F0T0(@T;;0;H;x; -LM@0`p Pq+ W@T   ?C00cSP @TP ?C00cS <$;;; ;VUUU;<; -LEM,0,0 pK Ÿ(0"KoKⱮ(0!媮8@0P,0 0 004 0P  X' (04? Q  Q5 P (0&! 4!0B@@T  R R R 0 ,0S ,tR'0 ( 0"2@@ @T   R R  RXRPj,;>:8;H>:<;x;;;k;;H;\;tkTkx;;;; -X0X L1?0c1Q< 8 80 ?Rh鍆5>gfffkX>(j0@-0@Q 500CS h/h/8h/Dh/Dh/Dh/h/0SQXP  +a51"% !\00S0L Q ܯjX> -LQX>k -LM0 @w~1P 00  P , 0Bl 0 0l0   0B0 (  $50Sk/l/l/\l/\l/k/k/l/> R0ԑ00đ00 R010201000ܯjkX>NN -L$M0 0 4 S@P` 0QT, K(P`>,0 $@0\A $0 S:1\7*Z`!>=10K0  0 @BP $00 >=1Q1^:40`, R ,00C,0,(0,Z ``0K 0 0,0 @p` -L$M`4 :#:S$@>0. Q< "&0@ PD  H `0 KcP 0D0 8 0@PL@  1 0<S-*$<0Q*0 S^ 0S[$04 <S1$ (0 $Q0V)0K*)K jjVp:00L00 S  0<S:H`4@ DL V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )Kjp2V:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (X 0WPU`pW >0~pW  0h:#:S 0Q0S:SQ::K q   `PS8 6 $0 0&P 0SR  R ,0( 0C,0  ,ă  0 ` 0`K ?P000$DP r ,0 0R,0 $ 80SS SPT P: QS@@S. 0   000  : 0K 0 ,PH 10S     0@ |0 P80 J,0( 0C,0 : M,: VʥU]  R  /$0R+* ? & -LM`P @75 0S2 *S"*`R 0T)@PbT >0N@T 0UT$p  00 Q ^( KP(0 $ @D P _X -LM` P  0RL ``R >0. RB 0V?X<:SV8:$@0p P000 0 ^P0000 0P (0K 0 (PS1_0 )_=: -LM0S *"*R 0Q bQ >0Q 0\ $ 0@-@ *"*R  P b.P  P \ $@ -L *"*R 0Q& bQ >0Q 0\^ y/y/y/y/y/ z/z/ 0 $$ 0 a$ 0 0-LM*"*R 0\.@b\ >0\$ 0T!0 H,&R$P 4d 6R:`0S*#0  0P 00k -LM ʠ,ʠ\ 0R lR >0. R 0^ $ 0P  -0LS    $0` P P #  -L $ -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < ]P@<R0Q6 `0 @000d"Y0 `]P000@, $2 H)&R R 46S  @ ,  0W],0 0P@,|]\ 0 80S 0 @ T 0 < {<\ Trp 80S   |0@ 0  P 4 00 T|0 0 , :#:S 0*=:k -p| '6Jp0@@h`LA @HVT 0 S @T 0S0STk@-00S@(0 A R0  10  0  !( ( !@00C0(0 " R 0 000 0 !( ((  !  B 00 000000 R  0ktk|kk-00x0CSp00000 000   !!(0 7(0 !! 00C 0tkk 0-(0LP R0  10  0  !( ( !00C0(0(.00  @ PP0!!( 0(( !!` 000剱(0 D0 0!!( 0 ( !!0tkk|kk-(0 H R $1@ 000 0  !( ( !00C000S(0 R0000 0 00  00  !( ( !44000 R  0|kktkk@-0 .!( (@.!@N0@-0 @@$!( (P@@$!0@肳0k -LM P, 0 "X0P0 ZY2  P(PPk""Q0l0 tPpPh P U hY0  a0D"6!@AdA4  8 w0YDQ< <0 b40Zj801cT0@8 04j Xf4 "*p@0&08`  0>00 00>0 0 0P  P00( ,0d 0 @\00`T@H0LPXL@L  00 0 c8{44TktkX>1j;k51jk1jkX>$;P; -PL R: 00B 0 0 P k`; -LM,a> 0R^PA0 pW 0gS*@`0S:>0 N@ T *$PK0S J $2T:|ჲPh5*DD@p0>0>0 0X>1j1j;kl;; -LM␢0^@xRxŸH0ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UTZ 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0UX>Tkk;<; 0-LP@HP@ T0 -LM@P\# ^/T%*p`V \ 0S\\ 1`1 @0 0X¢T 0@P<04m(岢k`;;X>kk;;;P;l; -2L M0Z ! 0CZ pWpWal1Ό 00 hPP00 T Z !0Z00G Z, hPp0lp3qPU,  Q 0 0 00   #&p:h !0 0p h01 P#&:ph P!UDF Z,<0X ,00 oQocX>kTkW>1j; - LM T0\ , 0` @,pP 000 p:8 00\,1(/$0$lo*X>;k;(;4;Tk<; -L MS,0 `@a <0R0 @0R D0R{Z 0s , 0 Q00S(0QP (3$3T Q 3 Q ?`4` p4pT T吡 0!`V R0000 0   B (0 $00C$04 R (0 00  000 00 0 ,,0 Q0I(,0,  % `0  !( ( !4Q 0  !( ( !0 RnZ <(& :p hP00P%,   IF 0`,0 0 000`  !( ( !0001`VqT@TX0!`V0caV_QB)kkk lTkjT; -LMp\`P7X4 , 0` , %&:p hP00P%FF`c`  0p4 ` 000p  !( ( !000 #&:p h00$3 R 0 0 00 0   R0 00 0 0  !( ( !00C0, 0 0, Tk -(0LP4` V 0  !( ( ! |s #:p h $ R 0 0 00 0   R0 00 0 0  !( ( !V00C0, 0 0, (0 b R0 20  0  !( ( !4b00C0(0 h R  2` 000 0 !( ((  !  B 00@S 0  00C 0 R000!!( 0,( !!XJ00000PP0!!( 0(( !! , !(0 8(0!!0$ 0R00 L h% R t0V @T 0  !( ( !pWTkktk|kkX>k -pWL `At00TPPU pW(0&  0S 0$0!!( 0 ( !!0!!( 0 ( !!y(0 -aqL0$ R0hL0 2@ TPR818L@h R0000 0   B AP$ 0  !( ( !p0 0S0@@@ 0$ 0 l0$ m`0 R HX0<0S0@@@P 0 00 kTkkj -LM KH|D0 #Q :b 0Qc*0 lk p-L MP`@ 5@@@t0l l0@@X0X ET`@@1@0STpkW>kkk1j1j X> -L$Mp0 0 4 00 P$,P Ǡ,K 0 PP\`0 ܠ @T T 0  wv\x0  , X,@ 0P4D 04 8 00PjVJ0),kx;1j1j lTk;k -4!LM0pP? @0` P000 2v0 9TP0000 (0K@@ 0S|0  t ᾦ(PXjT@w(0@@w(@ 1jk=:kl1j -L4MD0 0H0 8K@ < P @00K@,0S00S*0K40 S80S0K0K0KP KPK 0S@pǏDf#VZU@D 0 0HPK0S@#&:@ D@A H1Y:`P Kp@YW,0S00SY< PP (0   0S) 0!!( 0 ( !!(0 0!!( 0 ( !!Y0P(QPK0`0p0D0 0!!( 0 ( !!40Sʪ80S -LM@p 0PP`  0S0P0hV^ 0PP@> U00R0S 0̠ W0U0V00S (0T 0 TV U0P0UA k V Z 0!6 P0 U00R0S  0 0b  0 0 -LMp0PU`% \ \ XJ (0C(0   0  !( ( !10PU0  $@0!!( 0C ( !! 0 !( 0 (  ! u(0  0   0!6 000 `0 0$A0 0 0uꨪ/k -LDM008 ;pBf 4Z00P#:0#UhKhKH PUHPU@0Z00 0!!( 0 ( !!PU ;X 00 dPU(0 @ Z00S zj0 !( 0 (  !0 !( 0@ (  !pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0kVUUU p-0LM 0`PT | `@ 0"s1 0V1`0 t @ ?CSD00D SD0\ ,00R0St lTkk;kVUUUk -ܐLMp J0`S' PS00U 008 0B6C0@4``TP,0X@~t84yt($J r0kkkkko; -LM pW     M W̠  |xVt6l@0@0S  \  R  Q 1 pW V 10 1 D0u(6 RcS 400C40   !!(0 6(0 !!(01001 PpURT%$10$1( 0şp00p0ӥ  1R0100T0@ 0S h p0S  4l h0R 0  !!( 0 (  !!`Tᢥ0X00 \ P0S P0KU q 00 PPP X W \0KQ0  @|SX41 `041P0P@ 0 K0KPXPP`P Q Wp  (0H@0!!( 0 ( !!(  R 00?   RM (0J@ F0K$ V  VC@00!!( 0 ( !!7s08! W8!  (0  0a} th0K @0 u 0@0!6 )X K vP 0  !!( 0 (  !!@@ 7  . 0 !6' 0P  0!6(0@@(T  H@010010P(10(1A,10,1kk -RLM101=@H@0T1A d0Sl0P1d0S@D 0 ^c@dlh0Pk 2@T YX `(  Z @ YX0S400C40 !!(0 6(0!!( pY 0P& X#v<1H0<1 0!6 YP 0!!( 0 ( !!I p0!!( 0 ( !!( Ip T00R00 S n<x0Pti101]kkktk|k -LM̡,Ơ@00 4 ( 0 S8 * TP'*0%Q :c 01cQq*`, @(0Z U:8Q0 < R@0RD 0Sq\80S80(0#40 0Q!0000 00C0(  $00C$00(000004, Q 4 , 0 0000 @@4 8 kkkkTk -`LM Vj3PP >0^P%&@8 |r 08S V# R 0SS:( 0Sa 4 0 { PxP$&R:0Ra03, 5:| 0 &R:0R03:0 S @,8 10lp1Q01c1(  P8 0*R0#  R 4 Q, Q\ , 1`@AdAP(0#40!Q0!0000 00C0(  $00C$0, 0 (0```, 00 P,0P0S ,0 0 0 < R@0RD 0S@p,c0 0kkkTkk -LM?@T> aqPQ0000 0!!( 0(( !! , !(0 8(0!!0000{0@v0$ 0R@0(0 L @TikTkkX> -@0LM@T 0( T  嘗@,X>; p-LB MLP@  , `  0`\TP`PXL `0`0<La`Pa 0`xp\` 0`8$ a`($a! 1`<0!,148!t0dx |0htld0dpk;;;L;;;;,;l;;;;0;p;;;;$;\;;Tk; 0- LM0PS0P 0PdP0P!\0PPPx@Tp 0@ \ P宏P L0 P妏0h(0jPjk1jk f;;1jk;;k ; p-LM@`TP 0U- @T0P\@00 0S 0  00 00 @0D4P H$l Q0`Dd`d00d0p0<S 0  00@T 0S\I1jk@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd01jk -X0LM\  0R \ @ TT000@I1j p-d0ML` @P0 K@ @WP0,d(4p嵔1j0;-X0^ P ($\,40\DP ^1j -EMLPM0,0 |$ tpJ0S S RP@,P `V FK@0D @P4 L$ p t H P@dd00C@S񟗑/4///p///80S|0# @J|3 ,0S p,xp,PP@ @\ 4XH P\SH00@d80S|00 0080S+  x\ =HBK@$@0$lPP@ 80S \H\HtR@0 RPP@ 0 K@\ pHPP@  xT} @yB~KpGpGG>K0C+kP@I mT1` P@d0SLBKAG>KA0C+kP@ 1` Y( PU! WpG 4 O#J6; 0oiP@An7$giP`@/DTU WpG Y|@"<0@d |4 j0X>|f@;L;j;`;1jk -L|Mܒ@0XpP 0 0MP@80S S @0X 00 K%$ H2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !ኔ0P C@\0PP@均 0R20X : %0H!000dh00h0$!T0,0 $4>0CFT0 0/P`d͒0 P 0K0 P@rp KT$;, PP@dT0 4P$Lxjaf8X>;kLj;;;;; p-LM0@( +($00`[P P000p(0; ( P $$4RPU@80S# 0@ P 00 st$h00bh0@GP mL0(,$004\GpP@ Hjk1j(; -L M @ 6@H$x/ -L M@ 0@H$x/ -LMXp$K4#&:@aP`! ($@Đ@b0O&#J86$;\ @ \@P0Oti0 0+400 P<ib H; -L,M< @@ |`dˌD N@D< 0RL 0 @_<00H@ 夛H 億 <L$@D? 8 ]4K 8K,0KIP40s Z<Ld  ?ቩ80P@f"pd7`T册P @ 0K0 @Dl`,X0L 2Wp`0"H0V@0, x$ 0^P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8彏  e$0 0e#&B;p@-$0Q:0!a61c"QPo * 000"F!V:Up -L4; -0PL  \hY\;0 4Dxkhk|; -LtMp 8\~  0S 00 0  ,0S(0 (0,0p0,<000\0= !K0  P(p0K\$1 00 00P0 X0S(0 (0,0p0,<0 zg0 00pg|0 !b  K0 P (P0`@㕁@ ⒕#1)|0 d0!b1Qx H劎0@ 000e cxk lafhd;;000 0-LM0@C^/<0 0P<0 0 0h000  0S 00000  ( R,0,0,0 0 00 f0 0-LM0P- 00@H000 W0S @0000p e0S0 Sj0    (Q,0,0,00 000hf嶌;; p-LM`@P倘V00D  0S0S  ( R,0,0,0  00pfp凌; M-LM t KP00K @@ P P P ,?0@PKp0@@0pKt0S@#&: pKPo`DFᤀ#oXQ P  t 0 R 0S t@PU `V$ xpRPUPUt`P ` l 0U0Q00S@pQ  T X0 Pn Q$ x0RPP P 0|@S:pR 0S*P (0A 0 Spp X  P 0R@Kt_  (00Qភ (0 0!!( 0 ( !!ᇗN$;`;;   D0 0!!( 0 ( !! !!(0 0(0!!(010# 0!!( 0 ( !!Fr @p p 倀KhKtl l Kp0KwP P pp0Wp 0RXvl0P@, Yj (0d0  !!( 0 (  !!( M0  !!( 0 (  !!< ⬀  (00Q p0P 0: Y Yۖ  CA (0 0!!( 0 ( !!ϖ.Pd0tpS@\ ,0St    0pS{ Xw0KtH q `X ,0 St  Qʪ0@SPKt,s(0(0 K@:U0Sʌ@TP t0S @t 0000$btP0St`0 tp=0fd0pKK頀KtP6 0|S):R% 0S!*0  !!( 0 (  !! K @K @0S!`pKtP 0!!( 0 ( !! K@:0S@TP`U p-LM P 0R 0Rp@8 @0`<P` P0Sp; -LM -LM@H 000 0p`P W 4 1 s @:Pp` W400\ 0:P, 0W 0  040 (0!0  !!( 0 (  !!0,00 1 0p`P P 1S @:Pp` W W 0 @  \0  , ( (0!0!!( 0 ( !!, !\ 00!!( 0 ( !!,!0aV\, 7 \ ,K 02P@,0 !( 0@ (   !,,01 ,(00  !!( 0 (  !!, b,;; -L4M@00# T p` Ẁ"0 $a0 0S 0S RT `P00SX 0X 0R0v T 0 SX0pP0 0 0S*pe0崡@@0K`P KH  4 Lp D 0 8p , `PK 0S?0HK  0 0P@/ U8 W00W00SbP R00Q0#02SXTj0 0C0 S U[bX0 a4[  0HK  0 <PP TX ; l -0 `VL@0 P UDp0b000     l -L M0 p` 0S 0S0000Pt p-L MP >1a@0TH U( T0S% (@T@T 01 PQ0S 0@Tph >0  (Q,0,0, 0<00 R   0000S0@ hkxkpk0S@-+@,  0 000@܈;hX>dX> RQ-L 0P0000 P 00S000x; RQ-L P P 00S00000SY$; -L@M\TK K < 4 <#:0K [0*":("0009L; 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000t; -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0:P\ 0R,0  0S0sJ 0SI R 0S0S0S NAP5 02,\ ,48 <#R: DP, 00P @0  0,\,, P , #010く/dl l|k -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#h]\ ,,00@gP c1a`PX UPE000P:Pp 48<#h.\ d,,00@8P`BDP p H>H>H>H>|k -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K Pk H0, ,pLK P L0S10L0 (0 S h($jH0S<0H0 H,0sS$[ 00S40S80S0 0@@P0,0S 00S 40S80SQ  l0` x0cl R+<4< 4l :0 l 31j;8[f -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S ,i R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  pP@0S X 3S@0S<0S80S40S ,@K pPZ 3 SP0\ 0RP0 L,@K pPT pP(HKsj;t>:.+\f?: p-LM`P@ P3W00P3,@0 p p-LM`P@ PW00P3@0 p -LPM✡0``PKpDKA(0 d` VV:?:;;;; 0-@ L,nPP 40 <0%uU800C800 p-0LM@PT` 0 oPPUʜ@TU p mP 40 <0% 800C80phBdlQ@- 0`SP*0SP:P *0SB  RP *R 0S2 P*0SP: -LMhP0ppU,0 @`X 88Q ,8Q  8Q8 T 8T 88T*8T7 T 7T 7T 7T7T*7T 7T7 T Q 0Sl 7TBx7T<*|7T .d7T" T7T{ X7T L7T u,7T U $1S-,0 S ,dg d0lY PpaP> K`PU P >4K40[S2 Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P z[P 0S \00\0]OK K[PpQ|幂L5T <5T5` (K``-U P K0[ pS (K@K K 1 0 1\K%[Pp 0P WY [\00CS\0H4T? !<4T 44T8 r 10aR001#0p 10bP001#0003T 3TU @T1. ^mUy @T1 q8#0000q#0000O|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S + 00SP 5#$0$  R 5R00%"48<#P g|1T @1D1^L1T\1T* 1VL1T T:@10SPW  0dn 1T3匁e MHaWu 0Q0 T 0Q0Q*00Q 0jliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i ;$;Ri Ii Qi Si Ti 5>i Gi Mi >iP;Ni0WiHPi Oi Ji(Ki -9LAMpWP0, ` 1 $ 5 -0S S/cH0SVE Q> HP`PP ,蜠K E 0[S -0S h@ 0 SR8 RV5 H0S |0SH|0[Sk q0(0000q(00 00 0PP  Ld00d 7P 0 0Y0  ǟ,0 S ,ejP0005S Y _P d0 RK5S5$#Ġ0Č7K7K4x@Kl p0 lK0.KK0KtP P 0S0 0F0$ dKS\K0HKd0KcKStƟ@K.44HKHK GK3K0P jP@  lP 80S0C80ž@T 80S0C80ŝ .K[PL 00S 00$105 H0KZ Ph RtşP.DD0HK CKH0KGK0P NjP@7  kP 80S0C80A@T( 80S0C80 .K P 0S0 00$10Cp4 R() c(0  `jGOK@pRHK dK  $ğ(P0Q Q LlP  pj .KP 00S 00$|3 R )  (0xxOj^@K@6RPß HK( dK0 lP  I 6j=2 R (0 Y hK IkP 000 ` mP0 02 R 0D aPa 1 R0 1 0 N GCVD  3P`7q 00( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`E U 0 R 0 R 0[S0[0S[Q5#$0$)K%"48<#Q #PSj]f5>;>:>:صjĵj>:;; ;x;dl;; p-LM@ PgQ0 `0S R Q0000S ph )mP0`00 0(0 `~8; p-LM@P R0000 0P @`U00 0S S @0S SS00h0S0@ R \00C\0 0@ 0 X 0S0C 0 ph+i K~dl;; 0- LQP 0 @R T0h c -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,Vb0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`KxxP  wP KsPU00  3  R0TK\0KhP 0@ X: !xK UPU0h0  d  P` 0@QP@0pS0S 12XKOK.P0)v2Xq  SK $P0T1 `V OK0 S `VT\ PT< PU p ` 0S0C 0 00 R 0PV PpP?g0ST PU p ` 0S0C 0 00 0@0S00PVPpPg{P3j;@-|0\ 0S \ Q @ 0 0R 0 0^@0 0P3j 0-hP@LP 0S P 6/0 0@0 S00 0P3j -p0LM@T 0S @T P P R0600 hY0P3j -LIMp`0,0 +00 P 0SvP,6 /P`g 0 0 PU 0SPU6'0 100,0 S ,_0SU P 0 0 0R 0OK`0`0NMK$A0K<0A1T (K 000Si:  R0600 / 0S0C 0 6fS/K 700SP` V gP 00 0 `j<;1i -LJMp0P 0 0`0CS 0 Z 0S d_E: R000  R 0CS  NKMJK00<0 K 0-K $6s/ejL;2i -pL@P 6 .`V70 0 @T6@ N/ -LM@P6A/ P RP0S0S 00S0 0- @LTP 0S@T00S ZfP@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\|Xf1jhXf -LM0@S S  fPP P 0P P P0P P>: -LM@PPP  0-P0L@T P0 eP0@T00dl-P* 003P: 00 ? >-RALQBp`Ly ePUe 0 S\D@ @\P0 S j0?:;; -L M`4 X, 0 2PU8 S@OT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZy0Xjkk<[f; -LM{, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP:,0SW y  Pp0<[f -LM@ @0T0  0 R @T0K aJ%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* PXjXf 0- LP + @ + 0 0+00d90 -LM@~9 i, f, hb, -LpMpxPK0@X 0 eJ" x0 p`K. c  YJ0 00   00#0 Q  [jĵjصj ; p-LM P\ 0S \pQ  R X00G\`@M \K GP @P ;PTT LcP  FcP T# T 00#0  p  2cP00 0  00  0 00   I%PP ʐPPT@#XfXf -LM@pPPT T ~PD P1@T T sP, @T:Pa0S( w0S 0 @ `( PpP@ P`pv(w0 h`0S h(0( v@`0S(0( < `0S(   Xj]f;T;;;;; -LMtP0夀K@(x,0 QI  c5%#000K$2 8K4 KK 0 n qT`K@@0  \0K[ K@ 0@ 4@  QPI@<P 5X0S0 000AK`IQ @K@KKKK 1 !0 1\ڸ0[00K [ K  OP ,0 S ,Z OP/P t0 R0 T?v KP ,0 R 0vj>:0;]fH;; -L|MPK0`x@(p$0 H nbLKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$8Z80 0\0uj?:>:;]f; -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ b [000[S  A0BS 000S |@KX&HK  [PK!H00l0 0 %"4 4  0 H$0 S $Ylj ; p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S YpDu'X0S 58J0 R (  x0 R kPSH,KvPPj]f,;d;t;Xf>: -L0MԢ0p(0 8 PU 0` RP U PU `0S6 VPDPKXBq8tG:;dl]f; -LMP\@`pm:,KF<4(<"4&<,0 %pK RW RN 00 0 p1W6 W- 11!1!2["[[2[UT 0S @TP00U00S 0d^!0 ^00S`n (8#P @ @0N ^"J0 0 0 1!1!1 ^ Z J0 0^Z0 (8#P @@^J0^ZX (8#P @@~0,$!PUV r @TPUVV~<8# (8#P @@ ~0,$`FD!0 ^!^00S`n (8#P @ @0N ^"J0 0 0 1!1!1 ^ Z J0 0^Z0 (8#P @@^J0^ZX (8#P @@~0,$!v~ 0q~ 0d00S S00S 00S S 00S  rr;; -L@PQ@`p P 0S}0Sz0Sw 0StQ 0S0S0S 0S P P2 uQ Q ^g \ POVI R  H^P  80S0C8070 0R <0SD0 0  00 R  Y RA00@0 P@ 00@@T m\ \100 %6PP <P@@@T10RP P@0S  48<#P00S SwPt @0 R,0 P000Sb4D>,D> -QLMp@ ,  0 S  P x3 Y 0 S   0 S  R 0S Wh PUe 0S/ , YRAAZ 0 S R,002P@  0 @S? 400S; P 80S0C80100P[P 40 80S0C8000A \<5P@,@ <80S0C800A0 \ \ -]P X `V 40 0SD 80S0C80<0`0V PC` oXW 0Su`V <Y VAW,` i Pf Pc 5`5SA\80S0C8000`[[  \P` ` 0\0R00S4 Y:04D>Tk -LMPP 0SQ1 0 [fp@-@P`U RD R p00S SV 0S 0S ^ 0!$$ UV Q P 0 Rx0 Qp8#8#$0$  R R 5#$0$00S4D>,D>0@-@P00 R# R 00P P "48<# \0 R P0 Q U 5S00000S,D>4D> R R00S S0000S -LMp@ 0R0%` J:V* 0 0QR0%` .:V PEU@ R U00SR   bWp P`U@@0 ş,0K ဤPp` , 0R0%` *(0K oPp` ( 0R0%` *okP;080<0k -L$M4 0 8 ` 0L < S d:X YH PZ 40P80S0C80Iڜ)000IS6 P VP @P H  0$ 0 "48<#8f )H0@\ 1 x 0@0S(008Q8 R*H8pW  048< S  8pW0<0 T8 RH0Sa*0H00 #PpW L pp 048<@x 0  @K( J0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 t@ D0 0Sh@ R@T 0 00SCZ @@$ "P   04 8<00 <$ 0\0  0@4<2D   L008,0@#2Q,6   0R0Q00S@T  0S@T Q  0cPT 0  0cPş000D ` VD @ 0S0@T 0"R@ 8 T8P 0S P0S"Z @0`C"0(0C8#88#$(," @"(  -J( )J8 0VJ* @80 0 B0 8SD 00b#0"00C080! S P 0P U8 #H0@\ 1 0@804 `f$ß00;8 PP j8: "Ÿ0D 0b0i""00C0H R 1 0@Ÿ@08 蟝-@Ÿ00P% 000="R R:0`P0"@ @IPE( }I0 0@8 @ D 0SLhI[Y0S( 5TYP2Wb208 HQ 1 0@80zHP1?0  06IW "YP E,0K8 ޡP<080  , 0R0% *0lX3jT3jkt3j([fkk$[fk,kkP; -PLUp `2X !@@H( H0 !Z P$4D 00b0! 00C0͜kk0 0   00 80<808 8<<80808 < -LM:60aS00 8PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0S00ؽ oս 0@<bt3jkkk$[fk -造L0S `P00巽80S Hp`80@@80Sͽ00m颽t3jkk -L?+(0[ 0 [0T[fd[f[f[fQ0-4 $Q Q(0 `0P@ 0R@j0\j0dj0lj0tj0 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  P @0 S00 0k[f<; -L M0p`@A P0p`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) P,0:S @0 40 RP0MSy 0Po:0 00C0 0 XX 10000 00SZ:XN 4 mG iG R= R1  R) R <4(<"4'<(#,(` ## 0P `@0P`(`? 00S S00000S 00S S0 0 0 00S`1 RLL!Dk00 Mcᥜ1P@  0R0% :P 0 SR0]0P@ 00K 㝟P 0 0R0% * V' UV$ (㵜Pjk]f\;ykkkP; -L$M8 4 8 p0Qg ! 0@40X@0  0 S@@%` :V :4 0sPP0,!!-0@0S ʀS S cS( ; R4 0P804K~h @@ @40 08S0j4P 1  0@Y q0q0q0q0r04:P@ 40S 1 0@4 444 S S4P 1 ( 0@Y YY4P 1 0@Y Y4x4u40S 1 0 0@4eS>ʂS400S 1 @0@YX X(S 40S 1 x 0@4(0P<  ();4$)<4 垙840S1 p <8^400S 1 0@X400S 1 8 0@Y> 0'4婙P4< 4 < P 0X < 1 0 SQ*<0ᬘP< D 1<:)01<@<14@0D@ 1\@D( @< ;<0 0 0g(00 ՚<(P<0~ S00  ƟA.L` BP`0@<`4Pt4@4 <@ 0<  S D  :00K< ÝP<  0 0R0% *hS ʇSi FS" St400S 1 h 0@Y'XDL%4 0P<   f4 )400S 1 ` 0@YX#$4 0P<   7D4 7400S 1 P 0@YcX@$4 0̘P<   h="4 c=400S 1 X 0@YAX#4 0㪘P<   g44 b4S 0CSd30S X X8#40㊘P< < < R ß `LP`0@<(`> Y40P< < Μ< 2 D ( 4P@@ U P: :D00:D@ 48:4 <1@:)0144P4<D<400P PDs0(0YXh400S 1 H 0@YXGX!4 0P<   ;h4 ;1 R!4`P0@0S 1  0@4@U 0g0P@ <,0K _P`4  , 0R0%` *H `P8tgk]fx;kʚ; kkt[fĵjصjk;kP; -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,K 0KPp  0R0% * 0 S0% :X dK90\ d0Kc K\@Kl # dK0L UPS@@KHK90 H0KGKC HK 00 <P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 Rᩖff\@K  B 0K0 ZPpr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0K5Pp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0KPp  0R0% *+ 0KPp@  0R0%@ *<V0K0 ޚPp  00R0% *$0P@ \ ejk;kXf]f;P; -L M@0(  $( ,<4<,4"|P@UU110SPHDPK80 C0KD K<`K0SG  P, 40" T0X0SS<1 R \0R:1  R' \0R$*W*0P@ XpP 80S0C80ڔ0@T @T (0S `(J\0W00S0%" Kj[f[f[fk[f; -%LDM0PTP ,0 0 S80\0 `P dP @`p K:X HK@h@ 80@K hG0KHK8HKP@0[S CU@4 ,0S ,I?0[0S 0D0gCT#̅0̅0000SY 0S ST Y @0K@ [R R h@K QH0KPd0 T T Tzꀆ0x0p0|0<0\0 EPP5 1:)0100+\ 40R0 Rw1 \00 0( 70(p 7TX00000000s00Ẕx00004XK X0 q700 00880"000` PU 0S0 00 M8 00 2T 0 8 `0< 0@\ `0 < \ T Kd08 P\ u;r1 f!1 ?0[0S SO1L 0S5#$0$#KD?0[0S>Y ` C . 1  HPP 0S 0S 0 0R0%0 0":d0 d R  0 dP %P P0K P`d  P 0R0%0 *0L0K ϘP` L 0R0% *cj(;ĵjصjt[fP; -RL M@pKPPTX 0U0 0 @p  6 P`{0W0,0  Y pz*0.Sp Q:W000 p,  VP* YN* Qp *0S .S  Yp*0S .S0, 0SN*0G>SKpA @a0@RSD0SA La0LRS00L S:W@A @a0@RS PA@0@ \-P+^pGPĔĄ``W Y *0.S,0V* Q:0 0, S*00S0C00  00 S000C00 00c 0XR 0 1^ -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S NP0pi0\0jS\ 0jSg NP -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P ~NP040 Xj -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 &PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K4  400S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 Xj5> -#L4M0P,0 0pT0 Pp 0R0% :Z. HK40H0KT0 0G Kc HKX0 l@T9 h0 @@TW1 h 20S'Q@HKLP0 NPᤑPP x2 ,0S p,F閑@LH@0S  P K; ႑2P@ r0:S,0S00S40S80S T , bMP0S 0S$0S(0S X PMPQ 0"0 # W $!0{P h 00S! ْ@P0LHK ֢P  ,PP0P0 pi$@L֡@0S   P K L0K ЕPP7 L 0R0% 0*`jl4;kʚ;P; -((LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0 < <K3P` K`KPK< Kk 0K@K w3K`KPK  Y 0 6@T 0  LP0 @T0[Sq RF  <` 0: 0000@S1`6   0:( @@Y 401K<1 0@}P Q 1 0@Q 1 0C0@\ 񟗗`00 0$0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000<0T0l0000̜00000S 1 0@\ 3 ,0S ,#D0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K 2KK0  tP 80S0C80 R01 R/|K0 Z_I0[0S1@  TȠ |0P*^TPK(@L0( ᫐ 00@S*PL ( 1@0 R 4@40(0@_jdl[fH;]fX;;;Y -LM@P~`{px @0 1`x3j; -&LAM0p,0 `@0PK :Z - L6 R @6 R 0R0%P s:Ui  K:K :0[SU 0[SI 0[S 5 Rş@0 胎5 ,0S ,BK| ^0[0S0S @5 R K 0 0^H@K10@K KG0KHK1 HP` 0P 0S 4 R80S0C80űIK KKU f^@K )JP80S0C80ž0[`S 0[@S KK JP00  3 R K KK)NK(H( / Pz!R0 ! 僑Q Y0 00 S T3 R` KK@ KKY0PI 0P^O !@! 0K@h& !R3삟! M20SPAdPK@K0`K|0y00KxK c0KdK0K0KKKp0\KK l0KK h0FK !0@HP@KW0KK0 0KKR0 MYH1 R K KK ]0[0S@@RT1 R K KKd9H= 1 R K@ KKw 0 ]0 R K KKi0[0S5#$0$.K0[0S5#$0$-K0P@ E?K P p P  0R0%P {*L]j[f`[f]fk;;X;;;0;[f[f$0;;;<;kP; -&L0R@ /!0 0P` a 000 ᰍPU60Sn 0Sd 0SZ 0SP !@( B("("48

-LM, 0PR* L0Qڂ, 0S*@Dp`@40x 4@T4<@0 ,0H 4 800 _,5>[f -LD\f -LM 㤇P4 @ dB!2b2c621b1c00Sڜ0P*0 R 04P:l0l  h\ dB!2b2c621b1c1\ 0MYXfkZf\fLl; -4@LM, c:0hc:l'1> p-LMdP0S `Ϊ@T 0 S00 00C0嚪T 0SpLl - LM(080 0 4 !@ ) 0 S͟'="͟'=P@ 0S ! 0@4`P0@ 'R`00`S ,0@0S1  0@40p10 P  R0S 0S$0S+0@0S 1 0@0S 0S 0S0s R0S 0s P# 8+40@0S 1 8 0@40S 1  0@4 00S 0S0S0SS 0S0S 0S$0SG 4 5  R6 R)  R  R  R R R R 5 \ \q y0S 40WP 9P@ 80S0C80E00X *0 0<  449  u?Q 400S  9 R  04,0 PU 4, (0AS:(Q 0S{ a(ᒉ40Sm @0Sf `0S 0S0sO 0S0S 0sF 4ȟ0@Z 1 @ 0@7@U wgHL0 S4K8K @T480\ ǟ011 7PP0@0S 1 0 P@04 &0@0S1  H@ Rx ,04 (00&0@,K0K4 K80KP~4` 04$,0S!$&0@0S 1 8 0@40S 1  0@4 0 0)S0(P 00Ps+ 5 R0@0 %5P@ <0K( ۋP4  < 0R0% *:0%40@0S1 8 <0X R@04 1910  @ 4 R @ 0WA  BP,$0YL4P@ 0S 1 0@40 P 0S#Pß0@ R p L0@0S 1 80@00S0SP@ T  BP@4T00S;P0@0 40j04 00S S" !48<#,#80 400S 00S S !48<#,#8 0 4 00S00S S 04 1P@ H00S 00S S 04 00S4 5"00S[1@X{(pD P4 D!0@W 1  0@00Sl> @ 0T  # 0@05S1#=#=`Uk\klkLkpl<ltl|lll[fk0[fXfkkkk]f;4ltkkhjP; -LM p04`(0@S1!(P3T /+T T `V 0S,0K う3T+0[+0[11,@[PZ0S (0K n&0[S'0[(@[1P <T -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( PP 0 0R0% *,0K( PP , 0R0% *UkP; -RL M`p40 @0S SP V g* }pP P`eV@1P@ SN SVZAP 0/0K '00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*KT'"[P"48<4 #8V0PˆʎkLk -0L0@Sp S tS S 0@ 0S 1  \0 @0`P``0Lk -L$Mh0L ,0 @ /  DK)0D —L PhhL  0Q^ 7 0(@3T TT +T-  PPA p3T0000aa 0V43T !T +Th0 3  )0ㅗL PL @(2 ,0S ,Z8<Th0 2  )0eL0P̓1P@ <T (eP@  00Qh0 1  )0@0LS0L  L 奃h 048<,Ơ0ŒHK)0= H $L0PhhL b@PK I&@ [R! R Z 0Sh0.  )00 L0PhhL .?0[0S S #K?0[0Sj,;k -LM$0K@ p@3T#0[#0[00QQqPU@T ` `U*0 % Pǂ1`@(Q( R0,S  3S00! 00!R0 -L8MqP@ `PY 1 \ 3RC @,R/ )R R 0 S  ^70\:L0K ̃VL0[0K0[ 0QR+R(@\:H0K( 㹃VB0[ 0@\:T0K 㭃%[h00SV T0[<R0\:L0K 㜃VL0[0K0[ 0Q Rj<;H; p-SLPMPK0`@0%0PP@ ppp p-L MQ@`; 0BS'0000080808080808080808080800808080X00  ph@$U p h2 0PphR$-p,R 04pj#p( 0 phE#p`;k\f8?: -LM1p 0S 0 S- 0 S*0 S'0 S$X8儨h@0  Po00@0( *R0S 0o*0C0 MRM.0'Z`, 0S 40 G0S 7P 80S0C80Śdǟ00PP (900<'\0@0 V  0P6000 0@<TT h  0 @0 <0S 1 8  0 @D&DƟD0 0SV 0 x6 R 6P 40 80S0C80ş007<00@ (  0 <0( Q00<!0 R \0R:1  R \0R*P&\ 1 0@V 0<!0 R \0R:1  R \0R*0 \00 400,0 0\Z \4 R 0@55 R R  R R 0 0<,0 Pi 0 <0S 1 X0@x3P@ VV A\ I80X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0X0@0X0X0X0X0X0X0X0X0X0X0X0X0X0X0@0X0X0X0X0X0X0X0X0X0X0Y  0y   040 0@<0S 1 H 0@Y  0@V00S Sh000d00S^ 00S ST0 0 0P 00SJ (P0<; 0 \0P;b@W,00S00 , ,@ <P, m P 80S0C80ڌ00x", 00,0   lP, De78 \N=:@k,[fP[f5>p;tlllplTk[f;[fk|l -LM\ϟ , `0 0  xK0 +봠K"X p̠ P ` ,Q0Q 4QXQ0@S @0S 0@0S 0@|0(S 0@0fT0S0`0(@CT00:U KPppP0K` P| R U 00|  |0 <000S U 0 0   000S U 0< 0   00P$ U 0+ 0 0  P P0S@ B+ " B!xK B@D 0S 0S0S0S/ 0S, 4 @00 S X  40S8 X  \\0 $(;0S00 0S 0 :#,8#$ " "4"0 X 0s0 0h@K!0  `Kg0K*hKKK 0P0S L0P@ 0 0S 1 P0@ R \! X 0S 400  \1<1  QKx0K@K@PE \ X `0S \ 5@   R R R R @ R R R R RpX j d0g Q !0 RN \0RK*^"(<~LKP L0KR ȟ,0 S ,2LP 80S0C808LP0SQ  ^  0 \: 04 P<4(<"4\  0b0C0 S 0 ڀ0S   0S   0S ,0 0   ,0000 S/0S 1 `0@p00 }W Z0 JpYZkx6P@ c}|Pp 1 :)0 1 6 (@PP ) @  0K_P n 0b8#8 #00S!$ 00l0  04<#$ 0 @ 0D8#8#$(,""(  0}P4 0 S  0S000 0" ##<0 p 0@R 1 p 0@KP wF8@07 I4P@ A0(S 1h 0@1  R \0R*0S\0\1@0100 K! 0KP1 @01 v00S Sm000i00Sc 00S SY0 0 0U 00SO00S SD0"410 0S;900S3 00S S) 0 00S X `0S ̠  1<<1P 1 0@5S!`P0@P 1 X 0@3 P 0SP0S 5 0S00S0SP@ T  48P@P 0S  Z 0S_e1P AP 0S1X@0P@ jk;4kHjTk[flk;0S R(0   0LKLK  T@0- {{{|{8#8#$(,""( I KF PppP" |K ! P  K !P  K !P  K !P xK  R-LPp`zP@ U V P  N@${1A{7 -LMPpU!zP` @0 0P<4(<"4!< (K= 0  0007P 0 @0` 0 @ ZnzPP z1 U   0@/{`P0 0 000"{P p-(RLMP`'0@S @0S1P  00 0 0 0p%zP  0 0 7p( B(0%{P -LMP@Pp ,  ` P 40V80S0C80O00P0 0 5P& U4D> p-LMP`@s U  U U -p0 0V0 0pL0 0 0V00V 0 Q50[f -PLM@  R5hfQ0000S  -LMQP`p@8 PT  jP!0S+ ^ ^&@0 \ LP \)P 0000   bQ Q P P -LMP `@p  \0NSU\ #0NS1 1 1 1 1 1 11 1 1 1111111 1 1 1 1 1 1 1 1 1110N+S񟗎x11 1D11D1111111111111111111111x11 1D11D111111111111T2.^2 Q.^ U 0S(0S%0S" 0SD4 Q*Q ,4 Q Q{ P  70S 0S0S0S0S 0ST0S`0U0/^00ST0 S*RI T0 T T0S S /R0S 0S0S0S 0S S 0S0{ oP  00S2 R 2 Q <4<("4 <0R T1 Ty00Tu1{ =P, R Tw Ta00QT\#^ ^ { P 40S0X2^T T= 0T80S5R3 10S.3`{ P436T0 S\7TQ 0Sd00d00d0,D>4D> 0-0LP@ rP8 1 0'S(sP-  P$ P P P  00h00S S00000S 00S S0 0 0 00S0ʚ; - 0@(SpL@pPU`( 1:)0100`0 (0( B0 @ @Tq7P,0 S00!00S00!40XS00!P00! p-LM`@ 0PR $:P 0S0 0! p0e0 @P00 Nhd@0P 0K uP`  0R0% * @LkkP; p-T0T@LMK`` 00P` 0,@p7j7j7j p-LMP_ @5`#Ġ0Č ,P 00S q뀸D #211@,0($ph$(d]fQ7j 0-0|%L"4 40`P%@"4 40$0S 0,P 00S 0h7d]ft]f -LM 0R @`P :U  0S hp 00S0S9 S1@0S 00S$ P 0S P0S 00S0 0 00SP` V 1,P`$(5#$(,""( 50S 0S0S0Sn 0S 00S^ P 0SP0SP  ā,448!#8?As\5#$0$ `V pp +P`V 00S0S 0S0S0S  +PX (0S S0 (  n0$0(5#$(,""( 0Sd0P@ $0K [tP@P$ $ 0R0%P *v?Qd]f7jkP; -pL0P@S 0 @TP  0`@VPTV ( R  BR(  U` PV mT 0`@VT$7jdl -LMP8 P`z 0`nPpq XnP @@0( 0 @ V  0: `000  Xm  0 0@8PPPPPPPP 0SN ( :04PK 40 80@!! 4 0@Y0K 1 0@8Q" ʂQ V00  Y1   0@80SY 1 B/Y1 , 00S P P Tnt>:k7j -LMP 0 0 0 RT@00 DD<00aah h>]f7jll?1>@; 0-|LP 8a00X0@  0@0?040: "# ? 0 00uMb|! -LMX0@S\00 `Q( \H 0@0 \hM>\ 0R 0l;Xfv p-LM`@(P0V00@ 0`p -PLM \ Q @T0 S *01 0 S00@ 0(=;; p-PLM@PdW 0SS 0SLapP: 0BS(#1#1H$1#1#1 1S 0S0P U 0S p@0 \ ==0S |  1S$0SL `@0P`(`3p Y=;]f;]fk8;T;k; p-LM@P0U`$L0_@ $0 00 bph鱎 00>5> -LM@ˎ 0 S  i阎PUq <`Vm H1Q p QgWh 1S &1&1&1&1X'11 Q Q 0 0<   B0041 ,1Ba  0 0S 01 00 0S \ 00001 0 x0Baa0 L0 Q000< (< <;]f>Mb]f]f;;; p-LM3P `HD1D!00 01@T Q 1 Q::@T0Q P@| 0 0b S&p 0 0bS00000T0@T 8| `0H  a R@Tph龍@귽@'1l]f>l5>dl]f p-LMxaPP $0@SQ TP $0@SBT$1 R `0S@2 T  5Q' 0 R0 R@0S S P 0 R 0S \ 0 \p 5R\`1 0S# 0Sl]fl[f [f]f -L0M졟0D`KPp(0 >]fd; -PLM0@) 4 00 S H^ 00S 0S1ST0t 00S0 S! <0H  0hQ  P]f> -LM40 , P`0Hp< ,0S ,P40 V V V40 #50W00S 0 X$d(X00W050 40 50S ( D:0SX0؅0ʅ5؁0ʁW< PpH ßC0 0 0< $P V0a0 0140X#;40p0p <dP@)  `i00V01 Y  Y002 Rp 2@ T< j 0S0C 0 00 0@@`$40 [ `>0@15SQ 1>1p>1|>1d>10S Y T 1S @1 R41 R!10YX 00SYX  m 00 e R 0`a0 0@X00@Y "P,  ``6t;[f [f>]f; -L( p0aa0PU 1@ R 0"%>CSd0PUh߇@0  ;00 ?0#3 0?1l>Xj]fMb -L M0`S, P@ pF PC V 40 40T 40 }PqTZ!1  ,  0  0ɻ 0 @@R6pY f5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@e00@!@10 r!01 !1 0 g! P@ H0pkPAp@Ppd0S @40b} @0  d@PZ  P@` 80< 0CR80E;>Mb]f]fX0GS S S5SS ʇSS S p-LM@!`\ XP P cep3000  00  00pQ 0 0S X{6JepPU( (n6 p;; -SLMpP@` R00Q00S3R`U-  !P$ W W *`X  c0X0P00S` U  `   -L Mp, q0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4#0w0 0D D W001100 %!l -LM, 4 0 (, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 <ƅ8< @ P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  08#X᭹ 84]fL; -LM\0@,0 `p XK hK 0R60帐 0 弐 Đ 0% P@ i:T_ `xK 0S@ u0S.0Sş@0 c,0 S |,8XK_h 30S hKVH 3(50S xKL$ 3EPB @(03X0ST0SP0SL0S&[4R t0S 3d0S`0S\0[Sx0[S S pG@K ZP R010 0S  0S 0S 0Y0R00Sh0[ xKSppҸP`z K0P@BY Y0 00 S 8s0S[ xKи Y0@4W3PXK PL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-hŸXK%P"Ġ0 0Č2 XKx KKX0ST0SP0SL0SXKr 2H@KxK@K0 H0KGKP@ 40  00 R TVe P` 0  p0S 0 R 2w0[0S5#$0$'Kp0S0P@ 0K 3gPĀ@  0R0%@ *HN2j[f]fkp;;;;;;0;>:p;;;;kP; -LMPK 0 , 0S Y0 00@@aP d00S#X U 0S @00 0 pp    0@00 :0` d`K0HK@ 0U H0Kc KG Kd0K\PK  0S^ R 0(S@@K  0KKHP @@K  (` x0(0     0   Ru Ri  RI 0@#$(,""( :( @@ᗽ $ 0^0K K@@Z 1`P 0@ 0@@@0 \ 80S0C801 ,0S , N P Y@ 0 @@ 0P 0'1 0 Y @ @  00S S0 0 0 00S,1 R P 80S0C80?a޶0 h1TD  ẶPM=@@@KG5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 `1@`jHj,k,;]f<; -LplM0@,0 `P<K  0S㈠ # d6 RXƟ@0 `,6 ,0S $,Mt@q P(0 0 0R0%@ ]:TS LPK   048L[<# #3 0P| 0  5 P' \ Q <0[S  `Ft@K Pl  R010 P 0# 0Z Y0  00S 4 R  Y0@l0{ P` HPU 0@T 1SBY Z00RX Y Q' 0 S!|P40040 @R@ 0 ` @ 40 <0T# 0 01(#(30Z  0SgQJZ\T\00Z00S?Z |!0 R00S| @x@<P  GX2 R<@ 0S 0 S  1" 0 \Z\ 1!0Z Y00Y  p1S, !x1p!0 8"Y  P1 R $/0 R /0 R " /K0[0S S5#$0$$KK0[0S0P@ x0K dP p @ x 0R0%@ *88/j]fk|;;;;>]f[f,;X;;kP; -LM  PK ,  Y0 00@@x^0P0 d00SX 0S  @00 0d@Kpp0\`K00 :0` 0 HKHKdKP cKGKQRS 5,#04%KKT P0 X @  PK K 0K 2P @K  (`w0(0P 0  R R  R 0Sx 0Sl  ^R N0@#$(,"̠*"(** :( @@q 40K K0@@Y 1`P 0@ 0@@0 \ 80S0C80ڜ1 ,0S , *Y@ 0 @@ 0P 01 0 Y @@ Y0 R0000  @ 00S Sv0 0 0r 00Sl0 R P 80S0C80^ᳳ0 `=.1 <1 K吐 K]1]렀jHj4k;]f;X0GS S S 5SS ʇSS,0 P 0SP8j 0- @ PL0hLf1  -LMŸP@Q2  0 l ܁0S00 0Sj 5Pp8| P`F  Phl1 p ` `R0 0U0 0 p @ppp 0S? 1_i60T03 0 0 0Ba0 0( x-0 `P\0(0it-0 <P00(0(- ^f8j4[f]f>Mb; ;T;X;; 0-|0L PR0BP@ Z R 0<00  0| 0 CS 0h ^f8j p-LMP~U`r P@k bU !0SF 0R20 S0 S R&0`!00S R0 <10  0| { 0S0C 0 ph+~0a 0( ,; 0 0 0Ba|0 R ( t,0; \PX0(0,00 84,;^f]f8j;>Mb;<;T;x;; p-L MP0`@T6  0( ,0000 0( |, ( l~, R 0T00  0| 0S C pphCphf,;;P;|;8j -LM00 0 0 @0@ @@ -PLM@ /|0 0R h0 R饱 0P (0h-,Q 0Shy000 +^f]f;; -PLM@  R000h_+; -LpLM0P,0 `@ <KT2 l Rl@2 Rh 0S# (2 RŸ@0 [1 ,0S ,CP@ @(0+<0S80S40S00S5 0R0% A:P7 d@KH jP%` R 0 l 僡 Y0 00 S 0 R <KY0 J+@ <Kl  0@0 R {+0P@ h0K _Pp h 0R0% *(+j [f[f]fk ;0;h;;kP; -LpM0@,0 `1PK 6 R 0 0S# 6 RƟ@0 ZdƟ,0 S `,k ᒰP⏰ @(0,+0[S 6 R K} +0[0S 0R0%` Y:VO @KPE P= 0 4 TPK8( LsKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !E[0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF KY0 Ds*<0K@ @90 $(,<4<!4"L T:0S\  \ SP1:PT0@S 2 R Ჯ 0P;*2 R ᥯ 0/* R 0S $* R0S\ 0SX SR 0 SB K`0 K0KK0h [0  /h K0h [2 00h0K1\K 0$(,<46Mb]fD;;;;\;;;0@S T0$0Wz ,0S $,a  800C80jD< p-X0LM@`TP 0S  @TpPpl p-0LM `RP0 R#$0S R 000  0 p @T OPm@T"Vf|phF` [f [fl]f -LlM0HK`dpK,0 @K` 963PxK 0@KHKG@K`KdK@Kc@Kh` P0S  ,0$ S 4,  80S8jX< -(0LM@T @Tl -LMy1PpQ`1 R t1 Riy P0LG(DQ @U: $ V00R00S`RV)@TU V P HP 1S(@%TPV VSV PPP( P HP 1SPPӸ[f [f]fl<l< -LMpEy PPC a@V; 0 @0a P, `R00q00 0q PU @T PUP00 ``MxU  P 0``xxP1S (| lP` pxlTP0SP 0- @LP |GPT  T0PS0T 0h0 \0|00 0-`0L@PT 0S @T0XX0\ fP ]f -LM`pP`| P@= ` U@X(0T0k0( P00Zxx0S 000@GxL0W &PP D0 R mX0 (P& ]f]f< p-L MP0 P< 8 \0Sp9x `R000 TP @|MTx|EphP@ 80 R ,X0 (@&]f8< -L,MP @px T@ D  1 ; S00D0 :P` L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0j W P_ L0 @T 0 R @TY @w80S P1 \00\0`0pሢX0 P0eP 0Y@ 8K0q  00bS00bc8 xRQ:Q0 D0S 0 <0 ,0 H =H 00+P@ 0 R rX0 (@%80< S L0 < KP<Pt0 R Q<X0 (L%tL0 ``8<0<<<5> ]fx<< -LMT@T  P HP 1S@T p-LMS@T L0@T2 R @T 0S L0t@T@T 0Sf L04@TtR@T 0@ @T@T 0@00@Tp0S P T @T 0@@Tp0S P00000P PU L0 dP` x1 R ⫪X0 \`4%P` 01 RP ◪X0 ` %00SP  PPP00P0IPP0P 0 P0v 00Snp@T| 0S L0@TfP0 P 00S#PF TKF]fldl]f< -L]f<p, 000 0p 00005> -L@Ppt0`S hs040S ,4 40ꔐ1 -L M0 @R 0S  ^P4 0 0 Pl0 RP X0 Q H 0S P00 ,0$0  ,D>4D>l 8jdl -L4M4`@0P, `p`PLP 0P ST  0S0s 0S0S 0s HK0 H0KG K HK X 報` VA h0 l` VU9 h 30S/P0S@HKLL0 cPQLPp3P@ H,0 LS D,>Q@Ltb@0S  L Kg`P0@!   0@T;\ Pw0S 1 ( 0@00c ƵT2P@Qr0S TS,0S00S40S80S , h Pz0S 0S$0S(0S X V Ph0s T0@P 0 0a (P  0@KU& !0nQP@ h 00S)P R@L0LHK bPQLP 0P@ 0L0 P Q@La@0S  L KP,ljll <lklʚ; -LM0PS`@p 0SP0@S6P4 P 0 R T p # V00R00S@ 0xPn0\ )hP rP Pᬺ p @\f.+l?: --'LM0` ,0 00 0 P \p 0@K 0P @ a 0 :R T'P0 (0C( 0 V 10(00 @ d @0K  ᢯P:@H ,K 0孭P|  IH0S <0T&0 l  000 !̠` !4! 0r00d 0 :RT q- 0\*00 VP R Kz P5 ,0S t,z0K( TP700  P@ 0 ( Ыh000 Kp 0 :R4 P@ 0S 1 B 0@\ 񟗗ꀝ11141111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111L1d1|111Ğ1ܞ11 1$10S 1 0@0S 210J0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 10S10 70( N`P 0S0 00 =PP` /j4D><lk 0-LM)RP@ :R@0hP 0P KNS @0h@0h -L,ML@, ppL ^`P ^1 1D1111111ȣ1h1p1x111111XW 0 L0 Y NNL3 ,0S ,ol3ph _PL Ly`P@L  oo` rP` -P0  Pwb 0X Pmb00 0@S 0x2 R 0S 10 R 0S0s R 0S0S0S fP 0, 0@S1 R 0S /0x LKH0,P *P \fL0Sc @000X90U^T S80NH@K]0@K G0KHKX  0L ?S 0SHKH@KG0[S]fld*-0#   0 j$<0:0<@-QM@0-\ T  Ѝ8Ѝ@Jl -LMßP`, @ S3@ pK 0{P p T 0@S 00 MX KM$3 ,0S ,0S/00S 0S 0S$0S(pW 80K0K@K0 [0 .P ,KH0;P q 3Sg [Q0P]:0 00C0 0 VS 10000#0Z"(p0#0 81#81#$102$1 1 ! l@  000 !40! ` 0! 0HQ<֫0   0( h8,0h 0,000H P X70S0 qL` ޕP G0SD10A0S  0S$0S(0S904 #,0 0 w #j lH0>010  ^!0L$1]*!nx!00P10!R J 0 0 p0^=*!n!00P10!R +0 00p0!0>0^ P`eV0^*!n!00p`P pp maJwCp<p$ r$ -LM`0@ 1 ! 01 0^$!I*(1n  00  P 10!R 4 00!00>0^ PpeW0^*!n!00pP  >0>0  cR !oٯӯp$ r$ -LYM   0p0`S0  0S00g\Kc  a?K PP0/SP [0S< 10 S@C/R 0t/S0@ L0 H l D pK0pp $zP/0P0\0p 10@gnP?P  AP0P!`\pK@@LP H@ l pp D yPP0KP @ 0 帀 匠 yPP0` 0 GKcPP0 0 KYPP!l1R!h1RP` a?K "t@-@\  0S0  0ST 0Aq00 -LM  0 @ $ 80S0Ÿ K0P  T018#R 1   mPx2 0@40 , D0 K@0KP  H 0@ 8  KHKK0KϝPu80pcWn`PP Q0@ T^ 0ApcW `P6Q0 0 SRW*U 0S" @W$0S U0 03  P&U!  00C0 pdW`Wʸ0S ZP 0 Н fğ P ?S@ v  l 0-LMP@0 (0 (K0 $0   0$K 0 [@P 0 [00\0 > 0j 0-LM@P@ K0K  0@0 -L$M0pSPl V > V) V - @<K@0K< 8 4@ @`\P@00Q@K  V <K@0K@ < @ ` @NP<K@0K< 4 0P ,` 8@ @F VY  V <K@0K< #l VA e Vtt \E\PhP@P@ h0L 0` f0($0`@f0 0`Q0@0  @@ T@ @0 P\T\ D\ <K@0K@ @ <K@0K< @ <K@0K@{@K yPhG l|lT2;\2;\af -LM@[P 0 j p-LMP`J PK0 p .@`@ -L M0@S K0q1 0 00q1 0  p-LM0@ P0K(KP0  p0P,0oO` Km0 p-LM@ `PHi! 0!8< !ip p-LM` P@4i! 08<1ip p-L M(@1P 0 1 `K0P 0 0S  pP1 01 !00 9P -L M@` T00D^\P(:T8 p,KW" 1!,0 $ ( 1.$ 1$00$0 1$00$0 00$00$0 (00 (0 PP vP00# 0 R0 p-LMP0@0 W[P0,`KS   0S DtpC0S +0[2KPjT< p-LMP0@0 7`,`KP  0 S DLp0S +0[2Kjl< p-LMP0@0 _,`KP  0 S D$p0S +0[2Kfj< -L,M@DK< K04 0 DP @` $p <@ 8@ ,@ ^ -L(M` 0@p @K8 K0 , @P <` @ p8@ 4@ (@ \00000000101011<0S8000 00( 00(0H 0 @040L 8 P0<0 -LM` PD0FK0 !  P upKP@ 0  @{TЀK0`0S@@ @ 0 -LM` P0FK0 !  P upKP@ 0 ە@S{TЀK000S@@ @ 0 -LM`p딀KP@  0 ,00,0,0( 0CPԠK,,0U 00S DP Q @ P -LM0O K K  -LM0O K K Ő p-LM(O`$K,K4 K, P 凌400p -LM0 0K 0 峈N -LlM0pS l KےP`l0 ` $80S` ,00C,0l(0,;Pt0KP t H0 8 0` 4` p DP , ڕl0HK0@0K hK@T1# |0K h0 TP x 4l0|  hK0K@ ``;l0` K`P0X0 cPT *0^0 \:H K`  zVl  K08 `l0b0\`::0 0-L M0 @P0000 0(0 :(0  (04 0(0 (0(000(0  (0, 0(0  (04K0(0 0O$ K`j00~n0`pflNPP 0f0V@0*` VT( K,0K JTZ:0e P, 0L00 W>l -L6D< -L/`<00-@P 6 0 -0LHP -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS 111111111111111,11111111111111111111111111\1111h1P111111111111111111 11$181D1L111l11111111111111 1H1 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P`?:0F: < < <<;<<  `Sl h0 $$ à 0 < 0 $00 < 0.<! -LM 0@ 00  |0 Rh0  !!0 0)0  !!   00k ll p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q `zP0  R R R 0  R R R0Spp p-LM0O"ThaT `!0X!00,SH1  !00(!3PP 00B!30P0 !300 30$6!@0`3PP 00B 30\0 `!`t0t @ n@4`P0P @08 0C0plllllllll88j<8j48jl -L0 PP p0P h0P `0P X0P )\Lx HeD0 ns(< $i0$il ,i0,i .i0.iP`f$ll < -PLM`@P Q pK 0P 0S00S 0P S 0P0S 0-T@LP H0HP @rJL00d@0?00?0`fl$l l 0-<1L@4 P8040< 8 H0<0 @ 0 -Ld  -LMp(`< Q@G 1 G1F?(P8PPEP 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 00 !01BK VPp10! 8PH81X <04Y 10 1`K 0 l$l 0-LPMQ@(P> P dKP8\00S 0@0PafTafQHafLaf`fk < l  0P  0P$0 Q0X0 <l$l < << -LMPpU' `V @ `\  0V PPP  @ @N@@P@ LL@N @@ @ l( l -0LM0@KS8 `00 ,@ ) 00Q*P p0!Ơ\: c0\c054 50:00  0 0 Q:8 Y mk ->0LMn<`p4 CP@B 40 R08 &8 P00U* Vؠ 0. D   0Z UJjF:804 0S80 dw@X00K@, KP00L00  CW>$ll(<>0 >0 fBW>M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p$0 0 0c@0 < 唒W`D h 0x"Y, K00K /, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 K)yl  0-LMP 0 .@K PP@ PkP*80 0\ @8:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WH$ll -LM`0VPp R a :VP@bT@!W W `d L 0D@WH$ll 0-h@Ld0TP 0\0X `\ ,0R 0`0S0h) l$lDD< -LMX`PV r @0S  2S @2S2S lphd0JS L2L2L2L22`2222d0  d0d0@d0 P1`VAA0S 1 R$ 1 ?#+0AB%@ Z 11@T !mt h81\ ?# $1H1@Q1@!+B%0@ Pd0d0 0X u" 0|  cmlI:lx;>;<<<<<<<lllllTM:l Mj<40S@ Xǟ#&R:0R*0a00  01c@W2 0D0 HQ`  D0 `6W  T  8 5S55SSH0 SL0L0S S L6!XD0`0ó D0` &U  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`~TU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 5S55SSH0 SL0L0S S 4!ATD0`0ó D0` U  D0`00D0  300S p3 0 P3@q 0Sn ,3Ph ?P8 ]  "U 48  0 `"D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 5S55SSH0 SL0L0S S 1!aVD0`0ó D0` x!U:  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D8 0@ 0S 0P O0 |eg)*(":1"(Q 001 0RlkllN:$lllxEj\0@ >#& R7:0R4*0l$0  01c!R <\ 0P \0T\ 0 D00D0   $0 2R @ ` #& R :0R*0l(0  01c!R <\ 0P \0T\ D00D0  k$l -,0L ^  08 l$l -!*(L":M1Q"( 001 0R  0d* " !Q:0Q*0b !b0 P 0k -LM$0"*01\06S0:0@<,BlGjl$l 0-0 L"*("1"(P  \@! 0 SP!0!;   @00ll$l@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000l@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pDP ` `000@0  0@0$0)$|YllGjGj< -3唓LMp00P 0, 0 p0S P U:YZ @:(s(C<, c 00"R 0"  "0"0"00a3C?6C#Z!|"00#Rea!P"0H2@D"@@2  @@Z(Ÿ( 0  P 0 ,RŸP 0$T D@ 0@ 00 @ 0< ePtJT:no`}P@) E1? P 0 01  @`P 1 000R 8P@ <W 0pĀ mkL8jl$llGjlGjGjGjlllGjFjGjGjGjDj(0)2tEjlafaf00 R 0  \05055lafaf -L$M(1"W><( l lll$l(<@0 R !0S0 Raf-^ 0^  00!^..! 000ll -L@\`p P\ $*10ST$6  ;P#; 0P 0L0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEP?H0H 000 <0040 000 000 $0 -<<llllll <0l -``LM0pS P0  @P@^00 RlP0P0S  \:00Q0Sl0@-l0@P 0S P  T :00U0S000l0-0L 0 000 00 0 0 0 x0x p0p p0?00?X0 ll lllllll T2lR2llllllll -0L0Όn`VPp@0?0?0000?%:F%6;PK #;J jV!ZXafaf4< -LMPP̠%/*Ȑ%:8#*!% vWp!R#8 001 0R  :U#E*`L0HS @000ZU@:U:$ll 0-80L@T (PT N DT0tEjl< -X2LMP, @ @,89, 00$ 3080 00 8 ,1 R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0C $01!R.P I P k2k2k2k2U#&R!:0R*0a !bA 0 T L8%5HL}<@T V 0 *$s@T@Gjk<4< -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P GjGjlFjl -0LM@HpPP% KGPU$: 8 #! R#8 001 R00*"5*s `  0@HP8 Tkl p-0LMp4 40 1c!P+ Q)ڬ0 \0јP00l1  R0C0p`1AC\0^*PP06 @^:p|fafaffaf(lx l -`3LM T, :LL3< r 8C0S ,CP "88 #$0b3 0pǏ42 P0  0S",0S ,P@Dt oKϼ|2~Ϡx KP@,2 ( < p000PPC$0P=*!a06V,*46!SAW  4*1 0 42P4G|!Uj1 !@0p&V:@U00 Z0#02S0ES t2t2s2$t2$t2$t2$t2$t2$t2$t2t2$t2$t2$t2$t2$t2$t2$t2,t24=o` "88 #$xW0SS 7j l|f$lafafT<lx<<0 l(l ;l<<@B<<<<<<< 0-LMPK 㡾P@ 008@$l -LM0@X$l -0LS S  -<@L<`P. p*0L ^| P0(U@`H@ $@K,0$ $ 00ZUzjLafl$< p-LM`00l H0N@0d0>0^P 0,0 &L 0L0H plLaf,<0-P@P !200-P@P@0R0-P@ 0bR03 B0R0@-P@ 0bàR? B0QQ00QP:  p-QLM`P@S 0 V pp@rP`&p`0-P@P@0R0-P@ 0bR03 B0R0-P@ 0bR3 B1 010 p-QL MP@`S K0 V Ks 0K Kp@rPp` -QLM2p`S)P@WU (W # 3f g0T0e 0d0 "2R0c0 0 Z  p @rP*`ppp@-(Ƞ !8"(,ȠP@p^`b `n0 # 3\ c l0 "2R(#ȃ 0(BR00.8 c0(R0#03 8 " P@p0(R0#03.8@- a0`S@@B@-@0 -LDM@PKP@ 4dT QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H  `\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@^8#K0HT8#A0HJ8#70H@\ h *  P T P0Kafp@-^`@ Pb 0 2%$^ 040p0-P@cbP L0Q3:P:  -LM -LMK{0K0-P@P%@ 040 ( 40(S"4Sf40 ( 40(S"4Sf 0f -0LM @R 700 SN9`_hW 57B? S p0  "!  PLOW4<=03Xaf2>@8<`H0>02 aH2"& 0B0  0 1!<!⊾1ⅾp‾!1 1!1 Ex?! 0 @ ,"l?ܕ0 l lTN:Xf$lUUUU(jl2hfL2df9tfld< p-PLMP x1R p1 pdA00Ta 0D!P@0 SS  QQQ00 Q9 1P0-S SP& 0-S0S a0C@Sp2222222222222222222@0000SpK@@0@0 S DSBOj8 lff|< -h LM0\SX@ 00D0 <<0<P ,0  $HjTN:ff8f >< 0  긍j -LI!m 0 h*4<S  800S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@PƱ0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p៱``$U-Kz4K 0 3KP `p,@K -L M0pK@` |$P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p60S h}Pu,0P# P 0`V U004P< (0;4P00@ @0$0 0SV h4P 0,0h -0$ `L@(X `, ,0P+L2̡2ء222PU /0p /U 00SXp 08 ]0 0,0P#p!Q   ??P 01d5U<\5U"*T5U H5U$Pn5U Q QY00 "  d 0@P0 00 &000x4U l4UJ d4U Pᑅ0ES@3 0 P90S 0" 0#$0$   BR !+%0 0bJ10000 2 0,$,!$#, \@Z@T GP 0@@@P02 <4(<"4!<002 0#$0$ 0 S0S000l2U d2UY a ]@0D,S| 0\PKP@aP#Z0[Y [$ R !ᴦDDP@ 0P@3`@K P 0 dP0"  6[#$0$&K ᄣ0U 010SU0U 0U 00U00U 00U 0jf Q@c Q r<c@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc ccddQQ` -LM`eP$ i0d (08 , 0l!p2 040 1 K D ռ 004 ϼ$ 07K? 40<47Oɺ P%0 0bP 0 PʄZ ((0("4400$ 0 D 0 o$ ㉼Qr<b;WEVx2r< -L,M` 0 Ȁ"4pKP@ .%4K@(0K P P@P# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ p嫃PP ,0K ) 0K@@@ pP@,0S@@T,4 ,0 , 0^ @@"0 U N -LMP`p $P bP@ $0K   pPPPPP $\00S 00  00   -L$M@`p 0@ 0PPb 0KN 0@@@@ phP@0\@@T 㼃 0,0K 0+ K  *K)K4K@@@ pFP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 @| 0  N -L$M,`KP @prY0,K0 (K$pKP @@@  -L$MP $ 1`L  㚂Pp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 r@ 0 C  N -L M0pK@` $PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP@  -SL M@`< Q8 (p PP0 0@T@b@b`V!J! @0L\ 0 @P㩂0N^J0D@T;P -L M0`KP pᚠG0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp w@K}(K0 pKP @@ -LM@}̠ 0@ @| -L M0@KP `pHBU0K/[@/K&.K)K4 Π0 -pK*K`(`KS -L Mp0@KP` CV0K/['Ġ/K)K8'KP 0 *Kp (pK( - ML`0 PpPP@0nT `:PP` -L"P -L p-LM@g`$P P00$ ;004P$ $Pph. -LMK 04c: -LM@1@$01(00LP1!0S2Ƞ<23S2ԡ92ġ  0h!0Q000PYH ᙪ1 4Q> .P@/  T T 0ὕP`  o pX@` 0 @0 Ppx`{P0  z@0P .ԁfЁf_: 3T;r< s< Q-L Q 0@00 -܀L0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0U`Q0Y(]00f2aff@lf2> - 8L8#Č M R00 `,(Y, P@ 0@|0 0 Ā幹PppPU7 1'Zp ,0 S0 90  S0 90 0P0U0!1 010唹ݲ-2Y 8Y 2 RPp0! Z-.<1Z0-.1Pp ZpP101"P1p01 0-1ᑲ鎲鼁f - 0!4LM#4`pbP@E 0@A0'PP7 V0 70  V0 700(PUP0 11 011 YQM  1<1-S85鼁f -LMD@!88# ! P`@ p@=013 PV04000;00`00l0 $@Th@ $0l$0徑' `hPX0(p$0p Kh0D < RP0 @@P`p@K  0@ N x d`2 pK?0S@ pK?0S@ pK?0S@ <Kht 00`uyKwpyK"<"1vT!0xp@ py[$L@ "Ġ.<K[ @pIPP P ^P NAP AP P #P{ HP? JP) -U .U ,@E0S(0ES-0ES-U| 0SU0SFW x0HS< W0(S WHkP WP0p0@]XYX>PppHQPLPXGP[BP} [<=ppFp2AP-@P}&P! P  } OP OPxNtX1P|N|wN 0S]]PX^4PSZPN[PD|HVOP?N; X1PH|F 0S+ @' `#{PP P \P P T{ NpPLPM}\P{Nv`PLqPMl\PzNePPL`PM[\PzOT\P, OOPNJNF 4zX@1P !Pz 0@S0PyqPy @PyrPy zPyN" LU?}PywLU* MU LUq !Pl*h Pc4y^4P* PxK AP+ LUP LU1P* Phx) * P0x Pw MPO #GPLU MUP?PwP?l7PpUPLUyPtplhd`\X6p0E)US;+U*U8 MULU5 NU3 L@E0S H0ES?+;Lv6YP 0S.+*& Pu00PuyP  P|ueL`E0SE@E0)US1+U*U. MULU+ NU) 0)US+U*U MULU NU 0SD?@ Pt90P?Pt?P`tQPP P$t JUHU KUMP MP MPs,@E0S|0,SHP?P ?}P@xds?ssP ?nrP 0S?fhPs 0S?]`P ?XbPrQr #P AP.U,U /U ,@E0S.U =<'P =7'P .U,U .U =-3PDr~ 0SD|@,T! !0Pqr .U .U,U /Uk?Pf@qa? P@qW ? P ,T?P@lqE @AB8q7 =0P\ 0S=1P pppp LltTP?  0Ppv< -LDMH @H D =@K p:"L@ 0Sl 0T X@ L0 P RS 0SP  0 `R;:00S@ =0K@@ @PPKHDT0P@3  <KH 0D<K< 4 cK0@ ОP" 0 `Q*P00P0 0S P 0 0ST0X 0T0 0L  SL X D 0T 0  DDlf$30 2S-L 0 p-LMPp@0`00 X04 @0P P0D H0H H08L 8@P` 8 ph3vCh0 @0C8@ P0>~ 0p`gPP 0g0V0@ p PWT( K,0K jVJZ0 + P, 0L00 W>l p-PLMn@P^P^`0PPfS pW0 phW>0 0-LMP QH0:Q *^ lP*4@D P0 -L◲x< -L⑲Dx< -L M`Q9:#V6*0S`02* c 0>0~N0@pdyPP *"*0 T *` 㶼V\$ K(0K JTZ:8q P( 0L00 W>l 0-@@0N@P@@eLƼS0 0h_lW> -L(lx< -L"x< -PLp `, ,@ ,?@l8Lj yl0y -T0L M @KR000S  0S 5>ly<00  -LM0@S000 S  -40L R 0|P p-LM@Pᄬ400  `V` 0  phm`]0@004 0\040 \0@40 \phy<z<z< p-0LMx @0t0D L0l l0P T0d d0@`(PKX \0H`<}<<@0 0( $@ 堒pn3n3po3o3o3xp3q3t<3  `]  `] -LM`{dP{004 ,@nPU 0;P0 PDD;x,7$(3,{0~n0p`f'PP 0f0V@0*` eVT( K,0K JTZ:0 @ P, 0L00 W>l -L}< p-PLMn@P^P^`0PPfS pf0 phW> -Ḷ}<000s0f p-LM@4P 0 0   0S`T phRs04 `0S 8 p phҤ (~ @x@KLb> 3 uH"t 0/x0Kl KN$P <|34200|0L0>0D1" 0GoP y 1 ,0S ,a| ux1t0x0K ?r Kl0 K$P |x@K u !0tU x0K?r Kl0 K$P |( ! 0`!͊_0@@%0ӣP0`@#Hh P 8`p@5͊P%00b|t尣j>$m;|~<(~<~<@f2>\33~ -LMD@!88#,!+Pp -LCM⠁ d1peIK$ @0 l1PS ꄖ33X3`3h3300 ;004 0 <0 A&0⥑Dx50x5I $0S $rO? @7S>0Q  t <tP@0 |@g7S07 \X0y߁<00 ,p(p$pj<<<<><<Ѐ<$< p-LMpU@:0 `&0Cph -L M @ 6@?W$,3 -L M@ 0@/W$,3 -!LP!(ᝊP@C 0peP`)0S* |7` Q 8Q2 R  Z0 10  Z0 10 00Bዊ`;ᄊ|70W. |7| 0,f - 0!4LM#PFP@ 0pP` U0 80  U0 800 Q D,f -LMe r<(0-070

40 47 I4 -L,M`12l1,0,0 p ^<` 6^y6 006@ 5 P  0 ,  0$00$0\  oO 0(+@|xş@ܝ,tP000 o0@ ,@0S000 20<0 0<0 0@ 0S 0 00(|w8 0 0` %4% 4!@4 0 0@h 8@ 0O 0$0Y 0 5`%`@$ 0D<0HP0 400  @ 3 P0* 080Ƞ,Ƞ0 $D L$0 0$00f $0   0  #.$0 0$08 4@00 P0 ``8@ Q ! 0(P\`5$0Sڰ0K 0 9`)` N@ P2 P+0.8@400 0S\0#1 00 a0 1  P ,P 0$ ,D 0(+@ 08 0Ƞ,Ƞ0 0 ``0S0 0 4`$`0 0` `` P,@wv0040 v0P@mv0vv 0 @@T0(jv8 Tʚ0S@ 0$00S  0 农?뼰3'<< < < -XPLU @ ?#<0 p` @cT0p  p@˫0S 0 S04m]00\pm餖,< -d0` L - (L(" P` 0AT P0S XpW4P,`P`Xp2餅f0X0 -T0LM (("!X@ T  00X餅f -t0LM Ƞ Ƞ,A04S 0000 0CS0 o ꤅f@-$ @.MЍ@꤅f 0-LMP@@ 0@0CS00o -LM\. 0\ 02pXP 41` Q 80P d0\ \0\XP 41 PXQ 00S00}f|f~fvt -4L M^P@`p 4^ 44^ 3^ ?3^: 3^ 3^00 d`p 0 d`p p3^ x3^p 00 P3^H  00  p2^w G2^B )2^0S!1p +I hjP` I T q\ }H2^:SP`0 00  000 1^# 1^yp0       0 0 p1^d0 S0 ! jaRP`,0 t   x  0|0 000d`A@< S \0 K  $@ P`\@ 10< S< 0S   $L0^ :L00SW WW WW @W@WW@ W @܅fW@̅f W WW W-00 Ƞ Ƞ,1X0S꤅f -0LMP' 00S P @`Pp0 KS0C$ K00 0,A(oR0: S,>   P`0R P 0$ $ 00LjLjfLjLj -@0L R 000 0S 0S 0LjLjLj -4L,\ \ LjLj 0- 0P @@ @  @ @RL h0T d`  0h@0R  Q 00# 0Q 0 000 (-"H 8TLpP#h1 '0T 0S \0 0 : S 0Tl0S 0 R00\ :@@0T\ 9\ : h6> -LMQ4 P @pZ TS R0R 1`T R 04Kp0; S, # Rr Re R   T PPM P `@0`0VA` Ƞ ;,H ; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A1d2,R0X0 R00(2T; 002R 1R R;00A Rx!t!1T ʜ1T`!  0SvXx1TU@\!0@Hv@! 0 H604 0 4 04 04 04 04 @04 04 <4 <4 90`K 0<0 0! L# -p!LM04 S\q1Tq080 0K  m8P`@`V@DPEAJ3[ S"[00b0cS m 0KmX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3ff 4S @08#<@8oS: S>; S P 0 R0,Rd: -LM@Q 33333<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S 子 H< p-LM0`PP@ S^EP D0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S坏 p<<0Q 0`c Q- Lʐ̅<\0`0忐<Q p-LMX@PT 0S1P!00 S P0 p0`0CS0000 R000S0Stt 02c1gPDu04 V00#if 3@lf>܅<< -L$M ,0 0 0, 40 0(0 @0#4 p0#0# 080 XZ 8@ l0d@0l08 @p0,0p08  D t000t08  H x04h0x0P@  0R"<0 ` |0S P?#<0<0cS 00L iLU` ` P|T 0,S P?#<0< 0cS 00,00iU`, `PD0S 00S P?#<0< 0cSt 00000riU`0 `PHPf 04 S P?#<0<0cSX 004  ViU`40 `P0d@ 4 P?#<0< 0cS> z@ 0000)L 5iU`P ` 4L80 P?#<0<0cS @0i UP\hP哣0S0S 04 oU00 %hPEx0S P?#<0<0cS 00x  hH U`HP `x t0Sy P?#<0< 0cS 00t  hD0U`DP `t0cp0SD P?#<0< 0cS 00p  hU`P `p@/l0S P?#<0<0cS 00l  L hL@ U` P `l - (L(" P` 0AT P0S XpW4P`+P`Xpf -\0LM (("QX@ T 0`\ X0f -0! | LX\ ` -p0LM Ƞ Ƞ,A0S 0X00g0 0CS0Dg f@-$ @.MЍ@f 0-LMP@@ 0@0CS00g -LMPI(1Q: 1Q?1Q< 1Q0 0Q 0`\00pXP 41` Q 80P 0Q p0QXP 41 PXQ 00S00 |f}fvt~f-00 Ƞ Ƞ,1X0S*f -LcMq0P@$0 40@@R00}/#\B1TTT ݍ0P0 $0S h$qXЍTa0S0D!0000iK1 ;0@00 |`0`2S嵍@4 0P$@X0S 008 R 0  0S0 00C0Bvt>00X 80P0H凍 8傍0P0j8f<0Q```P`` `0 ^ pPU>P ($ f<3`f,l 3$f<<< 0-L@0PS0000 0@@0e0h`,l -LM@0S R 0 00  0  hG,l 0-P0L8 X0  0\2S @0S" ? u00\"R P0S"@002c1  cP0S ` 00C0e 0<D c0\2S 0S@L@~e= f><< -L`Pp@ 0Tl  R0000 0  Pc@T,l < Q- L␌< 88#$R\\ 0R01SP0SQ 004fLf@l - 8LbMР8#P( `P0 S@jKo0Sttt 0#@LcP@ |T (0 S 0(o V@j(f <(< 88#P0 4f@l -L Ƞ Ƞ,4MP@p <2 QPPy(2Q 2Q 0ό1Q 0B~S001<P  E 0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 >00S 00<1 P0T0 V 00S X $?TH KVT H K VPT H0Q @0QQ(0$0pLfUU@Ut}f~f@l0 0 4 S-L@PA`p <0 RpQ W0f4l -LM@H 0S00  Q0 0 0S00hr8l0 R=  00f p-LM1@s 88 #4 pS0P`$0<`80w00@L 8ldf 0-0 _0LS@ P0S 0000 8X00 0S P0S ?  c0 ?c p-LMX`0SLP-@e f1S0PM>00C0p0f(f 0-LbM`P0PP@0  cK T fK' 0S m0 j0< 0-LbMPP0 @ bK0 ufK 0S m0jD< -LcM䀟0k_K`$0 @c faQ=-pMe` @0iK0cS0x 0͇1pcXrT0P  $0S ,$mPgj0f(f4l@lX< p-x0LM R 00p`B P0`S phe000 0@@0= p-LMQ@@P Q pTP P0S \ R 0`S Tr\ `1PS 0-LbMP@0 @S0 4P0+L0SA00`"R 0fK1 Y0 S l$m00 0`20b@@ 02c 1`P Éjh<>t<|< -LM(@0$S  00>0tfDl< 00C0tf -LM  -LMPp^@`   0S & 0S ^ 0S K0K P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 PP @ @` $ $0 $P$0( 4$ P@0 $$0($0 0- 0 0CSL@ 0P U R 0 0 0 00C00  $Pe< 0 -LM0p$0 @Rt (B(0P3,1P # 3?0@CP  R0 I_KPE00 $("8  00Z00",S ?00^0#03^00SV000JKKK 0jP,1S QK% Q&0Q41!P0 S0 S0 0 SR 000 S -LM0PP,0 @`0<p7 S'V W 0S 04  ZZ U 0S 0,4| oK,  o9k 4k 0;p ,04PPPpMb -#0L MHD(0K0P(K #@K'K&0K%K$K"K!K`P@ p2 P@0 0pGWW  @p@-0@4\P` *0 S \0S \:p0 S@ `UQ 0-L@P D@P 0U0 ^ *0S ^0S S ^:0 R0 -1aLPa8P@pPm PUP]P 04\@= p `^*0S Q 0S R 0S ^:P  0S o~Pe1000 R 00p \ p0 `0000 S0 4S!40@e 1PЉ<܉<<< 80!b1\e1 -L M@A 0K 0KKK@KKKKK -QL M`@ M0PU ,pK P'0[S M0PU  -LLMß 0`S,  P0@PT8e[1PeX10 080P0x d KPp 2 ,0S t, ab [a0[eT 0P @ 0pW@ hT e$10SpT0@0  @ A@0 0S Y p0 0l~}0 @RPpPee I0P8p 0W@ 0P Pp@T@TJ$@TZ  _0l0K 0lKT Kf0KkKepKjpKipKhpKgpKPQ0[ XKbPX0[ pc@TIj$<<< -LM`P4 ep/ P@0 0P 0,p`$   (   00PU0e@0t0 -LM@)00  0e0C0ha0 <0S R -LDM<\ ` d0 1  P @ ČD ``Dp"PXKh2\L@ PP H < 8` 0` ,` 4` X TP !cP@e  /P\P@` 1P0h PS`P!1\XK4P P 8` T bP@P  e  h PPLP0epA T D/P` U801PU0e 0` ,p 3/P\+ XP  \0\XKPUe/XP\e/\h 0 Rh 8 @P@ bP\0@01e/\0` d0 |Dl`24(34< -LM, @00 0P4 `e .PP 00$00 1020 P 4 T0C @2356 P 0S \ 0S\z X 0Q~ <0S00 0 Q p@$ 0 0@P@p<` 0p@T` jW `0 R4 0S,0S) 04 50<P@4P@  C  C4d 1 -`LPVp $@Th {QqH{q<{V  {{ l;<<\;(< -LM@\ 0 0s S | 0s S| 0s S | 0s S| 0s S| 0s S | 0\ 000| 0\p 0P0 0 -L M0p@0`00 @NI0H A$E D040G0F $ I H040@ E? A1B x1 p1 R001 F? \0SP PR ,@I e00\P!U00R00S@U2I? PePU X0S # 0PUYχ 0 0S 00 4 PUX X 0U 0 13 p-LMPP!8P P0@`Te-PP \Pephy-ew-et-@T8 p-LM @`\ R 0PS 0 1< phsa\01\ P1Sp@-|` @P  0 Č$ L0#Q `P8Sp0 S0S S f: -LM@ 0 S0 S  -LLMP#@0`0P ,0 P 0S  uy3 ,0S ,\_0\KTK \0K[K)0  Y0KVKU@KZ@KX@KW@K Rp[W00P00SQ@T@TW 0f ,P@ 2XH 0S00S 0Sl ` KPL `OP8 00S$ yT f,0X0840` `PU M00B0S Sf +P P010  P 0S}?d0000 B0S0 S@\ X @ 0T4 0 R090Au jP@T 0txl`x01 0CĠ  UKV0KW>j<1!B bQ\^P` VZ U5` V 4\p0 ?>1!B bQ 0d B0P` V0t p x0CKh tpdKRKx |0  Q| 0 ,0S ,Wj0k;<< -L@M!0!`(0 3 4`pK5K06K0 @0, M0KN@KL@ 0 H0 0?Kt0PT I (0S P(W 0e!0 tPU@0Tj p (0  B`2RP1P! ,D,0(0S,0$0%e,0%V XpZ, 40 040^4 00PR00c404 00R2,D,0 0,00@-8P@ \0Q0"#000"#b!1C00 00Mb<( ,00$4G-M0p4`\P@Q ^Ѝ 0S0, R0( R 00Z0S 0 48S05 0 48S0Q  4 0 8S055 5 5 48S00 RG-@MPPp(,0`Q PЍ 0S0X0Z 00W0S0 48S 0 48VQ00 48S 0Y -LM@`pP0K ,K 0B@0\4 0P U,S:0 BP0000 RyP,0 0PmP00 UP -L MS 0PP 0@ T S0 0  0o @  0P@ T 0 -L$MP4 ,0 \tp0 8  D0S <  1S 80S t rl3!b1<P "rl3!b1x3@p0@ D0 2T00s@$80S t rl3!b1<P "rl3!b14l3!a1  044 D<0, 0>,`T`0LS4 4X4X4X4~4~4t4t4\^@Qܡ#^ pl 0P>PT0 4 D0S〡@P l!l1T@P8!81,!,1DQ!1 TT@0S 0 0DP 0^ ^DQ\@0S 0T\h d d0T ######\### ###@##h###D###4# -L M"00pAd"@,T(0K(K0, K%K#`K"0K!@K+PK*K'K&@K$pK,K -LM 0@S  P uP 0S 0S p-LM 0@40P00  8&g8P.JP(@ H0gPPd0`V0 phbPh`d0tPVf0<0p;;L<`< Q-L Q < -0LM@<0g0 & p-LM@PP ` 0S<0S00 P 0 Pp ppp 0-@L P 0S  0S000h齶 0R0S0 P0S 0 0S00p< p-LMP`l00lPhPdP`P@0P P0  4PP p   -LM@p h -LM80pS 0)%P`\ d0l@PU PPE`Ut@lT t@DlTflh`! p-LMd0\ `0V@ Pl`d0\ tP0VlP0l0h0`0pfX -PL8 @ H pf\ 1`dPl} \ dR00Q`01b1Xh`@=Xh@ 0a4 ^ @ # 00S0 SP000 40  0H0H7d0t@X 0 velf0l00a4 ^ @ 00S0 SP0 40000@0@6\0t@Xd0 递<< -LM0`H0@04`0P@S J4\0p0S @TZ0P $R0S 0 4aPP Q00Q0S P00$R00S 0S@00@0e S` aP P@ HR0@0 Q0H00X0R00S0@0\00Z0Q00S0d0d \H01`f P@l1 \0S`0d0Sh0\0l!c11 h `h h0Hh@ h0h ?6`` 0@4 @ 0 /6H00H00 0e Z00R00S 0Y -LxM4@fd IP`l 0\0H0@0d00 0PĂ\:^00 ^0S1 \00R00S 00S 0Pt \00%R00Sd ub TPp00@DP\0@0\0 @t` n\\d l`@1d1QV)*KtpW@* 0 0+  0P$ tQ:T t  >t > t >0W0`:\d Ql00R`0l 1a110h0\@d0H0d0 HP 0-P@0HLf PPY @ HR00\D01 ^LD     $ @0^(H ^L     $ H0^(\@^D`0P 0P(\@^td@^Lh0P 0P(d@^t00 0-@L óD0PSf0h锳P0P0D0L0Q 0S R 0S 0SP Q00R00   -LM0@ P P  R00 R000 00{o0 p-LM@XP T0`VPT0`VPXp -@0HLQ1PP@ T0`Pp@0VD0 H0VL0` X0(0P@(pT0V 0-@PLU $   000 0-\0$0 000 000S  00C00S  00C0 0-P0UL@ 0 0df 0-0LS@ P 0S <P0 00J - LR00 R00J -01LM@T f&P00XX 0RfT0 p-LMX@Q T0`VP P`T0PVXp -@XLPp T0`VP P`T0PVX p-LM@XP T0`VP P`T0PVXp000 -LM@0 (  Pؙ4 0-LM@`0 4P  P P0`004 -LM@P0p<`V>0S9  ` 0R& 00 P `0 0S`0: `l0 P h0d 0Rh0 ı0d0ự$ `l0 P h00h0寱# 0-@L0< R0S0`0PS0h铱d0S0d0| -L M0`<@\  $0K _T$PP' 0"Q1 @T 0S 0S $\ \0 pW 0p W$$0@S$0 P#0i: p-LM0@<0S hP`0U l`l 0S`l0h00Ch0 R $0S PU`0Sd0pphp p-LM\`2 ,2 0 p\6\- \00 p\0SPU0P000 0 " 0S R00 00 |;p20 0 K@T00DS4l4(4l4PU0P 00R20 0΅PU2 00 P 0R0ޅ 0΅20 00 0TPU2 $20  P0$(0!P:00p鐊f-0S S s 0S0S s0S sP   R 0B30 R f P0-L@ T` @0S @P80P4 4 `0S000h_7> -L<7>+ p-0LM a@Pp0 ph |024p0 0p0@ xt00Sx|tf7> 0-t0LA0S 000h<020P0CS00_tf7> 0-t0LA0S 000h<02 0P0CS000 1tf 0-LMPQ@@ 0@0CS00tf -L M`pP@hhŒPP 0{PPt 0S x|  0 PP〭1@W0P0 0W 0W PG0W 0W}0W |0W[d00S P0P07>]t@yt xt zt {t \tjt@ p-LMPP@` UPP0V& 0V 0V  Bt0V  phNp00040V000  00ltktmt0  8 S@   ,D  -LMt @0T|x 0-t0L@\ P00x| 00h -LMt @0T|x -LMt` \0p@x| 0P@  R0P% h 027> -LM l0@0 0S/$0S( (S&009900S 00t00S |xPh D020Stf7> -LM!l00Q@ R *ppa80S5.H0SCoH0S* HP`啅P # p00p0d0P 0 t0S( 0Kx|` 00X@T \`0@  @e\ī \p`0@ @ ` S60Hp0-4tf`4 0-LMR@P( 0S%@^( R0K yh0  c 嶫p @0p00p0 h \020Hf㝫p00p00K 7> 0-LM@0PS 0DH0L@$ @D PIJ4 -L MP@\1h RR2p 0S d` 4R @P:$`K(K0  t0\&F(0`S0C(0 P|Z$0$0 p (0 R0C(0 ( 0Zx| 0 7><4< 0-0LPCU@P 0b@PXPDP 40S DP\P 140S 0\0\TRXjXP@e@P -QLM@{Z0svZHMbԓ< p- 8LM8l# 20ATP0 0`0CS0pꈏfD -AML2M0P(0 D@pK\9 0  RG RC0P`<  04R !R,$ B^KPEPE ,!BKpL WLL0<PrP 04R !R,$ (0 S (9:Pp PpP T!0[T0( K;P "K(%P"0[@Sp(0 01R1 20D Dppp0" [@R(&P(P"0[@S(0 01R1 20D DP(00" [@R -qLMp`P 0( KOP& [%0[UD@ P00 OP0[ 0UD`@  P/ -LM0 KP  -LPlM@P`'5R` [5RE T 5R/ P5RH x5R p5R 0 /0)KP)0[0 5R 5RP P 0p KZPP 0p KNPpP000 T4R 6H4R @4R BpP k/t K30tL K^t0 ࠁ|0KL0 `PD0K| `pH 4@ x < 8@ 0 @t3R. #h3Rv  Ppo 0s   0{P  ]0s& 2RR0K05} 0@ t` R R@ 2R=  W;*W 0Kl0 d0K 茠h T P p \p X T0S! !0!0"X10 P00 W T0S Y tl K a l K\P  Pp 0s  P <0s  nPp  Pl %Q 112Cϓ 0S 0S 0 000 0h0R112Cϓ 0L0HrUqUhU pUtAdU@iU@fU eUkUmU jUoUlUnU ~f p-L Ƞ M Ƞ,@   Qh`@ 0 X0@0CS0p&ꈏfD -0L.2A0 \` 4p)011RCO# 㤣0  REp R qA @ H0SpO *gRA  0Sp鈏fH 0-R ^?`4444$4,444@4H4P4X4\ 0 \ @t4S 1t@t$8 #8@0\x4 0 \ $@8 #8@\ 0 \ (@8 #8@,@0@4@H8@<@@@D@0NS:4d4l444 4S xt6|PP T@ \0|40\0x$Rc $ (0R t4S1t t(0 RxS0 0h ,X dP"` tTxT $ L 0 L P0H@ h |,t L0 0CP L0 h l, ^4(4048484@4H4P4X4d4l4480d@@@@@X@@` \@ hBh P>,dPdP`@h 6,`@@@0D @0D HLP0Čt4 0CS0!1t  |4h 0|4 ,`0X 0 `0d  < <0<@1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S  P 0S0  0S   -BMLM P0004P`p 0@0X0 @T@0s 3@R CKC.K A Bf08D P 4P0p08<\`4p Pp:@0 "PWڐ2W" PpPf PhJ 0@0dpH0 cTC^KPE08< P@H0PHTH0@W0TH00` P 0<8P 08<P0  !14K,@ J6h0C.KP B180@T8<P 4O0S SxA}0T<4 s f< P8 v <$*xSf 0  @0eP 0 S 00SX 0@T?`P00S@  <Fj<<,<<`<<44$<̏ffIft<<< p-LlM0 d0 @P`KP d0T@p -QLM@ MO0SFO< < -LM 0@~  ^ 0 S 0000 p-QLMP` Q pd@V*h0!@RT:0p0^7d` -P80PLp0p\Pd` V@*h 1S@ T:0 I6h 01d`fd 0-LM@P0K  T TdD P00C0 Q *h0\ 500  <N0800<\00` -LM5 `0P\ 5 l00Sl0 H0S fm@D4PD $ H@80 @ *P@p"0.P< p X0s  4XL0P@p0PP 0PT L p?8=Df50@050Pl@P8@L@TPT@ P@4 0-50L0@ 050l PBUlPPPTPLP8PDP0fDP]88PXLLP -LM4p^@` 00 4`40P 0(004 40@l -LlM 4@T`pK$ P 0 04P $0S $$1@KP(4@KjL< -LM4@04 0 -LML P @0 @TK@ @d<P p-0L M<00@00 P4 K K` 0 \0  @0U  0D ND 0H@kMpL4x<Q Q 0-50 L@ 0Ppp 00 S P0 G0㥝0P0CS0P%rf4@lf 0-PP@L w|0 l;ax0S00h| % 0- 88 #PL!*0AT 0SZPP 0P Bvp Df |0L0|0xP 00f 0-D0 (("ALPFvPLf\xP0f -LM⤑|0P, @p 4 @0@R@`K0 P@ +,0 S 0,/ P0S@P`0T!7||#0pSpW)P0S ̜P R@W00T00S KP`T@!T@#  )v  PpP R@T|00|0 ᡜ#j<< 0-X0L Ƞ Ƞ,A000}0P0CS00f 0-0PSL@D0 TL R0 0L P   0-X0L Ƞ Ƞ,A0000P0CS00f -LMx0S`P(  aX2Q 9L2Q( @2Q (0 S $(7/4002Q0S|00|04 @0R0 KPp-|00K K00 S;#0 0 &t1QA h1Q\1Q% T1QQ Q@00 4@0@T@0 TpW  q&QH0D0Q Q@00  0qpQH0D0xP 41 QPx x0Svx ~j}fUDU@<Uvt~fUU 0-LM\ @.Q@@?0@0CS00f -0LM Ƞ Ƞ,Q0S@p A ` P0lS`[ _f 0-00@0ff(f -L M@K K 0P -1LM<0` 0 0@40jPP xJ0 e0p00E/30D0QP 0CS: 1R2 #P-11s) P0J1S,0 0 F$0 (P @ \*W003P ,K00| 1<0 S0SS!0@S8010p4̕ m)> 0FBa>Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!P84P @T*0P\?@T:@T*0\%@T:L0W 1S c LK.$q@ᰙTP LK0|  @mTxQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0 0 Q-L h0Q 00H0Q @0Q 0 `1 W@W@ WW -LM<@T 0TlLl 0S 0TlLl -0PLPp@0S' p+0\1c?@L`c ae# 00@W0@m004\uH00LjLj< 0-LM00P@K4U ˜4 0000吘 00CLj 0} 0 Pl -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀg@40Oφh P40RφL P40Uφ0 P鄖<<<̖<<< -L M@K K 0P -2L0M<00P00 @4 0`04K418 K04141 D0s; 4DH03P60偼00L}0LP0P SP PP@垻H@囻딐H{PxLT`pH@@P 00 pPH0 0 pxL奻00@z00@0.{hf>P<|f 5 -LM080@# 0 <@   ( qCXH0 DP =>0S4 P 0 S00S=  X0S 0PUm 00S> 00S<  iBPQ h D B @ > <S.0Y0 #00S PS 00ꠘ<41>i=PM< @T  T 0 >T 0y `>T0Q0M 0 =<<0 {P`7 H00H0  R@1J#T ,K,@ < >@0S ,RP,0S:0 S:#S@ᓲH00CSH0 ጸS S<ဲ 鸑fx< -@1LM (("AL0`SA0TPp: !PP3 H00H0  R*#R$ UH00CSH0N $X >hD$K P襷P0 S:#S$0 P P<* 鸑f< -L@0TA KPK0K 0?00K00K0K0K@K@KK@KϰPPP[ -L M1>@TA K0K ?00K00K00KK@K@KK@K寰P0 [0[4 p-L M1>PUAd0 K! K p!0K@0!@[ 0K00K0K`K0KPKK@K剰P p-L M1>@TAT0$ KLd K p@0 0K00K00KK`KPK@K$K#`KKeP00 p-LM P # H`@#b@TT !phy|6< -L`pP@P@U@ 3/0 33 -LM@Q 30CS 3h -1>pLWP@`  %\@ (X\`@(@TT &'H$H$6< -@Lp`P &U P %, ((DP@(@TT h5< 0-@L_ 000S5  006S$   e1>PU? 0h87 #80h  0@-HP@ 0, Q ^?0 -05L P <5^ mW @ @T8bVp `5<5 $ 0SA@20!pVp`5 -LM@ a{ ] hX p-LMP  M`@ @TT ? ~$ ~ 7& ~3? $ph 5'؝< -LM 0S4F 0 0坯P 00ꄊ: -LMP`p ҶP@?/@@2",3@#0cDc, KhP@ 40F i,?R!x2 p/p0PTg2S 2S 2S,(@K` aP 4# #1!0p5$!1! 10!X 0`1_!4018  @<0 !1p 0d$ R "0"+o8 $9 1!0oTᅄ 㣩,wP 0 S00S" 0@T00S"00S"  \ 4<4V5_5<8<:`<<\5W5@^5E5F5@G5l[5[5V5^52>< -LMp@0So0PЦͦR5@ dh5T0QL0  30CS 3僱  +2>Q Q1> p-LM@R40+P`  0 #d @paP@ b1+(  3kb7p30< ?0-LP $@7P  0S 0-P7  P7  -LMO0 S   P7  ݪP7  p-LM1>`@Q00/ 5@ R R00RPPU p303ݭPTph阫#0\)3S0S 0P@ 0` 0P@ `< -LM`1>pQ@0P 5@ R- R00RPPU 303嗭PT ̠A0  @巪C#0@2S00K 00  00S ,KA *0[0*0K*[Z 0P@ 00 0C00 0 00@P4 7P <P  4˂  d 0@R5< -P1>@LT`0p Ղ5X;E5 XXm颂 0@G \[2X 彪 0@ a <1S qꠞ<P1> R -1> LR@0` _ plc  R T0 hY,0 00 0S  <1S => p-AMLAO0P `0a P 0 C400\\  P303pǰ 1⚤p'U5< -LM@1> R# = R 5+4Q P 5;54Q 0S418<10C<1<P5 ;%5 y -1> LRP0p⑏5@@ Q#n @Tڴ5 A X 7P2 7P, H A : zb2S % @ %5;5዁P0m4P m$B1 Ԟ<>< p-LM@? ?勧PP? 3傧PP? /΄%+d @幧oPP ̠ ` Pۨp 40p ܯ Q5R5 <, LR_ = ( R $@T hc0@Ta0 0-@LOPb000,  0 -P1>pLP@`w1TZ1TD*1T4 1T ` %# = S =@S @ 8C8`2%2  b 2 W @ s5050 R0/g 04P`5@`0vl0T `0TT0P\բڠD0T/0:`2i 1i i i 5i i 6i( -L M `@0Pp```'0ㆀ0 $KP:$ <1SL`pPP 00S S @ @K@K 0@ K l0 PT0@U0[ [0p /K 0< -LM1Π P`UCĠp@ K 0Kuh 0P K L0~ @40PweT .! H< -LMt2). 6S00@ RA?< R 0, O0Sh.d< 0- 0D3_(0LS $@T .a0@T_0 0-@LOP_000,  0 -LM1>D 0Rp( 00 ,0  (0S ( 04K4 [30[ d18R`hU&h@ P0K< 50 0  0S0KΠ =0!U @P`j< 01.Q 0-@MLP 0@Kl 0X 0@0@ @(Ȯ1[#4S4  <0@㻮 0@K㲮 <0@@㨮 0@x㟮 H0@o㖮 0@f0 04@_ㆮ  0   0-LMP@ 0PH(oϠ  ^0  0P7 ^ H0P.U 0 %0P" I 0P<@ H0P7 0P (0" -LM 0S0 0P 00<: -LMp0P`2 4P@0 ph#?)@#H S=@3@/034SP@  -r!3 `/`F0`< " 0S;9X30@T8P 0 S00S" 0@TR}L, υ04|)>0j  ,).0@  ,`K,`K0`c υ0\!?@@,# L X0P10p|!5x1$!t! 1p1o0!h!40d18  <0 L!L1p2 0\$ R "0,"Ub c 0  | ӡK00S"u00S"p f pa,<:Ht5<|58<>; <<``0KP;xy5Xv5|5b5 c5c5dd5d5$t5<8< -LM00PS0`N  1> LP9P4P/| 3p0CS 3ǩ5@O \'^ 3 0CS 3:| XZ531Q Q1> 0-LZP@0 MZ1P+  H\00Z0 p-LMO0 SP$ , ` pkP7  X7P t7 0-_0 @SL   0MP7  XPV7 -LM1>4 Q@0`p5@ R' RR5PT X#X04  84eģA PU+00Kpn).00s[ 00S=  ,K[2[0 0 AS0 /Pp,08#x0g00 DPP! p 0@  ` pp}{@<P  L{00S x0P@ p5< -LM`1>@PQ0p Q{U UUi"{ 0@ǩ p*U =5U;5 Y P<1S0P@ ؠ<P1> Rw P-L@$ 1> 0`R_ {p[D#R T0 hz,0 00 0S D#<1S Y> -LMp)00P$K1 o< 2 @1T2K2[@@02KLD0 0&Z0@"P  P   @&S0S2020K2K@ 0 Y@' s5 -LM@D3S 5+4Q P 5;54Q 0S418<10C<1<P5 ;%5 -LMP^zp)7P0} B7Pw ).0@^ 1/0 4v)>  2 R95  0`;?*> P`  ()iy?? P`  O0X `r埠%@ %5;5y0it /0` @D \0 @, 0E@(t)P< -X2LMQP@`pr42Q\*,2QH $2Q p%9 = S# =@S @ 8C82:%2  0 K [ 0[40 2 X 0 K [ 0[40 p@ p505%@ 0 R0_ 04Pp5@pc0x0Q l0Q-P0P\0S\<0Q/ 0p{2i 1i i i  5i i 6i( p-L M` 0@Pd(y_0 K@ʠ <1Sxpnl< -@Li00%P-%UPRP9P `PpPP`PpPP0D36r@Wb0r:WbꤠP BP02D X(> R(ꎠP ,P02. xB(( d<(xP PR ,-( '(ꈡ<<С<<<<< 0-LM<@0TA KPK0K 0?0\0K00K0K0K@K@KK@KȡPPP[ -L M<@TA K0K ?0\0K00K00KK@K@KK@K娡P0 [0[4 p-L M<@\AdBT0 K  p@0\ 0K00KPK`KK@KKK兡P00 0-LMQP@ ?0@00K\AĠ0EKK@KPK0KKK0KhP0 0-LM?0@P \K0K 00KK@K@K@K@K@KP0PS0'0d< -LM0p5`, = <5 =?\ ! =@?\ 8RU@ P5<5% =@y;;1"  0S f;;!0U@P58D> -L M<@ \K @0\0K 00KKKKKKKԠP\ȧ'؝< -LM 0S4 0 0嚡P 00Pf -LMPp@ ϨP\R!1 @1/@32.1/,3s0s( KbP &(``0@V(PM 0 SA00Sl" 50`V$@Kw`eP &# '0 0@5$!0 10!X 0p_ `0  v\ Л00Sp"00Sh"  4b&< p-LM@? ?`?PP? `6oPP ̠t L P塛Κp魢 #p馢 L5,0488W p" K P ` ]T@5 M<5  8  #8 5_ -LM @DLP/DP T!D h؝< -LM 0S4! 0 0P 00: -LMpDBP KÙP  #! `HN0@VMd2S h2S %0P!&>f  PP Sq%N@`P $ # x1!0@5$!1! 10!X 0p 0  q P 0 S00Sh" 0`V00Sl"00Sd"  4 阣<8<`<<_<<5558< p-LM`@P {0SdDbXX PϠLP0\<D phЕ9pho  -@Lp2`Shpf0P0S 5@ n00p02Q Q = p-LM@R40+P`  0 @pKNP@ N1+(   N7p 0< ?0-LP $@7P  0S 0D嬗P7  xP7  -LMO0 S   D吗P7  \P7  -LM`0p,0 0PS0 5@ R- R00R@@T 202ZPU ̠Ap0  @z姖pპ"04B,0K 宗, R c 0 4,0 O,0 S0P@ 00K@0 ,  o $7P <P o  * 0@ȟ5< -P =@LT`0p o5X;E5 XXmho 0@  \!X t僗 0@ M <1S >ꠞ< p-AMLAO0P `0N P  0/"-C4? 0@ t\X  帖P202p鿝 ]p5 < -LM@ = R5+4Q P 5;54Q 0S418<10C<1<P5 ;%5 v -L M0p5P@` n@#΅ 0@ - 005  00 @ 7Pp ]7P p2S %@ %5;5in P  XԞ<< p-LM@? '>H委PP? H垔oPP ̠p L P 6p )p ȟ5,MOK}ሗP -0$S ~Pz ,@P(0!R@Tp2S0 Hʔ0L2 @TPHĔP 0@S 0TL2s p屔PD嬔QpWt"qrl |2se lYp J_KNKD 0^PIK@L5 838ß(KJK#N@ # ?#P D2"0@5$!2" 10!X 0`_G2  glD ㅑ0 0 00A SA ARa0A7ASWA? 02@0 T0#N pᮔP 2p@, t"|"0PT t"r |2s~pWspP 0 S00S|"0@T00St" 0   00S0L"l27PP 0 S ,(0!0p"(1H2p2 0S SY 00S0 0S꘍:,  P  ||  0S2020K# p '5 -0 5P=5U@xLPPP7PP`PpPP`PpPP钒rIbꌒrIbP P垑P0P2ꠙ ꚙ P 刑P02ꊙ xꄙ dԒP xrPxRu ,o , POPp  ,00C,0 , R ,0 S0P@ 00K@0 ,  i 7P <P & h   0@ꠥ<d5< -LMP?@pT`0 h5V;E5 VV  0@a uV h֐(K 0儐 P(0S00P@ <1S h G `ꠞ<Q Q? -RLM R0K R P坐 PAq- $0A0 0!q "䘒f -LM 0S4 0 0嶒P 00: -LMp@8` PP#?P #$C2/P438C0 K~PP000400 倒4 =080@0<0 `Uk80se <0sb @0s_ h,`K 0PPJy = t@1tp!51 !!$11o0!!4018  <0 !1p#  0PG$ R "0"ER P<S0 3g Če g03^4⎏P  0S 0S 0PU0S@0S80S0S<d6P;;<5 S7P6 o} u m GH0S D0SP %@ %5;5fL0Pf C <>Ԟ< p-LMCPT p3 F, >4`#0@  hTphh'Q Q -LM┡3 S`( tp5 U  <5    (0S (0K )[ 0)K|RU@ P5<5  0  0S u?0 00U@P5 j< p-LM3`SP4#8 #4D0 |P&4<H0 uPOD0|  ` 30CS3pĒ ,`ݓ pL5,P(T AD0  @^303刊30CS3A3D03݋30CS34Sh 08fhP,0K ~ 04 C, A? R 0P@   00K@0 ,  Pc0 E7P <P  0ac  0@L5< -`L3PS@pkkc1TN1T:*1T* 1T p 4c5 - R @R @ pY lQ @ k5050 RtI tx4Pp5@ tl0T `0TT0P\ծڬD0T/0p2i 1i i i 5i i 6i( -L M `@0Pp```b0 $KP噊$ z<1SbR;t -5@=P5LUPuDP9HP `PpPP`PpPP02rAbr AbsP HP0H0 p'  \!]P DPDP $  ꬟<̟<< < 0-L3_S2(0S0h"C$@T D0@T0 0-0L#RPO 5@00"000-C000,  0P3S0叄 P-L@# 3t`S_ bpB"R T0Pha,0 00 0S "<1S (>3/03m -LM@30CS3hQ 0-PLM@P 3 SQ 0 @      K0 } [0[Ă p-PLM@`P 3SQ p @ FĠ0 K K`K     0SH08 #\ 08S0 S ᬖf -LMPp@ PHR!1 @%.@( K◉P (PL"0@U5T2S X2S \2S\Ba0@;H!\0D1$!@! 1>`0!5X0p 1 PZY1XP0P`H (P 0 S00SX" 0PU00S\"00ST"  0P@ >1+(  : ?7p40< ?0-LP $@7P  0S 0HˇP7  Pԇ7 -LMO0 S  l H孇P7  yP嶇7 -LMP0,0 0`S0p 5@ R- R00R@@T 202uPV ˠ <1S 2< p-AMLAOP `0> P dXX   P202p Dp@5< -LM@0 R5+4Q P 5;54Q 0S418<10C<1<P5 ;%5 㱿 p-0LM @R0P5@ p)_`7Pl 7P `2S %@ %5;5ph^ P Ԟ<< -LM@? &>LPP? 3LpPP? τ$L @p$ mPP ˠ` ` PFsR 4fK G 5\5 <, j ;H0S D0SP %@ %5;5Zh0PbZs <+ & /<.>Ԟ< p-LMCPT pLD <`(00@  \T ph\.'Q Q -LM3`Sp`t5 X  <5   o$  |RU@ P  0S-E P  0@pU@P5<5 Y   H@ o 5 &* p-LM3`SP4#8 #4D0 P&4<H0 PO̠D0x  `z姀30CS3p^~ ( `w p5,X P7P <P G X 㠸 0@5< -`L3PS@pjX1TM1T9*1T) 1T p W5 - R @R @ pL vD @ k5050 Rt4> t 4Pp5@ *t}l0T `0TT0P\կڭD0T/0Ap2i 1i i i 5i i 6i( -L M `@0Pp```.W0 $KPA$ |<1SSWR;t -5@=P5LUPDP9HP `PpPP`PpPP02~r5b~r5bP H}P0H0껅 p굅 \P D}PDPꦅ $ꠅ ꬟<̟<< < 0-L3_S2(0S0h7$@T *90@T0 0-0L#RPO 5@00"0007000,  0P3S07y P-L@# 3t`S_ Vp7"R T0PEhV,0 00 0S "<1S 3>3/03 -LM@330CS3h p-PLM@`P Q pV pU UPpU] U 0ll P`P`0U  XU Q_0UPꜦ<:B7F p-PLM@P` 3SQ pUUphU] U 0h h`P`0U   U Q_0UPꬎ:zp\04 3R 3R] 3RQ 0T0 P0  @T*zPD 0 Q003T PQP 20@T\T0s x$ P0s h 0@S000X0 <00l@0 \0< 0Ÿ 00 0D , 80 H 4 (P w"2XK-D0H0  1R080 <  1R ʤ1R ʘ1R 1Ր11R 1wP 0=wP] 0S 0@S0h0 h@4 wP@ } D4 w0`80 Tl@0s; 4<0SV w @8 0`T0X0s) T0s$ 0\0X04\0 1,H 8p 4 00 < L D @ ,P P@ } `0 tL!L1\K `4vP 0 S00ST 0@T00SX   r wP@4 h} e4vP 0@S 0T00S@  04L04t<<ܨ<<<ʖQ: 1ʖQ- KQ 0     008#(< S SwP0 LP0 S  S08#(00KQ Q Q ʖ Q K Q Q $0Q   -LM\0@S@0s D0S V0pP `K0 V0PEUU V0P fL岪LH4@DD0d @onP @ > <@6(< 0-\PLU@ 0D0S oPDnPHf)DPv v ,0x0f  y Hf t<0+S`d L ! T0S4XT0 hP07jPD 02jP\ 0) 0X Tu!0@ 4<0hP@  00逘f4<`< -$0 (("L逘f 0-@DLP-\P&80P<PTPHP `Px00x00f㴥0`0f㯥0H0gjTiTPbj<i@>lț 0 S200S1+ $0@T 00PPP0  =h0 Dc00S|0 00Sh0  P<8<""" "!D)H)\)")<Ԟ<ԭ<]"L6""< -LŸ2 RP0p  0  0SXb0S>:( =@&J孰!@00CS06k 0S A ` 00C! 0Pa0 S AP?AP#xAP =d1 beX :dP00;l O4l HeX "dP00#l 7l 0leP  dP00 l hl TꙠiX)\"]""\00P p0pᴠᶐ,0@0000@ )|@  p @3d CD0P@@>oE!))) )$"w6' -2LM 2Rp` l2R `2R "\0PH")<p 0 00@0ᬽ2@ BŸ   @c), 0@? SO 1 R 1R" ʌ1R 1R Tx1 @l1 p p 0 00 0 1R 01R0ASp6p6p6 p68p68p6(p60p68p68p68p68p68p68p6@p6 0P 0S0S? 2K"K,pKsD0 ,pK2K"Kk! )$"w6'*D !( -L@M`83? Q@ (3\ 3Q d3QA  "\ C0?p0P% W@-00 00 Rh2  )lŸ ` p&c 6l2P@ @    Bм%-(7 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&ㇼV?G K5Kြ]PpPW 0"K0C "K Ss6s6s6s6t6 t6t6s6s6s6t60,`K2KT0000000S:T0,`K@KBK! $"'w6)d<(  ! -t0tPL @`T0 0 q @ i40P 0(00C ` 0@ !))() p-QLMd@ P L0L 0 S ``p0` \!())) p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S ύpp=P 0P!))()<) p-LM 0@0 0`aPx Pl0PȔ:< -0@LQP 8:U` UUh :h PUHp  80  &b00CS0}g\" 0-(P@L00h)!`> 0-L0 L@78P 0000S0h]7ۿ!X) 0-L0 L@x78P 0000S0hD7¿!X) -LM -LM`  㿙HH!000 P  0S3-70p $  06@T7p0 岽@6 ( , %0 00CS0̗XdX"X)Șf`>< 0-@L6( 0PS 0P6 D) -LP6pT`M0@\@8  h\00h6D)H) < 0-@L68P0 S(0  0h6 H)D) -LMP6눠ᄀ `|pV p 0 h @^00  &, 0S00 0  oO6 lL)P)07!0K$K#@K(@K'@K%@K, 0S  +j d< -LM;@SP `Ktp c0 S K U0 0KP  [PP -"L|M0PK ,0 }ϊ  0P@0 2 ,0S ,阐Kl "\2 Qh00KL2 K@K@K 0@ K K0K@KOD0 !0K*0 0K0+ KKK0KK@K 8S@K S000K1n p K`P4@$(p(W @@P@`}' KX1d@ 0.K K0K-@K/@K l vP@  P@ IP@P  0PP@~  0P@t  0P@j  0PP@a  50Pw@Yj:t<  * + -LZPH000q:j 0S 3 1PK [RR 0Q0  堬:R 0 ;S K 0:P l0Qh 0} 0S0;(V| < f j(62>68< -LM` uY0PU@0p pYP 0 S00S*0PUPP i% 1P㪲1  1.001@XWH7PWTG`+12 |1 pػPO*. *rPU@ڪ?07 (`Ļ1!51 !$1!10!\0T(2 x:(" p >X0* j嚒@U0@ +@L0 @000<<00S*z xs<< xfx9h666t66̖6Ж6 | : 0-l00@ PRL ؗ P :S *US0XX| Q Q  0S00| 0-@R40+PL  0 @00vP@70 1+  70 -k>PV0L@0~  WP@7 W0S70  7P6 0- ^!L p@`Vp X WP0 `WP10A7 . p-PLMU`@P0S 0`S 0SPU@pW` ` -LKM⤒pP2, `Z0 ,0S p,5A0AS R RR \ZV ,Ÿ,B0  @~WV X>K W01S4 @ 0 $ B@10! g@018 0 08 < 0@/D   7P? ;S80@@004 0 Č41Ȍ @̌0 : .0P71H7TG Xg ON>X0@|1|!5x1(!$1p!p1 01 !( pݶ  wD1(",2<1x* (200!  X0@0!T<< 1 1!|0, \gfffV;,< -@L^Pp| `/Mk. h| zj M -LMpR@`0 RR Y 4V 0P@  R* P+ `h+ Bh+ 0@k5;5+iH*L< -L`IMp0R,0 4 0 RR,0 S ,@R ˠB04  @Q4P HR>K Q0!#R0P UE 8!  0P@ P@n 01\ @0 00U 4 8<#8:#:0 0  *<PS80 @ k<1S 5  )PP)   P$NQMP@ l;h0/. 0bl;h8,0 S 4,倹@@ 7KKl  .4 0 ǚl0$ .4 00 \  V 0-0 @L$8P0 $  0$0h   0-0 @L$8P0 $  0$0h 0-8L@0P 5 ( "(  0hDPd6l6t6|66666666666666840,($ lX;tX;|X;X;X;X;X;X; p-LMPK 0@#![>  01[8#Y#h #͠##: 0P`/̄<\ l0.  0/- <0p -L`@0@=$cTdTDP@p  @~TP 頕:X; p-LM`PV@ V@@|0 L\R@ ZT@  8 , @ ph  0-L@PUT T 00CS 0h) -LMPc0@1 @T@0>S @#cTdT  "bP7l0'OlV.0 NH px 0~pm@ !0@T`@pZ| HP S 1 > 0 [GPU1 >0 QGPEPX8P@1. 4A 0 @H GPT Q 5QN n   >5;5%@ %T7 S(  O `O LD\:"VS< 8 -LM` ?| (K$K(K^T@L0p 'KP#K @&@K%@K"pK!@KG G: (6 -RL+-΁Mp∀   o`0h @ 0T0@> @@ ʇJi 0. o鸯 < > -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 P $000S$ 0040$0$40D`(00(0 6|6T< sr-LP`p  0 $@T uv u 80U 0@Tv D0VW WP  |<<ȴ< p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@孶< -QLM@8 0C?. B"0 <8< - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  h봗:@< 0-T L0P@K \  0 @0  P=$8P 8$8P <8T @ $8P@40  }T00T0 00h@T0 00 T00T0 )X <#3  \0 + ;8#(0$8P 8T0@ \0  ,  R,,$8P0 6>h< 0-P(0L0T0@08T0$P0 4PL0 0h p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@0ppp p-LMT0@![Y$80 P8}`$8P0 4P ` cVH0S T0  p8$;P8 T0hTQ -LL  -PP 00LR`p @$<0 T ,00z@ÇhM, \00Q0S p-LMP`,0@0P 0P 0PPP[0h Uh0[P`S `p0S 0-T0L @PP X0  v k _ U\0   B 1   X00H  00hXT 0@ T d00<0H 00HT 0@ T d00<0H0 08\0HT  0d0T 0+ )\0T H 0d0T 0+ \0H( 0H0& X0H0& X0H0# X0~H0# X0sH0"iHPÒQ- -LMT0@hF0S 0 ?C5A0P 0S0Q  0-T0@ L08P0 $4P0P8$ 4T0Q0    ; S 0@0 40+0   P00@@@T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000- 000008P0 $4P0@8$ 4T0@@ \0 3P   006    0060000 0S  < 0060 006 0060@006 000 00608P0$ 48PP0$ 4 -LP 8: p-LM@P`  |(0tH0 L8 P`0 T0d  $8P4 00 X0pph8:<,: 0-(0PL@ F 0ES 666x6 H0"S 00 H0"S+p H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 8#f0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4& 8P0 $4P0@8$ 4@ 0060 006 0060@006  0060P08$ 4@00000000006 0-@L8P0$ 48P0P $4$0 S8P0 80 -LP \: p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph\:C2<0 S T <0 SQ P0$8 40 X>k8 $P04<+Q0  T0` `  Q' (Q$ P$80 88P0$ 4 p P$80 88P0$ 4*98$P 8p, Q$8P0 4\T0  8P0 $4P@8$0 88P0 $4 -0$8 P8$08P 8L0 | $40 S t)0$8P 8L0g:<: 0-@L8P0 $408$9P 8P$8P0 4 P }U0 p-LM(0@`PH 0BS 74777 H0"S pMQp H0"Sp H0"S 8P0 $408$;P 80% 0 8P0$ 408$9P 8 p p-LMP`0 P0 ,08P0 $4P0@8$ 4 ,00,0 00300 00000pT000 0 000 00000000 00600000S p8P0 $4P0@8$ 4@ 00<000006 -LM 0T@ְP  @%#,00R0S ? p H0"S0% T -LP l: p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pphl:<`: 0-(0PL@ 7 0ES 78777 H0"S 0LP0 H0"Sp H0"S 8P0 $408$;P 80% 0 -L(P 鐚: p-LM@P`  tB(0lH0 L8 P`0T0 $8P4 00 X0pphDꐚ:<: 0-(0PL@ 7 0ES 7(777 H0"S 00 H0"SWp H0"S 8P0 $408$;P 80% ^0 -PP0 @0 ,0L8 P0$p4P08 $4,0 0,0P0`8$4 00 0,   00300 0 00000 00000000 000066 -LM@)$8P 088$P 1<8 -LWP ̚: p-LM@P`H  tq(0lH0 L8 P`0T0 $8P4 00 X0pphs̚:<: 0-(0PL@ 7 0ES L7l777 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000@000066 -LP : p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pph:<: 0-(0PL@ 7 0ES `77,77 H0"S 0:>0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 4 00000000 000066 p-LM 0`0@P 0?.AB"(0H0 L8 PP00T0P0 $840  X X0 \0  ph,phƿ$8P04\ <<< :X< 0-(0PL@ 7 0ES 7 7t 7,!7 H0"S 0hl0 H0"Sp H0"S 8P0 $408$;P 80% 90 @5$ 3S? P @ -LMp``(0H0 08 L0Pp02 0d T0` P0•\Bp 0\,0R 0*Q0 H&ՄT0X0?  R;X0 X00 X0iA0x<,:x -LM(0@p` RP2 *R  H0"S 5 `2` ,P`0d 0S`0T0``0T06R H0"S H0"S5 0T00p20 ,0qQ* Q T00T0QL0•p ,•00p \0a6S•00 \2h ,•00h \2p ,• 88p \06S/ 2p ,•<?0p \2h ,•00h \2p ,•00p \06S2p ,•<=0 -P@ 0LP 0, 00•` p,0S,0`0,02p , 2` , \& ? A QR\ 0000020 ,0000000020 , 00600 006 9 @  X0 0060  X0 006 X0  006000/0 SS2p ,•00p \@006  0060000  p-LMP0T @`P V @•` ,0: S@ }TppT00T0p20 ,•070 \20 ,•0<0 \2h ,•0h 0\X0 ••p 0p 0\2h ,•00h \2p ,•00p \2` ,•0:` \ -LMPh 0@”,”00h \v2h ,”00h \ -LP D: p-LM@P`  ޼ 0?>C2<0( H 0L80P` 0d0T  $8P4 00 X0pphD:<8: 0-(0PL@ 7 0ES ,7,7|,74-7 H0"S 0fj0 H0"Sp H0"S 8P0 $408$;P 80% 70 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000000066 -LM@<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -LP 鼛: p-LM`@P  ̻(0H0 L8 0?>C2<0 PP @ 0 0d T0P0 $840  X X0 \0  php$8P04\꼛:<: -(0L@`pP RO GR' K 00R <0S S EASW@0SS, W00R0S H0!S  5 8$P0 4`0d 0S`0`R H0"S H0"S 8P0 $408$;P 80% L 00SR 2737373737373737373737373737373727@0$6S8 0P8$8 0P80$8P 800S`$8 0P8<$8P 8<0SO0$ 8 0P 8D -PP 0@, 00L8P0$p4P08 `$4,0 0,0P0$84 00300 000' 00000P0$8 4  P0060 , P'  P 0000000P0 8$40 0S   <W000000060 P0060006 P  P006 P0060006 -LM@4L0<0PS<<$8 88P0 $4 X0T<C3 0;8P $8 $8P <8$8P <8 0-@L$8P 98P $8PP40  g 0U0: 0-$0@ LPy<00C*S.:7487D87 :7D87D87D87D87D87D87,:7D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D87D878:7@0SSs ឤPbP0 P2 X RM   08P0$ 408$0P 80l272$8 ;P8 0$8P 82 $8P 08$8P 08$8P ;82$8P0 22d6P0h! %;ؽ<  ܽ< p-LMP`0PS@(ph !0$!8PP81S긜: p-LMH`0PS@p!0$!8PP81S: -LM@P8$0 88P0$ 483$8P#8 8P$80 88P0$ 483$8P#8 8P$8 0 88P0$ 4848$#8P 8 p-LMH`0PS@p!0$!8PP81S8: p-LMH`0PS@p!0$!8PP81SP: p-LMH`0PS@p!0$!8PP81Sꈝ: p-LMH`0PS@p!0$!8PP81Sꠝ: -LM<@Q 0$8 $80 P88P0 $489$0 P88P0$ 408$0P 8 L -LM@P8$D0 88P0$ 498$0P 8p -LP : p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pph:<: 0-0BPL@ S \@7|@7,@7@7 H0"S 0z~ H0"Sp H0"S 8P0 $408$;P 80% L -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000D 00000$8P0 4( 8P0 $4P0@8$ 4@ 0060  @  006000600600068$P0 4     -LP H: p-LMP@`  (0H0 L8 P`0 T0d 8P0 $4T   0XX0 pphH't|H' 0l|H:<<: 0-0BPL@ S hD7D78D7D7 H0"S 0w{ H0"Sp H0"S 8P0 $408$;P 80% I -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 0 00000 00000000 000066 - LN5 Ó0 ?0 0 P 000< p-LM`@P!0 R %( H 0L80PP0 0d T0( Rp ph $8P4 00 X0pphꜾ8P $#R4$0 h0EPpb U' ! 0ESWW 8P0$ 480$:P 88P0$ 480$: `.8P0 $408$0P 8WW 8P0$ 480$:P 88P0 $480P$0 8P0$ 480$:8P0 $40P$8: 88P0 $408$R@;000d 00400 6 <80`05pP \p  (0K80O^W P(@,K@*s=<7L7ȉ7 0-L@PB  ,0\R0h (0 ,, -LM`4 -@4+0|0 S0  ;T#000d @3R 43R,3R*$3R 3=B 0CS000000 405 2R2R*2Ro2R25f:0600"SS22`00<0880pW P uP㬀80pO^W Pp0t@ 09 l%唠04 p5S A,0K0K4 @pp5S P p5S `p5S4 9pt 0@ R0 00R:0R1R1R 0R 000R| 00Rd`0R] _:=BW0RW 0RS 0|0R0L0RI x0d0RD h0s=7$$$!$$$$K$J$.077t=ȉ7$&%o&P(v'qqʄ -LMp|- &|0S 00X"A>000d 0 506 0 040080* 2 `0<0 2P_ q1P[ 1PX @ ptS 0BS5880`VP \ 080`O^V Pĕ\  (0K Affff -LM8 P8p0@ tp0@tD p0tH , p0tT @ @$41 0@00 4 @98z48 < p,@!8,27, 2<O^< p4Qpt 0@ p@t 0D pt,0H p@t00T 8o4! 0T0` \#X3 QQ H3Q @3Q 83Q 03Q (3Q 3Q 3Q 3Q 3Q 3Q 2Q 2Q 2Q 2Q "2QQ~ 2Q{ 2Qx 2Qu x2Qr p2Qo h2Ql `2Qi X2Qf P2Qc H2Q` @2Q] 00"SS RO000 0R0玁0 C800 ( &  1 ,!`, 4< 04 |< R <Y6 @9-<  0R0` D` @90 0'0  R0000 0S0:0 0 S:'0 00'Α0 0 00 X%&$!$J$K$$$$$$$o&'P(vf -  808 0 0 0 也ffffE-08 P` @TP0 p0P:P 00^0:0SS00Q  00QQ0 0Q꬟ffff 0@-P@ 000 000 00蹟ffff -LM`4 -屜4|0 S0 1!00d 0 405 1Q^ _1QZ 0601p`0 080< t@ 8 8 80pWP D g0Pᬀ 80pO^W Ppt80@ 8  0l%a4pŕ\ ,0K4 @0K@?^\8 8 pŕ4\ 00,0Q0s=7Attd7t=ȉ7it -L MP`0p0t00 0H 40 p0tP 0p@0c,Ÿ2t@ ,  p,@ pWOYmpt0H p@t 0P  ! 0T0g! 00 4 2 00, 8  R00ą 0g a 12  07\00L000Ũ0 ` 12 # 0# 04h0 PQ 0 0Rg0 0⌛00g0n!;i!;d!; tu= -LM4 .04 S,0#4080 8 3#Q00Q@@Tp3Q 40  0 p0P p0 ` <S  40S 3&P 2P }2Ps 70604]0|0 S0  60+S2 d000 00"040` <588f80`V P8 P㬀80`O^V Pp0@ t f0 l%804 p5S A,0K0K48 @p5S P p5S gp5S4 80p t 0@ 0S 01P0?S嶚0}岚0y0S0P 0Pk壚0j0P 0Pa 0  p0P p0 ` =$Sd1t0s=7`7t=ȉ7Hu=Pu=Xu=w1G1du='21 -LMP@p0H tp0tP 0\"0c2#ppf2  ,2  2Q2 R020ĕ!0SQ00ė`, `VYpt0H p@t0P  ! 0T0f# 00 ? = 00 6 b"f, Q0|  Q  Q  00| 06\00L000Ř0 ` 12 # 0#d0 ,0 s|00Q fjnŸfɟfԟfܟfןfϟf -LM`0p @3fp1tQ P*.0S,0#4 $P @ L!L1V0P4`@0,!QVP5Ť4=ڤ4S$5 V . 04 0 4S@,0K0K @Y4S 0oP V $ 0Q  0$4L !Ls=(s=I4s= 7t= -`LtP pW 0tp8 pWP@4S PONU @UU P8 8 p -`L-P`p@0 <00 |@8M80T =80@Tt= -.0LS,0p#4`P@ P $c@ @@pܘ|0 S0 L!00 @!QH @41Q' ,1d00<0 1 `04 85 80PU@ 4SONP @80Utpq 0h4*U0 00U|0pts 0$pt{ 06 D0Q40 00 0 00s=HF7@77I -LMpP ,@XOYo ! 0 T100,0  200Q 0S0@0 X10,0 00pStXV T ,0X[ X  t!s p `0h!pts 000 p!s t `RR0hƁ60S0hp0p h0jj#ts 0y ptuP 00  fff 0-0LSP P@ tp\t0p0P e0htW pOt0p0W 0 -PLpᾗ幗|0 S0  0 0006 d00<00 58pt4 `0 010pt ,t p000pt !80`V@ 4SON` @80Vipu=<77 -L0M3j. 1଀,0R#4 4 0!40 P1Z04P .JP 2p`@, 0 pt@ T4 0 40S00$@2,0K0K 4 @4S  40G$(s=(s=.;s=s=s=s=u=ȉ7u= -LM p4 , pt ! ,000 ,`0 o R0  0! |,0So[4 ! 0T00 8 I 00 0"` BSP8  H0@S 00810T0CP   600x!0t! 0 8, 0 0., 00 +  00@0 00  00 @108HX0C$P0 $L  0 00h @108H\0C$P0  $L  0 Y.;.;.;.; - 0L @p$ PQU U P0@RwD@s @T` @ :0 SD :h 0$P P8P0$ P -L Mp [H<2  $P @0$ _ H$ 0UTb 0 $ @ P00Pӕ |Ε0 S:Ӑ0Ռ0w0|0 S00 40 8!A> 000d 0 506 1!`0080l <. ,0R#480`ㅀVP d\`  (0K80O^V P@,K@y4S ``傕 0$@  0$0@ Ps=<7x7L7ȉ7u= p-LM@P`u  ,0\R  h0 1t ph 40 ,PP,x!; -LM`P 0,  RdP?0PB!01x@"80,01x0!0A|K0pS 07747L77 i0 i0SV   Y0S1 0  0@0XT22002 Ô0#P P i麔帔 0 $  $ 0 $ 0 $  0T $x!;Pv=Dv=lv=$0 , H$0  $ 0@ =Po10 FtA0|0 S0 4 t!A> 000d 0 506 T1T!<`0l 8 0(K P  0($ @p0(`@ (Px W  @18 3d1TP@ 0S 4S `TW DޓPu=x!;s=<7x7L7o=ȉ7p=0p=p= t< -d!L`1M, H `, L1L0,0D!D0P 04 , 040 8 8P1 @0e!pS1#D 0   PP%U4 80 0R4 80 , 0 , 0, 0 , ||0,t t0 0 0, |0,0L|0 oqЍ77T7x!; 7d77787v= -L03a`^q\0@@L0 lŇ`#FPU$T l%?fw= -L M1 p`$$x 1,0 $, @0 Q 1D!00 0 0 P$  o04 <0M>000 P$013$0@ P⊡ X00P  PPX, 001  8  04$x!;Lw=pw=fw= -LMx0@  001<@$0 01 $ p-LM0 h0 P@` 0 <@Tp 1 0  -00L!0D $ -40LM@0D T -00L!0L $ -40LM@0L T -40LM@0T \ -LM`P -D2p Q0 Q0 @0r  2 P@c |0 S10 !000㜡d @40 0`<58 @l(DPC P1P!  Dݑ0 8ّ4( K,0KT 0 0 04Sw P 4S 0-pt 0|娑,K (0KX垑P囑|@D嗑|@w=s=77s=s=s=w=w=ȉ7w=x=4x=t= -LM810,0 p P `,@0(`VOp0tL 01pp,0wpP  Q10Y ! 0 T 0w 0Wp <040 P0S RQ0m ff0@-p0"R 0\P0X@00"R  ^0S0, 0R%9Mjf(0(#00"(R0 Q,0S009 -LTMpt0J po0 -`C4  0P p0@ pD  0lK@0 P@ c 0S0060 0庐x帐|0 S0  L3P00D#D3d 00 040< 85P7770707d72t`0pR 0 0pt0R 8 80`V P DP80`O^V PV0 V, 0 4S @Bp0KtK @L4S 0bP V  ptJ 04S `$<1t`0I p00pt0I d1t`0P p00ptP tpR t0p0tW p0t0W p0 Q0   0 p0@ p0D  @ lKP00   6(PV0 60@ 6@"Mjt8 0BSRrY0 60m0ꅀ@0IS4s=<77x=t=7 -L MPZ `tp@0& 00CSi777770DSW1堑, 00 p,@0pWOXof ! 0T p0 !t@ 0  00 0bZ30 0S00ą  0p !t@ 00,  Q 0S0@0 0 T DD0D@@0@8垉0000ꌠfff\flfxfĠfؠffy=ff f -80ZLP `@p0 $ 0S 80`ONVp @ 0S0 c0 Tx= 0-0LA0 0T0@ $0 -LM`d(`84 PP P8P H8P @8P 88P 08P p0tP 8 '7QQ 7Q 7Q 7Q 7Q 7Q8  8 '7 QQ |7Q t7Q l7Q d7Q \7Q 80 D4000 $7R 7RR 7R |0S 00&A>000d @4@5 Ɵ RR VR vR R RR X6R P6R R R R R R~ <6RRx R6u %5QQm 5Qj 5Qg 5Qd 5Qa 5Q%] 0`  <08 5RRN 5RK 8`%\5QQe P5Qb H5Q_ @5Q\ 85QY 05QV @5@%<545  8p〆  WpPA` t 0pd@0t 80pW 4RR |4Rᐄ 80 \0 $0 T0 $0 T80pW P P#80pO^W P0h#d3QQ X3Q P3Q H3Q @3Q 83Q pt80P 0"2QQ 2Q 2Q 2Q 2Q 2Q 2QQ 2Q0 8 '$彇 04 4S 0`"QQp $2Qm 2Qj 2Qg 2Qd 2Qa 1Q^ 1Q[ 0K4B ,0K@~4SI !1QQ% 1Q" 1Q |1Q t1Q l1Q P 0X!QQ' H1Q0# 8 4'8  0 0QQ 0Q 0Q 0Q 0Q 0Q >A/>:4 064@0K:r꜀0 L0P 6@060000:00GhMhbiMibuuRurs=3M8M0M78!f&f+f.ft=8T8  8l 88 -LM`0 t3RR^ h3R[ p,@PpWOYo`! 0 T +  2 "   0P2 2  <\W  p !t` 0 P2P"008 $2$"0080 $p0tP @ ;:   20S`1  1 R20SU!0S00Ƈ  20S T1  H1 R20S020ƅ(!0S00Ƈ  20S0 - 0 R) 0B0 T0 G  000S |0  00S 9 ! \00 0B0208M0M7f1f!f&f+f.fjn - L@`p0P , 0P^ho! 0T   U  0S00 -LM0` ,8pWP @4!S PONU @;2 j\  0p 8괅4y= -8 pWLP`@4S `ONV @4S 0 0QQ$ 0Q! 0Q 0Q 0Q 0Q 0! $8 #P8 p 8p   hMhbiMibuuRurx= -03a`pM@ 0L P m0$0 10 T5 $044 \ -`pfL  P 0mb0$@0 0< T 0\ -L4M@p V7<6 ,K P- 0,$4 0%Q] c5Q5Q:5Q5P 5 D p , (xx0S 40S 廄幄P0K  0 PPPP|,墄 0x,00 0P PP{P 匄0 僄$4d  005 0$40060` <D4P 84P04P:(4P 4P l 04\0H ,00808 3ZH0#3L P0Dp4#P D@  03jx1ଐ 㜐l%|p 7P|H 0 1cA8 4 0#< 0<0/8000 P 0`< PLV 00P P`@PD LV8  01ca 2 0 <0&.<000 P dD ރP80U<0/L000 P@  ~0<@ ,@=P0<0@ \!0\ sꮃ1` \080t!t1h l0Lh1P \1P T1T1P0,1` \0(1P 1=<@0CSQ 0D0 D 00Q 0Q:0Q00Q 0=C0CS88d8x8@8@8@8p8060H1 < `008!pS00W80P \ (0K80pO^W P  0 0@d  :9d x@,K@ĕ\  0 4S 0S00s=<788 -L,M, "0 p0t@ 4 p0tD p0tH 08 p0tT @ @`00 00"0!D0 4D0` 8 n,0 < 4 8 ,@4YOpt40@ p@t 0D 0!Q pt80H pt0T <Q,o@0< 0T,DpT10 0(H0 1L0 0H T0 40!2P 8T 40 8 ( & 0S!PL0 bH1< 0h< p0, t00  0200 00   H0<0< 0  < u000r.;.; -80ZLP `@p0 $ 0S 80`ONVp @ T0S0 0 Tx= -LMP `h21p@t$ Ps  $ 0@ cP tqml|0S 00t!A>000d 00 506 P1P!p<0`0l 4p8p 0(K P G 0($ @0(P@ (Px X  - @183d1 T `@0S HX 8 u=s=<7L7%8o=ȉ7p=0p=p= t<-|0| H t0t L0P D0d 0`0 XX0X T0T P0P L0  0|0 Ѝ77T7#8$8L$8$8$8 - 0$L0 $ -LM@ Ġ00 T - 0$L2 $ -LM@ Ġ20 T -LM@ Ġ40 \ p-LMP0 `$x0@4 0$0 0 Rx0$ phi~ $  0S $$ 0 0 pho=o=Xf -LM2`p 0,  Rdp?DHP <2\4 <\0@@ ,0PS &8&8&8&8t(8 i~0 i ~0SV   q0S1 0  0`@HVT22002 }0#P P i}} 0 $  $ 0 $ 0 ` $  0T $Pv=Dv=lv=000d 0 506 0`  <08 -pP ?\  (0K80pO^W PH@,K@Tĕ\ 0 's=<7L7ȉ7 -LMpt0`@ p0P t@8@zh|0 S10 !00040 1d  6 `0<58uLp@0tP 80pWP \p $0K80O^W Pp0t@ ptP ,@(K@`s=7h78ȉ7 -LMP`p0@ tpp0P tp0WT X t0 07 80 0, 40 ,A)^όpt 0@ p@P t 0pWT X 00t,0So! 0T00"  0S40 00 0 55$$‘0 ,@ 0N,@ X000H000S8 00  04@0  Q0 -LM`(-Ty ||0 S10 !000400d  `0<6 5880pWP \ 080pO^W PJĕ\  (0K P@,K@ĕ \ 0V`s=7;8ȉ7 -LMPp0@t@ 0@ 8 p0tH p0tD 4 p0tT , ,p,` 0pWopt 0T p@t40D pt 0H p@t80@ ,\o)0,@! 0T00/ - 0 , @ 0, T@0D0^  0080 180 8@0A8@ 00  00 `04@0L4@  P@@4  0,,4  nj, @%;%; -LMt0p`@ -p?x g|0 ST10 P!00040D1d  `0<6 58u80pWP \ 0 80pO^W Ppt 0P .ĕ\ ,0K @0K@ĕ \ 0:\  0 W`s=7?8ȉ7 -P@p0L@ t`p, ^Vm5! 0T00  00 0S00 0nQ0A000  00 Q  p-LM 0P$, (@0Ƞ,Ƞ\`p . `0^ phP0$SL0V \ p(0$S,0 S.;727$9 -LM p$0P PE 8@4P,`K 00 `)P 0 0 `PH 00K P ('w0$ 10  (P wY w2 0< 2 5$ $@ $P< $`0 $0 $0< z=n=p)!ho= t<K /; -LMP:D QC< V4 EV 3 # 003 #3/ @ +hLT%…ąXÅP 'L"0BS񟗜E8E8D8E8,G8E8 0K c )2[ L"L"L22RD02z"02=?0?In ` 0Pg$MN$! @02>0 0PR45pP@p-P:Pt3 #N G/`7Dc9(6v'9P2x2S 0h5A0l4 0BApL2Shevv vv0 02>0T0u?G8P{={={=P8 0-5L=@S@P 00 R 4\ yP 4\ 0S418<10C<1<0S05&5;50| -LM@`0P 05Pp 1TU1T5*1T" 1T p%!8 @ h4A8#  @ 8C8h4 % N@ k5 0 R#05 f 94Pp5@p DL2S y [90T 0T-P0Pp\0S\X0T/0;p8P  u}2i 1i i i 5i i 6i({= 0-@L\2P ,0( 050t@50@50 |= p-LM@N0P`5u L2S11,, !<01  B@!L2 0CSUK8K8DM8DM8 -LMCn@0p`\2 ,L2P S01S 5@ @D50D5VTDH0T v5@ <1SI> p-LM@Po~00 0  R"0   X20CSL2S+0.060p00dS% S = R06 000S p K 1!1[ 0<0b006#00S00&0|~ 0-PL 0 SD0S6@P8P8P8pP8P8P8P8P8P8P8P8P8P8P8P8P8P8 00/00@XC00 06Sx0 h0 T T006S  0s 00 00#%|= -LMX20CSO K  K ![  1[ ; S ; S 1[; S 1[; S @@@ -LdMSC 0S`h ` d t  0Sp 4  A 0x Ė ` P@  <50<5x08#(00CQhŖTh \ Pl h x#\y$,0@00$ 2  tP !P@0U0Px l(0l \ hŖhŖ\TM X"d00`0`00xĖ(0S40 p 40 t$Ė(0SL ^ \2^1! 0\L2 S ` = R` $0 ( $0 x (x0"00b0,0 \0KY X| * d\0KpP0tP d  4T K4 0 00 0P|0U @PX :kh0445$045x$705700588 -\2LL@ 1\`! ,0᳠ X Up 42 0!X \(P"x U/P0\"L@\^P \p3U> 0P@ EmQ88 0-LPX@0h+ -= RL R/+ 0B>>Q PL5H%0bSL5L% -LM\2L@l2\`d" ,\2L–@\P@"C.,U \2L"rR  ,\2L"聟QR@  ,T\2!,\2@!,T\2!,P\2+,\"@0+\\2L"R  d5\\2L"R  d5\\"d5 \\"d5 \\"0+\\2 @,UΆ@0 L88844(4 404 0-\2LP,,0@% 0 000\,\0 -LML2 S, `0pZ BTP @ ˯K [0S5`<5V P sBT`@V*K 0r(L2S ,0S ,T\2,,\2@0,\$?  2 \2,,\2@0,\\2,,? @ \2@0,\ j|= 0-@LPk L00 R 5@ L$0CJP0h `f> -LM\2P ,0`; $1 R GN@-0S 0h"c#b13 O-P0 P00[0i*L20CS\2-,\"6-\4 Q( 0p= [|~ 0-@L:wC P0PE P5=50hQ 0-:N 0PL$ ?2/0"0 $ l0,  $P0 2. P,L2 0CS0T20o"|= -LM: p$ Pw χ0ះOP @PPkL2S"@ 0$ 0DS@@'T`χ90?N_ P@ P`\P,DL20CS 0$ `6 χ0O_P@ P`>P* 0,K P@\,$ P|0, p (P P3oD/oU 4*o0(o$|=|=}=n=M8tm0 8m 3m}=}=0~=t~= 0-LM@PT \ (0 S  $  8 00 000$0 (@ -L0LM@ 0S4 l ~= -LMPP`<@pg> 3V4D0@ 0ĕ DDD(0S 4  (ĕ?0 0 @ 0 Pp` @(0 Wl~= -"\LLp0^D! 2,P\\2Lp^`! 6:\\2L"RB.+0\\2L˜@`1\X! 0\\2L˜@\4! 0C.\L2S:S S X20CS \" 0A.\\2L˜@\ -4\LQ\" Q00?:+\4$S4$4\"4< \L8(8$888 p 8,8 -LM`P& 1p @Wp\ (0S T (0 S$ $P0S0 @ WP4S04Q044ꖚ$0(T -H2L M@ 00Rp,0 m TDĐ00@ 1( XRB`l 0= U. , 0SP  0@(0S D (0S D $E00!00UP$0UaBx 4 0 Xė(0S T0Y,Ŵ5;ô50Y, 05 0 Y,@p0峐 $0 ($0(D $00 ( -LM`:PPJ ベ1> ; 00"1R3Ŗ  0Pp%5 AQ5 0Ŗ%(0SP%,0"@ $0  (5$ᩙGᡙ,570,5(570(5 -L MaP PV ÕQ. 00 0Ņ   P@  ?0pPeŕ 00   0 Pp@ `&0 W p0W `[Pp@0Wĕ(0S $0 ($ `j\j  ~=D= -80LM@;P 00  -LM\2,0\\"L˜@4\8"1B/\L^u\"@0^Ę"F/2,P\\2L˜p\`!E/0\\2L"R. +0\2P#6I5R@@ SC  S=  S7 X1"RL2 @S \"0,\\2L˜@\!0.\\ L˜0@\ J/0C\\2*,\"<*\DH @DHDH\"4H \\2 z?\Lw ( ((((,( -LM`QDP& 1p @Wp\ (0S U (0 S$ $P0S0 @ WP5S05055&$0(U%05  -LMĐe(0%S0 0P4 A 0 0 R00Sw 45@s ŕ冐( 01Rp@ @p 8p <  Q0a0A0 88 B#8#88 0 @0 Y6 5S 00 EE 1@0Q1 % 00a 0@ 00b0 5@ %0 50 0080S` 4%p 0@%Fu0 55MG,K 9 0G0 0 990 R000 ,K9 0 CC I2\20n $0  (  $0  ( (vL2S 0 0 0@ 0@0 0  0  0  00 -\2L 0\ -LLQ\\ 0 0\ -L M@K @ AK 0kRP0 -LM00 @$0  0-0L0 P@$ 0 - L <$0  - L <$0  -LM0p0$`@ P0  p.0@S&K  2[:: 2KA-` ^0P@p00`0A  S R0 ApQN `000 000p0 -L$M, X2S \2 , ,,\2,0W^, P,0@\+0m, ` ,V\20 0  0 ),000`t+0@,=\40 40 4 ,44+`0@,0\Y~0,p`*0@,Y\8 80 8 ,8*`0@,0\Z~0,p`*0@,Z\< <0 < ,<D*`0@,0\[΃0@ ,@*`0@,0\[~0, p`)0@,\]~0, p`)0@,\^~0,p`h)0@,0\^~0, p`4)0@,\_~0,p`)0@,\_~0, p`(0@,0\|0,p`(0@,\|0, p`d(0@,\a~0,p`0(0@,0\a~0, p`'0@,\b~0,p`'0@,\b~0, p`'0@,0\c~0,p``'0@,\c~0, p`,'0@,\}0,p`&0@,0\}0, p`&0@,\e~0,p`&0@,\e~0, p`\&0@,0\f~0,p`(&0@,\f~0, p`%0@,\g~0,p`%0@,0\g~0, p`%0@,\D D0D ,DL%`0@,0\}0, p`%0@,i\H H0H ,H$`0@,0\i~0, p`$0@,\k~0, p`h$0@,\}0,p`4$0@,0\}0, p`$0@,\m~0,p`#0@,\m~0, p`#0@,0\n~0,p`d#0@,\n~0, p`0#0@,\o~0,p`"0@,0\o~0, p`"0@,\|0,p`"0@,\|0, p``"0@,0\q~0,p`,"0@,\q^0, P,0rn0@,!\`0,,L‘ \p,W],0@,0$00`DH@04@`0@0,@0Dő@0@ 0 @ ,0 8<,@0@P` `@8@@@@@ @(@0@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@, \2( ,0W,`L 0@,\0,` 0@,\}0,p` 0@,0\]0,` 0@,\r^0, P,0sn0@,4!\`0, > 0-YP L@ ScW  Mc  Gc[  Ac  l;cg  X5ci΄ 00*c $cV  cW c] cD%c@% c^ c^  b_ b_  xbc  dbeN@ P0hbp====== =D=`=x===؀===(=@=X=x=Q  p 0R 0R 0R 0 00 0 0R 0RQ0p0R d0R \0R0L0R D0R0 0AS0 A0 A AP A A0  0-LM0@S0 K J-D0 0CS'|88|88 5tt!1l -`,)T %HH!!@ 4? ( 3,孴![ 0 SPK w1[  p[p @Q> 0A @>-: 0p01K![t <@8#X N[/q!y012 s-3R ʼ3RUʴ3RG3R<ʤ3R73R / R$ 3R 000 0C S 8888888 8,8,80\00`00d00\0h00S S0 0:B0CS02R ʰ2R 0002R 0|2Rt2Rl2R `2R X2R 0H2R :B&0CS00 2R2R 2R2R2R 00 0 01R31R1R ʼ1R ʴ1RB R10uRp0p1R 1Rg0hp1Rh1R`1R X1T1RWL1RD1RQ81R01R(1R 1R1R 1R>1R C R7080R 0R.ʌ0R*0R0R|  MIxv^`uL) -LM@Q01-0R1 20R- 00R) 0ASꐜ888888888888888Ԝ88Ԝ8Ԝ8000 , 0 1 00,0R C=B0CS`({ -0LSPd 40S^ 0 0\0,0\ 0+\0 @, A²0 , p R R# R R 0BS`8`8`8,8`8,8`8`8P8P8P8P8P8P8l8l8#E00CS񟗆Ğ8Ğ8Ğ8Ğ8888888888888 ヲ0 ,0*0 \0 ,}j 0BSD R R- 0 0\0 , R 0BS0$#, 8"\< K 70,, <4<,\0|", :P"\ @!P P 0 ,0*0 \0 , 3 \G 3 1S " 3 \<̱0M"Pq0*0\0 0\ 0,, ` @ 0,\0,,@ } @`V  1 \,刱  '0 X N -0L SP1S 0-,0p", 5"\0", 5d"\ s0BS#88|88\8\80-,0@+,B`uD BB0-\ 0-\0 ,0` ,0ee@0 \0B0 0+0CS0vǓ,0`-,@0R r,0e0 \0-,0@+,0BB`ED6u(8(9 -LM0`Sd ZPP a"@T TK@T2 @T 0DSp pPU*0T1R,,0\0P ,U@5:@0S TT T 40S 0DSd@PTT 0DS[ꨨ8888880+,0$0+\0L$,0*+(0$\0A.,0/  0A.\0#,0&0#\0#, 848P#\@T$ 0S? S?0CS=  #SSB0 , 8 \2| 0[,, 3[,\v@d0\", 848("\@O媯F"@K $ K2[[`0`S "Q:@/ 02K[ K0 , 0 \@  0,\0 ,i<@v 0,\0 ,N 08 \0S=pp SS 0 ,0!0 \_(9(8:IM -LM0@S 0S S0K P ![,0R 01K![b P -LMPyP ( R Q0(0 Q$1S0(0 Q| i 0Sc~0pS 00 42\0, <\0( 1\ <.\(0`0@\!0Z/\0@!\.0\1S  @<\@!Z/1\0@\<!.0@\< Z/70K iPp  1[02 \Q :0AS0 (0g0K IPp1[: (Y  S00`!h! -0L0CS@`n0 ,0PS^ P +PP((0SHꀰ8888q0^/0\ 0 \0 ,p0S 0 ,P P0 ,P1U2U0000PDp@p0Sg`0$ ;\'  -LM0@ ,0S10@ +0 \ P DP0 SS SS S S S 01 KX1[01K![00a-0 \ P -LM1PS b P@ Z00CS 0S P@`K P@0 S Sg1[ :1K ![P@0S% X0PpS0XS00< S)   P@![ 0  WT W  pP@;1K![W:*!K1[; P@1[01K![PP@  P@1[:1K![ ?P@|![0*0Q!K1[: Q1[: 1[:1KP@bk0,, <4<,\V: 0-LM1@S[ 0S 08"PPK jP1[:1K![P0 , 5 \ LPP1[|01K![P` 9P1[D;1K![P( *P1[ 01K![PPKU P1[01K![U !K![P P1[ `0R1K R1[ 0 1[`01K1[ 0R1K1[01K![xPs Poj40R 0-LM1@S 0PK P;1[;1K![` !KQC$808$8081[ 01K1[ 0R1K1[01K![@Pt0S P1[t p0R1K 1[<1K![,!K![%P0p P0R1[<1K![+!K![P 01[`01[@0 A -LM<@/0<,R/0< 0S<0< P  KcP1[<1K![P0S01P -LM0@SwP Q PP -LM0P0CS!rP@  K3P@2[?02K"[`P@}P@0SN 0SSD SB S: S2 0S) |P@ `pK @T @T 1[ 08#h VP@P@ FP@P@ {P@ Q>Q.2KP@ 0-8LM 3Q01K@PA. 00, ?0 0A.\< KPU1[1[;;1K![0 -0LM 1K@P0A. 0, ?00A.\8 KVP0 1[;1K![00 -LM K@AP? 0SI  K 8P 1[>1K1[![ 01K1[,@01K1[!K01K1[<1K 1[<1K(0S8\8@8\81[;1K![P  0S ![ P1[;1K![+!K1[;K -L M0@(@ `,P" K[P@2^02[ :2KRR2[2[<<2K0BPPS"[2[*"K2[=Ã@0Ó\\Ń2K 0 \ 0SS S &K P@ 2[:2K"[*"K"[(P@"[!P@㺩0S5 BKP$pK @T }@Tx2[}0E8#X 0SSn P2[| e@T \^0EP@8V#X 0S S  ULP@2[ 02KR2[2[002K2[02K"[UP@  0P@2[p02K"[P@{ P@t2[;2K"[P@j00CS0S0SP@  P@SU&K P@G2[02K"[@ "K"[qP@H &K P@12[`02K"[^P2[@92K1꠆ 0-0@LTP+?@@@, 9:6+\0 ,0 0-LM0PS00 , K@KPM1[ @@1[9 SL  SL 0 \0 -LM0@ ,(0S88880S0 \ 0-LM @0BS0SR 0SP R0S0PK +P %P1[   KP KP![  1[  |0S 0(0K KoP1[S(P; S ; S |0SS 1S 01[; S1[; S0 -LM0pP ,0` ,@0DST1ST| TP 0DS@ 6T 0^/,P' ѧ0-,@0 3@1T0^/,P0 , @ 0^/\ @0 \@00S00 01^/\0 ,0A`0 \P` 7 S&pK 9P` 2P`{2[ A00CSv R0SORK 0S?IP`\1S (K* KsP`R2[S 1S~ 0,,0 0,\@ aT 1Sh 0 1,,0 0,\U*P` 0 \0 , 0 \0 0\ 0-,@pT0S01 -LM0@S?`p0F00 PU 0S 0S 0SP0S0S P0S "K ]P2[P  SP dR R2[@002[  0 ,?@d0 000 p-LMP-@`K %\ \0 1[ @0D8#Hp p順 -LM 0@6 \0 , h -LM 0@6 \0 , h -LM@8 #80CpP S,U  `K 0 066 0 0  0\0 , إP -LM0`@ ,pK 60' \0 ,vP8#hm0 ,0 0 `w0PUXm -LMh0!XS@`+d0S& jPp 0,0 `h`V V 0( 0\iCi/\[ 0-h0SL@!Xd0S0hk/P0@ , 0 \0h5\[ -0LSP`= P5 0SS& S$ S p 5@pW0SW((**P@ V("(P@ 0 , p-QLM@`P.0S0(6 \@2㿤0 ,@?Tpp ; 0 p -0(SLP`"= P5 0SS& S$ S p 5@,pW0SW((**P@ V("(P@ 0 , p-(LMQ@"hP*0S0(B6 \@10 ,@ Tpp 9280 p -LM0S@ P! px8`8V04 \04 ,0p, -LM@08P `#x ?88PP04 \㻣h0, -LP+P@ 0SuSh p P@_0 , 1` \0 ,0 Sdz 0 \0 ,0 S.c0 S S P@ 0S  0S@0,, <4<,\7 0 ,p0 ,0L@0 \0 ,D0@0 \0 ,' -LM@{P  00CS4848l84848:P  00CS KP1[91K![0Pʢ p-LMT01K[ 0K a c? #P80S S p 0 , : \Jp麺' -LM8@(\p!X"h7 \'V00 eV0S0S$ 80S P80S  0@p 0_@ 0ii 0i' (-"@TLP!x8`:P6 0WSQ   !T*0 "! 08#H $P T:T: -LM8p Ƞ,Ƞ H.P ` B("(V$+*  !0 @0 ,02p08#HTT v08#hV:  ("(y  B("(r -L M0SP)K*K8s 0CS0S 0 ,%o 00 @+4@ 00pa0\) KJ d) [ Z* Kd40 SPbT*0[@=#=*0K* [0P0T40 S'@* K*0[@0*0K* [P 4@00 @0 T000 '0d)0KЛ) [ Z d0#4*0K 00 00 0!, @0 ,` @⦛T:T < S  7 @\T:T0L0 ,` @ₛT:0,0\꠆< p-LM@K0 `Pa\0  [ ȠUP0![00 p p-LMP@`K0 @08P#H, [T 1[#4000C S X8X8,8,8,8,8X8,8,8X8@08#H T p0 ,00#0p - @LK pR3 0BSpRpGPU `3)*0R1+@ 0\0 , 0S;@0 0\0 P,U` 5:1Spp -LMP @RP, HPpe W11@`2**0P1+@ 0\0 , 0S;@0 0\0@ ,T`5:0@S` `@T*0P1R,,0\0@ ,T5:@ T*,`W0 *p@ T `:@1SH0 S89@9d90LS0ѕ ѕ1"0 2"0L S 0LS0ѕ0х ѕ х120LS0 3"0LS х0х -LM P0BS2@@0RqR,,, 0Rh 0RR,,0\0 , 0@D!R,, 0SR,,0\0 , 0S!R,,0 -`0P4L@8UDp:U)U' A0U!+@ 0\0 ,0!S +@ 0\0 ,81S -P0@SL`pP @0TP1V,,0\0@ ,T;!( 0r` p-LM0@Sp0,,0K ,PMQ![C (1RR0AS!11 1K`P1^3 @R 999 9 9 90!2200@S 9 999 999 90!22008#Q0!220!22(0![R 0p!F -LM0@),0 (,0 p(,0 T(,0 8(,0 (,0 (,0 ',0 ',0 ',0 ',0 t',0 X',0 <',0  ',0 ',0 0CS{0&,0 &,0 &,0 &,0 h&,0 L&,0 0&,0 &,0 %,0 %,0 %,0 %,0 %,0 l%,0 P%,0 4%,0 %,0 $,0 $,0 0CS0$,0 $,0 S0x$,0 P$,0 4$,0 $,0 #,0 #,0 S0#,0 #,0 #,0 S0A,,0 8#,0 0CS0#,0 ",0 ",0 ",0 ",0 ",0 d", c0P",0 (",0  ",0 !,0 !,0 !, 0!,0 |!,0 `!,0 D!,0 (!,0  !, R@@@@@ @(@0@8@@@H@L@P@T@X@t@x@|@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A@@@@@@\@`@d@h@l@p@G-`0M@O0L 0P 0  @P@ P(P,PP00 ^`@0@00 `P0@ Rf  0P@ 0\K @\A \4 \! h1\ X1\ P1\ 0Ѝ0P@ @0pW P@0`PU` ` P `@0 P J0S(1S 0@0S0 -LM0@0CS|9|99999999999989898989l9l900040,00 ,-0 R4 Q 9 S0 S00 ,00000 S0 00Q000 40,  KP1[0?>C20 004 0 -0l@`L P0p  \0@  0\ -PLM8 PP 0Sp Sr S> SS 4K p@040C* K08Pd`#H2[Ġ0L8oS  0Q 1P8 T#X 000c8X ER 8004K Q`@0* K08P#H2[0A 8}S XV`!TU0f8@!#X Y7#X,! 0AS008  * KP2[0S09H9T9$9`9<08 0|<s0s00* KmPn2[=3S񟗡99999202P0Pn0n002;,1;2;,0; -LM @RR R R00R0SR 0 K1P1[ 02  K(P1[? -LM4`KP@  0S T0S4 X0S h( KP@L P@4$-P@* {P@3,tP@ "[kP@X ( KP@ [P@t-RP@&Kp @T#2[92K"[)"K"[;08P@#X3,/P@ȓ"[&P@00*K, KP@2[S{6K8 KrP@u0S/ X\n3[1Sk&K  prP@`b㕓  g08P@#&0[pWWd`X:K0X0i P@B 3[1S&Kp D@T2[92K"[08P@#X002;[/ N5 -LM@Q 0S0K >P1[L'S  R  P P p-LM @0BRS`Pp0 S S 0CS0.,PVJ0 S S< 0CS/0P0.\0S S p KP1[01K![JP p KP1[01K![:P p1[01K![0P1[01K![&P p<S/S S0 S S% 0CS0P0.\ K}P1[01K![P1[01K![P1[01K![P p KZPr KTPm p p-LM0@ S`Pp0CSn0.,PV=00CS/0P0.\0S S p K P1[01K![P p KP1[01K![P p1[01K![P00CS0P0.\ KP1[01K![lP1[01K![bP KP 0-LM0 S@!K S 0 KP 0 @PPK P1[<1K![0P *P P1[;1K![P![ p-LM`P@0!, ,0@T:p 0-0LP,,@ 0,,0 0@ T T 0 0 -LM0@L ,0 0CSR PT[PP *0 0R:0` -L@0SP``0SP <0pR` `W0 IAMT -LM PzP@ !rP@ kP@`pK @T S@THN1[0S 0F8#h  HP@ ?P@ؐ,6P@ϐ -P@ &P@`  @T @T4 1[0F8#h@BP -LM40 S@ 0, 0 \ 0-40LSP2N 00 ,0d o@T 0T 0-0L0CSP @0 ,0 S@T0T 0S 0FCa p-LM0@SdPg:SS |0p0 ,gg0D ,0PUpU' 0-`0LS@00S( 3P 0 ,0 0l \0\ , 2PU 0U 0!P P[ -LM`0X S@0,0S  0 \P[ 0-0#SLP@ 0T00< ,0 @TTP[ -LM0H S@ 0, 0 \P[ -L0ASh  Q\ 7 0,0,@ T[ X 0-40LS@P* S 0U[,0 0CS0, 8 \0, ?00[,\n40 0-0L0CS@dP!0,,0 0,\0,, PU0U 0 -LM0,0CS@0, 0,\ -L M`K @ȠH 00 <4, 0 ႐P@" PP*Q0* K 0pS0  P@0[008#X U: -(L!x"h@lPP0S P*P0 S 0P0 :P -LM0P (@ p`0 8@#8 X  0 (@ 0` At0VW  08#8 Xp 08#8 Xp -LM0` p( 008#8 PX0 (0@PU:0S -pBS00W0LMSP@`Q$ 5430:؍fP@ -0( @ 0 0 X0  0\P@  0(0` S0 ,X00 X -BLM8Z`P#x@4bWQ$ 5430:wP@ 80(0 @ 00 X0  0\V0 0\X&P@ 0(0 S -L0KM@c 4P0[0 -LMp `P@P   @dT PcUdU@0 s0 -L M0,  @(0*P0  S: SN S 800 p W3`gPP ,0( 008#8 X0 ,0c#$ 0 4\PP 0Sp ` WP0( X0S0 , 89 90 0`6000 0 ?9æ- -PLMU`!p&**K@ 0_@PH$HU,0K TPU4PU ["[PW08#x W: p-LM 0`S p0( ,@) P0 ,PLd$1UT 0 ,0L0 \0,,@ p0d ,X%X@ 0,,$@! qP,!3=p0 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`S%#00"c1a 0 H2; -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ ׅ1W< K0<0  ?B3cS!3$0J0$008 b30 ȵ᫯<W^U U080S>gfffH2;PjMb 0-LM0@(()0K[ S 0K )崫(^ PU 00++ 0KK堫$0 /0(()KP[\0K  )P凫( 0- @L aP,00 0dS0@00@00: 0 T0 0T9 -0P2c1RL@,p ` (H2D 0,0T (0 0S0T00T0$=\d9T9T_9 -LM` @\ Ƞ!$C"a,Ƞ@Qp 0 @ @0,P@000$0T0 0`0 S00`U9 -L 0!0 0T  00 #(0 0 00   垰0000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000<1k$2Sx=<\d9=|S9===ȃ<0@- @,PU @0T00\0#(# 0$ 0 T0PXP0c9|S9 -LM `,Pp 0K NĠ@ KKPK`000  0T0@N~ p-LMP`!"a,@  \40T0pհ 0 0 00 T0}.? pc9d9 -PL0 aR@,p `  4}.0,0Z 0T0G(00T0=c9 ! !A -R0 0c BSR48 R p-@P`x BRpR0 BRRR` `!  O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb,in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  0  )?) 0  )?)^18#811 d R R q000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O '+@mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8`f2-@@Pr?0RW` o9o9o9o9` B`p Bp` B`RE0C`R9`p9@p9Lp9Xp9dp9pp9|p9p9` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `8q9\q9Pq9Dq9` B`p Bp` B`p RpPP2-B@P00O0RW` q9q9q9q9` B`p Bp` B`RE0C`R9`r98r9Dr9Pr9\r9hr9tr9r9` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `0s9Ts9Hs9ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R MjMjN  0O   ! -- -i > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|zC;C;C;C;C;D;D;0D;HD;XD; tD; D; D; D; D;D;D;D;D;D;D;D;D;D;D;D;D; E; E; E; E;D;D; D;! E;" E;# E;$ E;%8E;&8E;'8E;0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-\O;dO;pO;|O;O;0O;0O;4O;8O;@8O;8O;tO;tO;xO;P;!?$,dbEaL 8pP-%!T1;? 8#2!U#4@\ 0HP#+ "#P'()`5689:=`>K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik&''(())**++,,-*++,,--../-@@A@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 F,?  0 4P H ,Fs"D#4 ?LGdthtt@tx@l@tp@@?$D + $A,B8EIQ7RbSjTi              $ f`& g`( `, `. `0 `4 `6 `8 `< `> `@ `d f h l n p t v x | ~                88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80(   !"#$%&'()*+,-./02468:<>AEIMS[gjkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗 n;AvXaM ְdx $0$:$:$t;$;$;$\<$<$d<$B$|$(\&?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U(h(p(((\&d(((\&p(Ģ((Y((\&(d n;0&AvQkkXaMq//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(6666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@-.,-..h-4--8-t--x-. .....X.t...X.L...vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ$101&<;<;<;<`; f=f= <*L><*0><*H><*`><*x><*><*><*><+><,0?<,H?<,d?<,?<,?<,?<,?<,@<,(@<, H@<, p@<-@<.@$H<>PH<>hH<>H<>H@X@0@@ Q@c@c@@@@<8484p@4?4DA4A4C4C4uaudio_identify_acp4844|4̟4ԟ444L4444t 444x4444|4      d4`4444H44 444abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'` j:Rm: m:]n:o:Im:Pn:Jp:RTq:7q: `n: n: n: n:Kt:0u:@#:u:0u:0u:0u: 0u:0u:H@0u: Nfr: _s:u:v:\zx: 2y: Jy: 2y:E`y: y:ms:Kz:Az:[{:{:0{: N|:^}:jl~:@:?`:n: :5`5T5H4D55P555(5554545P55\55<"5!50#5(  v      W 1 Q `  ,(5@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   H(5  L+ L (5L2 D   O  {$)5o  A AZPZPZPP.5$/5|05p15fGg ---0000 0@0P010`0p0aLfLLLLid75885`<5;5D>5?5?5?5F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9 XK5`K5N5O5 B  w W UP  <1b0 0{&"79=F@W wn a- \xi5i5 n5Xo585l5̅5t5@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 055t5 52V{%1" `"'`~%ZP `455$55D5555hF F hF fF X5555D 5h5(5 5@@9WP P Q@url_int_miibus_readregurl_int_miibus_writeregd68 6,66Px6666G W WnPnPA   !^y 4Xhp9{#{{{rS#S&@'ah 33.U 1(Ex$ #l"6d"6%6P&60    h-6.606,16   `6666p9696e&  l!  P ` c feXA6B6D6E6 B  Q  DJ6xJ6N6N6=eK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,- 6666!A  !@@@@@66X6x<66|6Q`<66\6<2Ե<3<1<66\6<5<777CP4D<p>X<DAp<PA<QA<RA<SA<XA<dA<pA<qA<rA<sA<BB$<6C4<7CD<ACP<BC\<ECl<GCx<HCx<IC<LC<MC<SC<TC<XC<aC<cC<iC<nC<pC<qC<rC <sC0<tC<<uC<<vCH<wCT<xC`<yCp<zCp<{C|<C<C<C<C<C<C<C<C<C<C<C<C<C<C<C<C<C<C<C<C<C<TE(<BG4<DG@<IGL<LGX<MGd<NGp<OG|<PG<QG<RG<SG<TG<UG<VG<WG<XG<YG<ZG<fI<nI<BL$<DL0<EL<<FLH<GLT<IL`<MLl<NLx<PL<QL<RL<SL<WL<YL<ZL<fL<FM<LM,<DND<ENp<JNX<HNh<PNx<TN<dN<hN<DP<FP<RP<DQ<EQ<FQ<GQ <LQ,<MQ<<NQL<OQ\<WQl<YQ|<ZQ<^Q<lQ<ER<FR<GR<KR<LR<HS<KS<LS<MS<NS <FT,<LT<<RTL<`T\<MUx<mU<RV<SV<TV<UV<VV<0X<1X<2X<3X<5X,<8XH<@Y\<AYp<PY<QY<RY<TY<UY<`Y<aY<bY<dY<tY<uY<3Z<4Z<6Z<7Z<8Z<9Z<?Z<AZ<BZ<aZ<bZ<`[<b[ <c[4<d[@<p[P<r[`<s[x<t[<a\<c\<D]<O]<o]<M^<m^<O^0<o^@<pT<p`< ql<@q|<Eq<Iq<`q<q<q<q<q<q(<q<<qT<ql<r<r<r<r<y<y<y<y<y<y<y<y <0<ÔD<ɔX<p<<<ʨ<ʴ<<<PG<C< <<<< < < < < < < <(<0<8<#@<$H<P<`<x<<<<<< B <$0 <$P0<$Q@<$H<$%X<$h<$x<$<$ <$!<$"<W<p<<D<<<$,<@`<@'=P'=Q'=R'=S'=T'=U'=V(=W(=Y(=Z (=[ (=\,(=]<(=^L(=`X(=dd(=et(=f(=g(=h(=j(=k(=l(=m(=n(=~(=(=(= )=)=()=8)=L)=`)=)=t)=)=)=)=)=)=)=)=*=*=*=,*=)=8*=8*=D*=T*=*=)=d*=t*=*=*=*=*=)=*=*=*= +=*= +=4+=D+=T+=d+=t+=+=+=+=+=+=+=@+=A4+=B4+=D+=F+=P+=Q+=R,=S,=a$,=e4,=gD,=pT,=qd,=rt,=t,=u,=v,=x,=y,=z,={,=|-=-=$-=<-=T-=h-=x-=-=-=-=-=-=-=-=.=.=.=.=(.=4.=D.=P.=`.=l.=x.=.=.=.=.=.=.=.=.=.=.=.=.=.=.=/=/=(/=!$,=@4/=AD/=BT/=Pd/=Qx/=S/=X/=Y/=[/=`/=a/=b/=c/=d/=e/=f/=g/=h0=i0=k 0=l0=m(0=n(0=o40=pD0=qP0=r\0=~l0=l0=x0=/=0=0=0=0=0=0=0=0=0=0=0=0=l0=l0=l0=0=0=0=l0=l0=0=1=1=,1=<1=P1=!d1="|1=$1=&1='1=(1=)1=+1=,1=-1=01=12=3$2=C<2=GP2=HP2=`d2=ad2=bd2=cd2=dd2=ed2=fd2=gd2=hp2=l|2=m|2=n2=i2=j2=l|2=m|2=p2=q2=r2=s2=t2=u2=v2=w2=x2=z2=~2=2=0=0=2=2=2=2=2=2=2=2=2=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=3=43=L3=X3=h3=h3=t3=3=3=3=3=3=h3=h3=X3=3=3=3=3=3=t3=t3=3= 3=@4=D 4=E 4=F4=H(4=I44=J@4=K@4=LP4=MP4=NP4=OP4=P\4=Q\4=R\4=S\4=Th4=Uh4=Vh4=Wh4=Xt4=Yt4=Zt4=\4=]4=^4=_4=B4=L4=M4=N4=O4=P4=Q4=R4=S4=T4=U4=V4=W4=X4=Y4=Z4=[4=\4=]4=`4=l4=Y4=`4=a4=b4=c4=t4=u4=v4=w4= 5=5=5=5=5=$5=$5=$5=$5=$5=$5=$5=$5=$5=$5=$5=$5=05=05= @5= @5= @5= @5= L5= L5= L5= L5= L5= L5= L5= L5= L5= L5= L5= L5= X5= X5= X5= X5= h5= h5= h5= h5= h5= h5= h5= h5= h5= h5= h5= h5=Nt5=|5=5=5=!5=EWŜ5=EXŨ5=EhŴ5=Eh5=E!5=E5=E5=E"5=Ea5=1 5=6=6= 6= (6=!06=@86=@6=H6=P6=X6=`6=l6= t6=|6=6=6= 6= 6= 6=6=6=6=!6=#7=h 7= $7=07=!l=B87=Myx@7=fT7=f\7=fl7=f\7=fl7=f |7=f7=f7=f7=f7=f7=f7=f7=f7=f67=f8=f=f8=f(8=f008=f2@8=f@P8=fAP8=fBP8=fDP8=f`8=fh8=fp8=fx8=f8=f8=f8=f8=f8=f8=f 8=f!8=f#8=f%8=f'8=f08=f49=f@ 9=fA9=fB 9=fJ,9=fK,9=c<9=c H9=1aX9=1bX9=10qd9=13qp9=14q|9=15q9=f9=f9=f9=f9=f9=9=9=v9=w9=9=:=2:= :=P,:=8:=D:=Z0 T:=Z8 `:=Zul:=Z3x:=Z3:=Zq3:=Zr3:=Zs3:=Zu3:=Zv3:=Zw3:=Z5:=Z5:=Zp5:=Zq5:=Zt5;=Zw5;=Z= ;=Z=,;=Zs=8;=Zu=D;=Z0MP;=Z3M\;=Z8Mh;=ZhMt;=ZiM;=ZuR;=ZS;=Zhb;=Zib;=Zf;=Z f;=Z!f;=Z&f;=Z)f;=Zur;=w<=w  <=w"<=w<=w$<=w@0<=w8<=w!@<=w"H<=w#P<=w#X<=w"#`<=w"$h<=w2$p<=wcx<=w"c<=w0<=w@<=w"0<=w"@<=wcx<=<=<=<=<=<========= ======)(==)0==68==8@==9P<gH==hP==iX==`==h==ep==f==u==v==w==x==!==Q==R==>=">=2$>=C4>=R@>=z L>=3S1Vd>=3Sl>=3St>=3S>=3S>=3S>=3S=>=3S>=3S>=3S>=3Sˆ>=3SÈ>=3SЈ>=3Sш>=3S҈>=3Sӈ?=3S?=3S?=3S(?=3S4?=3S@?=3SL?=3ST?=3S`?=3Sl?=3Sx?=3S ?=3S!?=3S"?=3S%?=3S&?=3S?=3S?=3S?=3S?=3S?=3S @=3S.@=3S$@=3S,@=3S8@=3SH@=AT@=}`@=#t@=O|@=O@=H@@=HC@=H C@=HD@=H@=H@=@=@= @= @=J@=J @=J@=JFA=dA=A=9(A=94A=9@A=9l)=9LA=9TA=9 dA=9 l)=9pA=9|A=9A=9A=9A=9A=9A=9A=9LA=9A=9A=9A=9A=90A=9@A=9PA=9B=9  B=90B=93B=95$B=9@,B=9E4B=9FtZ=?Z=fZ=gZ=hZ=iZ=jZ=kZ=mZ=nZ=oZ=Z=[=[=[=([=4[=@[=L[=X[=d[=`p[=a|[=[=[=[=[=[=[=[= [= [=[=[=[=\=\=\=\=(\= 8\=pD\=T\=l\=t\=|\=\=\=1\=1\=2\=B\=\=J8G=P\=P@\=P@ \=Pe\=P ]=PZZ]=Pf$]=J0]= D]=]P]=]X]=]h]=]h]=] h]=] |]=]h]=]]=]]=]]=]]=s]=s]=s]=s]=s ]=s ]=s ]=s]=s  > > >  >> ! >> >  @DHL  @DHL     &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a2]G4" w! 7248"707.7v7p7q747q7ʄ7$7!$7J$7K$7$7$7$7$7$7$7$7$7%7%7%7&7o&7S&7Q&7R&7'7'7'7'7'7'7'7 (7!(7"(7$(7%(7((7)(7*(7P(7 )7!)7&)7()7-)7.)7&7 t47t47At47it47 47@غ7CX7FX7HX7IX771757@717q7q7d17$S77I1(7I2(7(77S(7rS(7I3(77U<7(7(7(777)Rl7777773M 78M 70  70M 7hM 7hb 7iM 7ib 7u 7uR 7ur 73( 83( 8q3( 8u3( 8v3( 8w3( 8s3( 8r3( 8=( 85( 8=( 85( 8w5( 8q5( 8u=( 8t5( 8p5( 8s=( 8)8)8)8)8 )888888@ 8A 8B 8J 8K 8/8e/8/8/8/8S/85/8e/8n/8/8H/8`/8l/8Y/8(7(7(7T(7U(76(7>(7f(7g(7~(7(7(7(7(7\(7](7^(7_(7P(7Q(7R(7S(75858IC98iC98vC98C98C98nC7yC7zC7a#=8c#=8e#=8f#=8h#=8(%;5"';'; X(; (;9(; );0);<);*;f+; Zx);+;$8-;P-;{-;222CC @ @  "2"]G4" w! 6higYCW xv|w   &'(yz{u^_`}~LJKMIL) (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx   #&) !%),036:=#(,159=ADHKOR(-38=BFKOSW[^beh<BHMRW\`dhloruwySY_dimqtwz|hmrvy|rrrrqqqqOpenBSD4.3RAMDISK#178 @(#)OpenBSD 4.3 (RAMDISK) #178: Wed Mar 12 14:20:06 MDT 2008 OpenBSD 4.3 (RAMDISK) #178: Wed Mar 12 14:20:06 MDT 2008 deraadt@armish.openbsd.org:/usr/src/sys/arch/armish/compile/RAMDISK dackirqtargetlunsizewidthxintchanneldriveconsolemuxconfigurationvendorproductreleaseportnoreportidphydevfunctioncryptobiohotplugloopbpfilterdrive at %s channel %d drive %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl tagged DT %s: target %d now using %s%s%d bit 80.0 MHz %d REQ/ACK offset xfers 40.020.013.310.06.675.0??3.33async siop: can't find my sync parameters%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d %s: rejecting invalid wide negotiation from target %d (%d) %s: rejecting invalid PPR negotiation from target %d %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: no DT option %s: bad offset in siop_sdp (%d) clear fifo failed %s: timeout waiting for DIFFSENSE to stabilise %s: invalid SCSI mode 0x%x %s: switching to differential mode %s: switching to LVD mode %s: switching to single-ended mode siop%s: can't alloc lunsw for target %d %s: unexpected phase mismatch %d %s: selection timeout without command %s: unexpected disconnect without command != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: script interrupt (0x%x) with invalid DSA !!! unknown irqcode %x unhandled message 0x%x %s: scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x our reject message was rejected %s: done without command, DSA=0x%lx invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()%s: extended message too big (%d) %s: target %d lun %d tag %d reselect without command %s: target %d reselect with invalid lun %d %s: reselect with invalid target %d %s: reselect with invalid target error, DSP=0x%x reselect failed %s: reselect with invalid tag %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x parity error %s:%s: phase mismatch without command scsi gross error %s: DMA IRQ: DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid parity bus fault illegal instructionsingle step dsp 0x%08x dsa 0x08%x INTRF %s: unable to load data DMA map (for SENSE): %d %s: request sense failed %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d cmd %p (tag %d) added to reset list %s: unable to load data DMA map: %d %s: can't alloc siop_lun for target %d lun %d %s: can't malloc memory for target %d siop_start: bad statustimeout on SCSI command 0x%x %s: unable to allocate cbd DMA memory, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d %s: unable to create cbd DMA map, error = %d %s: unable to map cbd DMA memory, error = %d %s: can't allocate memory for command descriptors %s: can't allocate memory for command descriptors head siop: resel switch fullIBSSLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: free(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) RTL8169RTL8110SRTL8169SRTL8169/8110SBRTL8169/8110SCdRTL8168 1RTL8100E 1RTL8101ERTL8168 2RTL8168 3RTL8100E 2RTL8139C+RTL8101RTL8100RTL8169/8110SCe%s: PHY read failed %s: PHY write failed %s: bad phy register %x %s: reset never completed! : %s (0x%04x), %s, address %s %s: no PHY found! %s: can't create DMA map for RX %s: can't load rx list, error = %d %s: can't create rx list map, error = %d %s: can't map rx list, error = %d %s: can't allocate rx listnseg, error = %d %s: can't create DMA map for TX %s: can't load tx list, error = %d %s: can't create tx list map, error = %d %s: can't map tx list, error = %d %s: can't allocate tx listseg, error = %d : unknown ASIC (0x%04x)%s: tried to map busy RX descriptor %s: tried to map busy TX descriptor %s: can't map mbuf (error %d) %s: watchdog timeout %s: %d silo overflow%s, %d ibuf overflow%s comprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : st16c654, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes %s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: WARNING: unable to establish power hook %s: WARNING: unable to establish shutdown hook %s: could not allocate Rx ring %s: could not allocate Beacon ring %s: could not allocate Prio ring %s: could not allocate ATIM ring %s: could not allocate Tx ring %s: could not create desc DMA map %s: could not allocate DMA memory %s: could not map desc DMA memory %s: could not load desc DMA map %s: could not create DMA map %s: could not allocate soft data %s: could not load rx buf DMA map%s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate beacon %s: sending data frame failed 0x%08x %s: sending mgt frame failed 0x%08x rt2560_decryption_intr%s: could not load old rx mbuf%s: could not map mbuf (error %d) rt2560_tx_mgtrt2560_tx_data%s: could not allocate protection frame %s: could not write to BBP %s: could not read from BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526unknownRT5222%s: timeout waiting for BBP %s: could not enable device ral%s: MAC/BBP RT%X, RF %s %s: could not allocate Mgt ring %s: could not allocate Tx ring %d %s: timeout waiting for NIC to initialize rt2661_rx_intrrt2661_tx_mgtrt2661_tx_dataRT5225RT5325 (MIMO XR)RT2527RT2529 (MIMO XR)ral-rt2561ral-rt2561s%s: could not load 8051 microcode %s: error %d, could not read firmware %s ral-rt2661%s: timeout waiting for MCU to initialize %s: could not allocate beacon frame %s: MAC/BBP RT%X (rev 0x%04X), RF %s (%dT%dR) %s: could not allocate Tx pool %s: could not map DMA memory %s: could not load DMA map %s: could not allocate Rx mbuf cluster %s: could not allocate Rx mbuf rt2860_rx_intrrt2860_tx_data%s: could not write to BBP through MCU %s: could not read from BBP through MCU RT2820RT2850RT2720RT2750%s: timeout waiting for BBP to wake up %s: timeout waiting for DMA engine %s: timeout waiting for MAC ral-rt2860%s: error %d, could not read firmware file %s uhciuhci_allocm%s: host controller halted %s: host controller process error %s: host system error %s: interrupt while not operating ignored %s: controller did not reset startstop%s: cannot %s uhci_alloc_std_chain: maxp=0 uhci_abort_xfer: not in process contextuhciabuhci_device_isoc_enter: xfer=%p in frame list uhci_device_isoc_close: %p not found uhci_device_setintr: 0 interval UHCI root hub version %d.%d%s %s: unsupported OHCI revision ohci,, legacy support%s: SMM does not respond, will reset %s: reset timeout %s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return ehciehcidb%s: run timeout ehci_check_intr: sqtdstart=NULL %s: config timeout ehci_open: bad device speed %d%s: *** WARNING: opening low/full speed isochronous device, this does not work yet. ehcidiehci_root_ctrl_start%s: port reset timeout EHCI root hubehci_abort_xfer: not in process contextehciawehciabradioradio at %srd%drdattach: device name too long RAM diskfictitiousrd_idlebioioctlhotplug_device_attachhotplug_device_detachhotplug: event lost, queue full hotplugclosehtplevhotplugreadAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command the kernel did not panic procscalloutallbreaksextentsmallocobjectpanicpoolprocuvmexpvnodewatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function db_fncallArgument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupteddb_examine= 0x%lx %c\%03o%-*ld%-*lo%-*s%-*lu%-*lx: db_print_cmd%*d%*o%*u%*xAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%s %sdb_show_regs+%s[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]After %d instructions (%d loads, %d stores), Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %s = %s db_write_cmdNothing written. () Score: %lu/%lu db_hangmancdspeakerheadphonesinputsvolumerecordoutputsdacmonitoraudioaudio: could not allocate play buffer audio: could not allocate record buffer audioattachsourceselectauddetaudiodetach: %s didn't detach au_portofoplaudioprint: unknown type %d%s at %smpuaud_draud_hraud_rdaudio_silence_copyoutaud_wrau_get_muteau_set_muteau_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfowskbd_set_mixervolume/etc/firmware/%smidimid_rdmid_wrmid_clmid_dr: <%s> midi at %sunconfiguredarc4_stirarc4random_bytes_largeextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqueueplknoteplkqreadinit died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: draining against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: unknown locktype request %dmalloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map%d,No KMEMSTATS compiled in physiophysbuf%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-12.12s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-12s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlezombiedeadonprocADVLOCKCTTYNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPSTOPPEDPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplidle%dfork idlesensordevstunrsensor_task_unregister: unexpected state %dcoredump%s%s.core/var/crash/sigaplpauseissignal hashinit: bad cntsysctllksysctldlkkern_sysctl%s,%s%s(%d)sysctl_tc_choicedummyTimecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %ld.%09ld to %ld.%09ld sysctl_tc_hardwaredenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func syswqwqtasksunable to create system work queue threadwqdestroyunable to create "%s" workq thread boredsmashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at rootconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too longconfig_detach%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structure (default %s%s)can't figure root, hope your kernel is right setrootroot on %s%c swap on %s%d%c dump on %s%d%cinvalid geometryno disk labelunreasonable partition countdisk label corruptedinvalid label, d_secpercyl == 0invalid label, d_secsize == 0disk label I/O errordos partition I/O errorbounds_check_with_label %lld %lld writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%llddisk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 filesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %dcannot open disk, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryuse one of: exit %s[a-p]parsediskroot device (default %sswap deviceintrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogphpoolpool_init: too much uptimepool_do_get: %s: page emptypool_do_put: %s: page header missing page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenablefindlistquittimezoneverbose--- more --- 0x%x0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlpiperdpipelkpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplmbuf prepend length too bigm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectqueue %d > BQUEUES %dcan't return dirty qbremfree: lost tailbufplgetblkgetnewbufbiowaitbiodone alreadynchplvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs: reducing max cluster to %d from %d due to FAT size msdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdir.msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedfile errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data checkinvalid block typeinvalid stored block lengthsinvalid bit length repeattoo many length or distance symbolsincomplete dynamic bit lengths treeoversubscribed dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pstream endrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rtinitrttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroutewlan%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_cryptieee80211_aes_key_wrapieee80211_aes_key_unwrapieee80211_hmac_md5_vieee80211_hmac_sha1_vieee80211_prfPairwise key expansionPMK Nameieee80211_derive_pmkidGroup key expansionieee80211_eapol_key_micieee80211_eapol_key_check_micieee80211_eapol_key_encryptieee80211_eapol_key_decrypt%s: %sassociation failed (reason %d) for %s %s: received %s from %s rssi %d mode %s %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) ieee80211_recv_4way_msg14-way%s: received msg %d/%d of the %s handshake from %s ieee80211_recv_4way_msg2group key%s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s -%s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for TIM bitmap! %s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passiveactive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodenot in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u mode %s null node%s: no node for dst %s, discard raw tx frame invalid group cipher!802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) EAPOL-Key frame too large: %u%s: sending msg %d/%d of the %s handshake to %s %s: sending EAPOL-Key request to %s %s: station %s power save queue overflow of size %d drops %d .5 %d%sM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bfhturbo0x"NODS %s->%s(%s) type#%d%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s %s: bogus xmit rate %u setup %s: set STA link state UNKNOWN %s: set STA link state DOWN %s: set STA link state UP %s: set IBSS link state UNKNOWN %s: set HOSTAP link state UNKNOWN %s: can't set link state (unknown mediaopt)! %s: set MONITOR link state DOWN APL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaearazbgbhbnbrbybzcacncocrczdkdodzegf2fifofrgrgthkhnhuiliqisj1j2j3j4j5jmjojpk2kpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntttwuaukuyvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreerevarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_set_iss_tsmtcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5FinalRMD160FinalSHA1TransformSHA1Finallibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccryptof_ioctlcrydevcuio_copydata: off %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copydata: len %d < 0cuio_copyback: off %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copyback: len %d < 0cuio_apply: len %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lencuio_apply: off %d < 0swcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESAES-CTRARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSaes_ctr_cryptmichael_finalfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_statfsupdate: rofs modffsinodino1plffs_write: typeffs_write: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corruptedext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpath%s: typeext2fs_write%s: nonsync dir writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapuvm_km_pgremove_intrsafe: no pagekm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs=%d PAGES : <%p,0x%llx> refs= PAGE %p: %b flags=%s, pg_flags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p swplkuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_ctloutputip6_getpcboptip6_setmoptionsnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputcompat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsockname spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d at %p not found frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uMB) avail mem = %lu (%uMB) cpu_startup: no room for system tables; %d bytes requiredcpu_startup: system table size inconsistency_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15** IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumping to dev %u,%u offset %ld dumpsysdump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible vmapbufvunmapbufrebooting... The operating system has halted. Please press any key to reboot. WARNING: powerdown failed! cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: Failed to align the kernel page directoryinitarm: out of memoryunknown option `%c' can't init serial console @%lxboot device: lookup '%s' failed. boot device: %s wdsdraid%sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs scsi_sizescsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target links%s: unable to register bio scsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260%s: not queued, error %d cdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcadrive offline%lldMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lld sec totalsdstartsd_ioctl_inquiry(unknown)SCSI opticalSCSI disk%s %ssdgetdisklabel/usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %diic"%s" at %s addr 0x%xlm75alm75lm77xeontempmax1617%s: addr 0x%x %02x=%02x words %02x=%04x: %smtp008it8712it8712f-aadm1026gl518smasb100f75375as99127fw83793gw83l785ts-lw83l785rw83l784rw83781dw83627hfw83782dw83791dw83783sw83791sdw83792dgl523smlm90lm89-1lm89lm86lm63g781-1g781tmp401max6642max6657max6646max6690adm1032adm1023adm1021adt7461adt7516lm81lm96000lm85lm93adm1033adm1022adm1028adm1024adm1025adm1031adm1030adt7467adt7462adt7460adm1027adt7475adt7476adt7470adm9240lm87sch5027emc6d100sch5017emc6w20147m192ds1780ne1619asc7621thmc50spdricohrtc: RICOH RS5C372[AB] Real-time Clock %s: ricohrtc_reg_write: failed to write reg%d %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_clock_write: failed to write rtc fintek: F75375 rev %d.%dVcc, unable to register update task unable to read reg %d pcaled: PCA9532 LED controller gpioi80321_io_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_mem_bs_free(): not implementediopaauiopiiciopmuiopwdogpcii80321intci80321_intr_establish: IRQ %d out of rangetcr1clockstatWARNING: CHECK AND RESET THE DATE! WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: preposterous time in file system resettodr: failed to set time : I2C controller iopiiclk%s: unable to subregion registers, error = %d iopxs%s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersattempting reset PCI I/O memory spacePCI I/O port space--------------------------[%3d devices bogus] [%s]----------------------- device vendor product register space address size -------------------------------------------- PCIBIOS fixup stageSystem BIOS SettingWARNING: unknown PCI device header. NGOK [%s] %02xh %s 0x%08x 0x%08x mem No available resources. fixup failed fixup failed. (new address=%#lx) new address 0x%08lx pci_addr_fixup: Resource conflict. %03d:%02d:%d %04x:%04x Thecus Nx100I/O Data HDL-GCertance CP3100board id failed iq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) irq %d addr 0x%08lx intr %dobio_bs_alloc(): not implementedobio_bs_free(): not implementedcom_obio: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach%s: enable write cache command didn't complete %s: enable look ahead command didn't complete CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE diskwddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedwsevent_readwskbdwskbd at %s: console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %swsmdetwsmouse_detach: %s didn't detach pre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create event thread for %sunable to create usb task threadusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbpalockusbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04x%x.%02x"%s %s", class %d/%d rev / addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port configuration %d interface %d port %duhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored %s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d sel%d-uaudio_add_selectoruaudio%s: audio descriptors make no sense, error=%d %s: audio rev %d.%02x, %d mixer controls %s: alt %d missing AS interface(s) %s: failed to get configuration descriptor ulinearmulawalawslinearslinear_leulinear_leslinear_beulinear_beuaudio_mixer_add_ctl: no memory i%duaudio_get_cluster: bad data mix%d-%suaudio_add_mixermixeroutphonelfeauxvideofmsynthuaudio_add_feature%s.%smutebassmidtrebleagc4 msdelaybassboostloudnessuaudio_add_processing_updownpro%d-modeuaudio_add_processingpro%d.%d-enableuaudio_add_extensionext%d-enableuaudio_merge_terminal_list: no memory uaudio_io_terminaltype: no memory uaudio_add_alt: no memory %s: ignored setting with type %d format %s: ignored setting with precision %d %s: ignored setting with format %d %s: non sync-pipe endpoint but multiple endpoints %s: ignored output endpoint of type async %s: ignored input endpoint of type adaptive %s: ignored audio interface with %d endpoints %s: no usable endpoint found uaudio_identify_ac: skip desc type=0x%02x uaudio_identify_ac: unexpected AC header uaudio_identify_ac: bad AC desc subtype=0x%02x %s: no memory equalizationumidi%s: out=%d, in=%d %s: disabled. USB MIDI I/F%s: illegal endpoint(in:%d) %s: illegal endpoint(out:%d) Fixed EndpointYamaha Specific((genuine USB-MIDI) ucom, %sucomlkucomopen%s: read start failed %s: lost %d chars ucom at %s portno %dugen%s: setting configuration index 0 failed %s: setting configuration %d failed ugen_do_readugenriugenrbugenwiugen_do_writeugenwbhid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d , %d report id%s%s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhidev%s: no report descriptor %s: iclass %d/%duhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8 and Z dir.: %d button%s%s %s: mouse has no Y report ums %s: mouse has no X report %s: X report 0x%04x not supported %s: Y report 0x%04x not supported ulpt%s: setting alternate interface failed bi%s: using %s-directional mode uni%s: could not find bulk out endpoint %s: couldn't get ep %d ulptop%s: offline %s: out of paper %s: output error ulptwrumassCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured SCSIATAPIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cburio%s: setting config no failed %s: getting interface handle failed %s: missing endpoint uriorsuriowruvisorGeneric%s: no proper endpoints for port %d (%d,%d) DebuggerHotSyncRemote File System%s: init failed, %s %s: device is neither visor nor palm : failed to get interface, err=%s : failed to set configuration, err=%s udsbr%s: request failed err=%d aue%s: EEPROM read timed out %s: MII read timed out %s: reset failed auemii%s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemii AX88172 AX88772 AX88178%s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk out %s: could not find data bulk in %s: no descriptor for bulk endpoint %d %s: interface alternate setting %d failed %s: no descriptor for interrupt endpoint %d extra ethernet descriptor %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: open interrupt pipe failed: %s %s: too many errors, disabling %s: usb error on rx: %s udavudavmiiudav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x no %s: data interface %d, has %sCM over data, has %sbreak %s: Could not find data bulk in %s: Could not find data bulk out %s: status change notification available %s: could not set data multiplex mode %s: no endpoint descriptor for %d umodem%s: no pointer to data interface %s: close notify pipe failed: %s %s: abort notify pipe failed: %s %s: abnormal status: %s %s: Invalid notification length! (%d) uftdi%s: failed to set configuration, err=%s uftdi_openuplcom%s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: reset failed, %s %s: failed to get second interface, err=%s umct %s: failed to set configuration, err=%s uvscom%s: uvscom_readstat: %s %s: uvscom_shutdown: %s %s: uvscom_set_line: %s %s: uvscom_set_line_coding: %s uvsop%s: cannot open interrupt pipe (addr %d) %s: uvscom_intr: abnormal status: %s ubsa%s: failed to get interface: %s %s: failed to set configuration: %s %s: ubsa_request: %s uipaq%s: no proper endpoints found (%d,%d) %s: unhandled set request: reg=%x onoff=%x umsm%s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor found for %d uscanner%s: bulk-in and/or bulk-out endpoint not found %s: could not get interface descriptor, err=%d,id=%p %s: cannot open bulk-out pipe (addr %d) %s: cannot open bulk-in pipe (addr %d) uscnrbuscnwbusscanner%s: open in pipe failed, err=%d %s: open intr pipe failed, err=%d %s: open out pipe failed, err=%d %s: alloc cmd xfer failed, err=%d %s: alloc cmd buffer failed, err=%d %s: alloc intr xfer failed, err=%d %s: alloc data xfer failed, err=%d %s: alloc data buffer failed, err=%d wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthratuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-extatu_send_mibatu_start_scanatu_initial_configatu_joinunknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atu_get_card_config%s: could not get card cfg! atu_rxeofatu_tx_startural%s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not read BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d qsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 1 Gigabit PHYMarvell 88E1000 2 Gigabit PHYMarvell 88E1000 3 Gigabit PHYMarvell 88E1000 4 Gigabit PHYMarvell 88E1000S Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1112 Gigabit PHYMarvell 88E1116 Gigabit PHYMarvell 88E1118 Gigabit PHYMarvell 88E1149 Gigabit PHYMarvell 88E3082 10/100 PHYMarvell 88E1000 5 Gigabit PHYMarvell 88E1000 6 Gigabit PHYMarvell 88E1000 7 Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present dcphy: internal PHY bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT PHYBCM5722 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706 10/100/1000baseT/SX PHYBCM5708C 10/100/1000baseT PHYBCM5906 10/100baseTX PHYbgebnxamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYurlphy: RTL internal phy %s: %s: enter %s: %s: link %s rgephyRTL8169S/8110S PHYciphyCicada CS8201 10/100/1000TX PHY%s: unknown PHY speed %x nfe%s: unknown CICADA PHY model %x dev %d function %dpciprintpci_io_find: bad requestpci_mem_find: bad requestpci_mem_find: bad 64-bit requestFirewireOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx CardBusOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDeltaPermedia500MXPermedia 2Oxygen GVX1Permedia 35000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249 PCI-PCIM524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3 PCI-PCIU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1200ARC-1200 rev BARC-1202ARC-1210ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681AX88140A/88141Radeon Mobility X600FireGL V3200Radeon X600 (RV380)Radeon X600 (RV380) SecRadeon 9500 ProRadeon 9600 ProRadeon 9600 LERadeon 9600 XTRadeon 9550Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon 8500 BBRadeon IGP 320MMobility M6IXP200 AC97SB200 PCI-PCISB200 USB2SB200 USBIXP200 IDESB200 PCI-ISAIXP200 ModemSB200 SMBusMach64 CTMach64 CXIXP300 AC97IXP300 SMBusIXP300 IDEIXP300 SATAIXP400 AC97IXP400 PCIIXP400 SMBusIXP400 USB2IXP400 USBIXP400 IDEIXP400 ISAIXP400 ModemIXP400 SATAIXP450 HD AudioIXP600 SATAIXP600 AC97IXP600 HD AudioIXP600 PCIIXPX00 SMBusIXP600 USB2IXP600 USBIXP600 IDEIXP600 LPCIXP600 ModemIXPX00 SATAIXP700 IDEMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon 9800 XTRadeon 9800 ProRadeon Mobility M10 NPRadeon Mobility M10 NTRadeon 9500/9700 SecRadeon 9800 Pro SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZES1000Radeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRRadeon Mobility M300 M22Radeon X800 (RV430)Radeon X800 (RV430) SecRadeon Mobility X700 M26Mach64 VTMach64 VUMach64 VVRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRD580 HostRadeon XPRESS 200Radeon XPRESS 200MRadeon 9200 PRORadeon 9200Radeon 9200 SE SecRX480 PCIERS480 PCIERadeon X300Radeon X600 (RV370)Radeon X550FireGL V3100Radeon X300 SecRadeon X600 (RV370) SecRadeon X550 SecFireGL V3100 SecRadeon Mobility 9200Radeon Mobility 9200 (M9+)Radeon 9200 SERadeon X800 GTORadeon X800 GTO SecRadeon X700 PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRS100 PCIRS200 PCIRadeon X1800Radeon X1600Radeon Mobility X1400Radeon Mobility X1300 M52-64Radeon X1600 SecRadeon X1300 ProRadeon X1300Radeon X1300 Pro SecRadeon X1300 SecRadeon X1600 PRORadeon Mobility X1600Mobility FireGL V5250Radeon X1600 PRO (Secondary)Radeon X1950 ProRadeon RX1650 XTRadeon X1950 Pro SecRadeon RX1650 XT (Secondary)RS690 HostRS690 PCIERS690M PCIERS690 HD AudioRadeon X1250Radeon HD 2400 XTRadeon HD 2400 ProMobility Radeon HD 2400Radeon HD 2600Radeon HD 2600 HD AudioRS690M HD AudioRS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST2000AR5210AR5311AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLL1L2Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000PCI 2 SerialLP-PCI 4 SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNF5D6001F5D6020V3F5D6000VME 617VME 270655015601BCM5752BCM5752MBCM5709BCM5709SBCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM57710BCM5705BCM5705KBCM5720BCM5721BCM5705MBCM5722BCM5723BCM5705M AltBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5754MBCM5755MBCM5756BCM5750BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5750MBCM5751MBCM5751FBCM5787FBCM5761EBCM5761BCM5764BCM5787MBCM5782BCM5784BCM5786BCM5787BCM5788BCM5789BCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM5702 AltBCM5703 AltBCM5781BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4318BCM4319BCM4306BCM4322BCM4309BCM43XGBCM4328SerialBCM4401BCM4401B058015802580558205821582258235825BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearAAR-1210SAAAR-1220SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IR82C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Live (Dell)SoundBlaster Audigy LSSoundBlaster Audigy 2PCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port21050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 5PERC 68139Viper/PCI550TX530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDGE-528TDGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Light Pulse 982Endace Dag3.6DEndace Dag4.23GEMemory StickSD ControllerSD/MMCCB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pXR17C152XR17C154XR17C158ATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02PR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iIPMI77516500781179517814/7851/785480658165815479567955/7954HB6 PCI-PCIHB4 PCI-PCIMSVCC01 Video CaptureSH7751 PCISH7751R PCIMCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIMiami/PCIOlympici82557B 10/100FireGL2133 PCIX-PCIXCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950VirtualBox Graphics AdapterVirtualBox Guest ServiceIPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA2114580303 IOP80312 I/O CompanionPCIE-PCIEIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIX82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 2100PRO/10GbE LR (82597EX)ICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 MPRO/1000 PT (82571EB)PRO/1000 PF (82571EB)PRO/1000 PB (82571EB)82801FB LAN82801FBM LAN82801GB LANPRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000GT (82541GI)PRO/1000 PT (82572EI)PRO/1000 PF (82572EI)PRO/1000 PB (82572EI)PRO/1000MT (82573E)82573E IDE82573E KCS82573E SerialPRO/1000 PT (80003ES2)PRO/1000 PF (80003ES2)PRO/1000MT QP (82546GB)PRO/1000MT (82573L)PRO/10GbE CX4 (82597EX)PRO/1000 AT (82571EB)PRO/1000 AF (82571EB)PRO/1000 QP (82571EB)PRO/1000 PT (82575EB)PRO/1000 PF (82575EB)PRO/1000 PL (82573L)PRO/1000 PM (82573V)PRO/1000 PM (82573E)ICH9 IGP AMTICH9 IFEICH9 IFE GICH9 IFE GTICH8 IFE GTICH8 IFE G82598AF Dual82598AFPRO/1000 QP (82571PT)PRO/1000 QP (82575GB)82598AF Dual Port82598AF Single Port82598EB CX482815 Host82815 AGP82815 Video82806AA APIC82559ER82092AA IDESAA711682452KX/GXEE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGP5000 DMAPRO/10GbE SR (82597EX)82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA Hub-to-PCI82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 Host82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCIE7500 HostE7500 Error ReportingE7500 PCIE7501 HostE7505 HostE7505 Error ReportingE7505 AGPE7505 PCI82845G Host82845G AGP82845G Video82865G Host82865G AGP82865G Video82865G CSA82865G Overflow82875P Host82875P AGP82875P CSA82915G Host82915G PCIE82915G Video82925X Host82925X PCIEE7221 HostE7221 PCIEE7221 Video82915GM Host82915GM PCIE82915GM Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000 PCIE x85000 PCIE x16E8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI6321ESB RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945G Host82945G PCIE82945G Video82955X Host82955X PCIEE7230 HostE7230 PCIE82975X PCIE82975X Host82945GM Host82945GM PCIE82945GM Video82801GH LPC82801GB LPC82801GBM LPC82801GHM LPC82801GB SATA82801GR AHCI82801GR RAID82801GBM SATA82801GBM AHCI82801GHM RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HEM LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI82801H RAID82801HBM SATA82801HBM AHCI82081HBM RAID82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801HBM IDE82801IH LPC82801IO LPC82801IR LPC82801IB LPC82801I SATA82801I AHCI82801I SMBus82801I USB82801I HD Audio82801I PCIEICH9 IGP C82946GZ Host82946GZ PCIE82946GZ Video82946GZ HECI82946GZ PT IDER82946GZ KT82G35 Host82G35 PCIE82G35 Video82G35 HECI82Q965 Host82Q965 PCIE82Q965 Video82Q965 HECI82Q965 PT IDER82Q965 KT82G965 Host82G965 PCIE82G965 Video82G965 HECI82G965 PT IDER82G965 KT82Q35 Host82Q35 PCIE82Q35 Video82Q35 HECI82Q35 PT IDER82Q35 KT82G33 Host82G33 PCIE82G33 Video82G33 HECI82G33 PT IDER82G33 KT82Q33 Host82Q33 PCIE82Q33 Video82Q33 HECI82Q33 PT IDER82Q33 KT82X38 Host82X38 PCIE82X38 HECI82X38 PT IDER82X38 KTGM965 HostGM965 PCIEGM965 VideoRCU32 I2O RAID3124 SATA31244 SATA82855PM Host82855PM AGP82855PM Power6321ESB PCIE-PCIX82830M Host82830M AGP82830M Video82855GM Host82855GME AGP82855GM Video82855GM Memory82855GM Config82854 Host82854 VideoE7520 HostE7520 Error ReportingE7320 HostE7320 Error ReportingE7520 DMAE7520 PCIEE7520 ConfigE7525 HostPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965AGNTurbo Memoryi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power82810 Host82810 Video82810-DC100 Host82810-DC100 Video82810E Host82810E Video82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8330GIT8888F ISAJMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDEKTIHSSIDS3SSIDS1HSSIcAppian LiteDual SerialQuad SerialParallelDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88E8040Yukon 88EC033Yukon 88E8042Yukon 88E8048Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon 88E8072Yukon 88E8075Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6111 SATA88SE6120 SATA88SE6121 SATA88SE6122 SATA88SE6140 SATA88SE6141 SATA88SE6145 SATA88SX7042 SATAMGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200e (ServerEngines)MGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDPCI32PCI509PCI511PEX511GPS170PCIConnectX ENKSZ8841 10/100KSZ8842 dual-port 10/100 switchMN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2PCI-GPIBNET2282 USBNXB-10GXxR (NX2031)NXB-10GCX4 (NX2031)NXB-4GCU (NX2035)IMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtDP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620T1P2S1P4SCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066ESAS1064ASAS1066SAS107853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04 PCI-PCInForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 USB2nForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3 PCI-PCICK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 USB2nForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7200 GSGeForce 7300 GoGeForce 7300 GSnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51 PCI-PCIMCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7900 GT/GTOGeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 USBMCP55 IDEMCP55 MemoryMCP55 PCI-PCIMCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430GeForce 6100 nForce 405MCP61 ISAMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 MemoryMCP61 SMBusMCP61 IDEMCP61 USBMPC61 USBMCP61MCP61 SMUGeForce 8600 GTQuadro FX 570MMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAMCP67 SMBusMCP67 LANMCP67 SATAMCP67 AHCIMCP67 HD AudioMCP67 IDEMCP73 IDEMCP77 IDEMCP77 LANMCP77 HD AudioMCP73 SMBusMCP73 LANMCP73 AHCIMCP73 HD AudioMCP79 LANMCP79 AHCIMCP79 HD AudioMCP77 AHCIOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA (F32)010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950OXmPCI954OXmPCI954 DisabledExsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56CMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS Host (GC-LE)CNB20-HE HostCNB20-HE Host (GC-LE)CMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAVerite 1000Verite V2x00ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVPT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 1076I/O 10778114 PCIE-PCI8518 PCIE8532 PCIEI/O 9016I/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP2422ISP2432ISP6312ISP6322ISP4010 iSCSI TOEISP4010 iSCSI HBAISP4022 iSCSI TOEISP4022 iSCSI HBAPWDOG185008580RT2460ART2560RT2561SRT2561RT2661RT2860RT2860E802981298101E81388169SC81688169818081855C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C843 MMC5C852 xDRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcelMagicLAN SWL-2210PA10xNeo-4Neo-8FDDISK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9ExxIOC3Rad1TigonIOC4STG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA1901915597/5598 VGA6215300/305/630 VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA530 VGA551155125513 EIDE5571 PCI558155825591 PCI55965597/5598 Host620462056300650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio966 HD Audio83C170 (EPIC/100)83C175 (EPIC/100)FDC 37C665FDC 37C922LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotEasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KCrypto 6KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniST201ST1023ST2021TC9021 (alt ID)40XX4018ANE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigETC9021 GigE (alt ID)TN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 Secure DataPCI7XX1 Smart CardPCI6515 CardBusPCI6515 CardBus (Smart Card mode)PCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 Secure DataPCIXX12 Smart CardPCI1620 MiscXIO2000A PCIE-PCIACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2032 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBusPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostP4M900 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVX700 IDECX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64 PCI-PCIVT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700 PCI-PCIVX700 HostPM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVT8237S ISAVT8237A PCI-PCIPM800 PMCP4M890 IOAPICK8T890 IOAPICK8M890 IOAPICVT3351 IOAPICP4M900 IOAPICVT8237S SATAP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVT8371 PCI-PCIVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPK8T890 PCI-PCIP4M890 PCI-PCIP4M900 PCI-PCIVT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363 PCI-PCIVT8235 AGPK8HTB AGPVT8377 AGPVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICVirtual EHCIVirtual PCI-PCI bridgeP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIVolari Z7X3201-3X3201-3 (21143)CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205Martin-MariettaHauppaugeTTTechDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonVortexEfficent NetworksIDTFORE SystemsPhilipsZiatechCycloneEquinoxAlliance SemiconductorSchneider & KochDigiMutechXircomRenditionServerWorksRicohD-Link SystemsCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveATMLC-CubeAVMStallion TechnologiesCoregaASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1HifnExar3wareAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioTamarackAskeyAvermediaAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixMellanoxAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomNetSecZyDAS TechnologySamsungAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionINPROCOMMLanergyRalinkXGI TechnologySangomaOptionAttansic TechnologyAgeiaJMicronASPEED TechnologyTekramTehuti NetworksHint3D LabsAddtronNetXenIndustrial Computer SourceNetVinGemtekTurtle Beachc't MagazinDecision Computer IncQuancom InformationssystemeIntelInnoTekSigmatelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDmiscellaneousfloppyIPISASethernettoken ringWorldFipPCMIG Multi ComputingXGAtelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorACCESS.busSSAFiber ChannelSERCOSCANbusIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediacommunicationssystemdockserial buswirelessI2Osatellite commDASPundefinedunknown class 0x%02x, subclass 0x%02xclass %s subclass %sclass %s unknown subclass 0x%02x, rev 0x%02x) rev 0x%02xvendor "%s", unknown product 0x%04x%svendor 0x%04x product 0x%04xunknown cy82c693_init: bus_space_map failed (%d)cy82c693_initcy82c693_readcy82c693_write: broken match/attach! : couldn't map interrupt : invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: couldn't establish interrupt: unable to map device registers pciide%s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: unable to subregion %s ctl regs %s: couldn't establish native-PCI interrupt, (unsupported maptype 0x%x), unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d:%d: bus-master DMA error: status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s configuredwiredcompatibilitynative-PCI, %s %s to %s: DMA%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) , (partial support) (unsupported): no DMA%s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA66: ATA100: ATA133 %s: bus-master DMA support present%s: %s %s to %s mode %s %s: can't allocate memory for command queue: unable to map BA5 register space %s: port %d: device connected, but communication not established %s: port %d: unknown SStatus: 0x%08x %s: port %d: device present, speed: 3.0Gb/s, speed: 1.5Gb/s%s: port %d: PHY offline : can't subregion offset %lu size %luport 0port 1port 2port 3%s %s channel: can't allocate memory for command queue%s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs : unexpected PCI function %d , %s %s to native-PCI compatibility : cannot allocate memory for command queue , (unable to map ctl registers)540620630630S633635645645DX650651652655658661730733735741745746748760962963: 5597/5598unknown SiS IDE type %d %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) : couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: can't allocate memory for command queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers : can't map mem or i/o space %s: Allocation of PCI resources failed %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address %s: PHY reset is blocked due to SOL/IDER session. %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_desc memory %s: Media change is blocked due to SOL/IDER session. %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type em_set_multi%s: Unknown MAC Type : mmba is not mem space : cannot find i/o space : flash is not mem space : cannot find mem space %s: Hardware Initialization Failed%s: EEPROM read error while reading part number %s: The EEPROM Checksum Is Not Valid %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: Unable to create TX DMA map %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate rx_buffer memory %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive Length Errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: RX overruns = %ld %s: watchdog timeouts = %ld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld : can't map i/o space %s: init failed, error=%d : can't map mem space %s: unable to establish powerhook : can't map memory space %s: pre-2.0 USB rev %s: timed out waiting for BIOS : could not map memory space : could not map interrupt : could not establish interruptpciide_machdep_compat_intr_establish called pciide_machdep_compat_intr_disestablish called atapiscsiwdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here %s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEunknown state%s:%d:%d: soft reset failed `ld'(T 2` ;43;<3;@3;H3;;L3;T3;\3;d3;l3;t3;|3;<3;L=3;3;3;3;3;3;3;3;  <,"01-./23+)%$RP 5UTV  OQ #>><><>L>`><>l>>><>h>L_f`_f<>>(`f<`fH>X>@fTf<> >lffL>T>ffL>T>ff<>`>ff<>`>6>dfxfL>6>ffl>6>(f\> PfdfH>X>f$fH>X>f>T>t>f,fL>P>fft>L> ff|>d>e:Lf<>(>h:f<>p>ff<>0>h:Pf<>0>i:|f<>0>pi:tfp>>)i:f<>0>i:f<>0>i:fp>@>;j:@fp>@>;̃:Tfp>@>;:hf<>0>:f<>0>ĉ:f<>0>\:f<>0>p:f<>0>(:(f<>0>،:0>:\f<>0>:pf<>0>:f<>0>:f<>0><:f<>0>P:̖f<>0>Ď:f<>0>؎:4f<>0>:hf<>0>:f<>0>:Зf<>0>4:f<>0>t:8f<>0>:lf<>0>:f<>0>:f<>0>:L><>0>: f<>0>:f<>0>ffp>>=$f8fp>>=Lf`fp>>=tffp>>=ffp>>=Ĝf؜fp>>=ffp>>=f(fp>>=>=dfxfp>>=ffp>>=fȝfp>>=ܝffp>>=ffp>>=,f@fp>>=Tfhfp>>=|ffp>>=ffp>>=̞ffp>>=f fp>>= f4fp>>=Hf\fp>>=pffp>\> f>L>H>GtffL>H>GLf>L>H>GlffL>H>Gf>L>H>Gf0>L>H>Gfd>L>H>Gf>L>H>G0fDfp>D>3;3;3;3;3;m;\"- ,#\.#0)(!#  H    | @)+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! 8:;p F <@ $ H H T l Ȱ 7nxg=a=%%KLX!hX!X!X;\;"4t"x"h"i"i"j"T""T"X"~"o"""\""~"o" "T"8"@"~""Ă""D"`"~"|"~"~"""~"D"ԇ""4""~"," @ @   ) 2^;     """""" """""X"""""T"X""h"" ""X"""" "("D""\""""D""l"("P"x"X"$" @ @   )|`;"""""""##8 #< #" #D #x # # #"@ #l##h#p#"#$#X###"#L## ##"$#####"# @ @ @   )@##,!#!#a;m;$# $3#3#@Sjc;%c;%;0&c;>c;49#(;<#c;=#c;0=#;=#;<=#c;X=#,;t=#c;=#c;=#c;=#dz<4i#c; >#d;=#d;Ђ#<@#d;@#@x;A#d;A# d;0A#(d;HA#4d;X;K#d;@>d;(>#d;#d;`A#e;`li;`>#i;>#i;\>#i;T>#i;X>#j;,>#>oj2;q<k;k;k;q<(k;0k;(k;,;(k;8k;8k;0k;8k;8k;@k;;@k;Hk;(k;Hk;@k;<@k;Lk;Lk;Lk;@d#x###Tk;###@##4#P#l;ȇjȇj $$$ $PX$$TF#$(%$PN4%$RR%$CE%$ST|&$NM!$"$CLD#$0PLD#$0RE#$@RR%$CE%$ST|&$SL$RR%$CE%$ST|&$ER&$CE%$ST|&$<>x'<> $<>(\&<>(\&<>PC$<>XC$=>`C$=>C$ =>B$,=>DE$8=>(\&D=>H$P=>H$h=>l't=>0\&=>(\&=>xQ$=>(\&=>(\&=>(\&=>Q$=>J$=>O$=>'=><$=>$>>Q$>>Q$>> $X>> R$(>>LS$<>lS$4>>|S$@>>(\&d>>'j$ ><>;(=>`C$=>C$ =>B$=><$=>$>>Q$>>Q$(>>LS$<>lS$jL!><>0(=>`C$=>C$ =>B$=><$=>$>>Q$>>Q$(>>LS$<>lS$d>>'j!>@\i$">4@b$">native12">@W$1f$~9~9native12">$1~9~9p;$p;0p;tG%$p$ h]& Ha& <'$p$tG%|''tG%',' H'$' (T/ tG% tG%%0''%%%tG% D7' 3'6' +' ?' >''''t'|4%tG%%tG%$Du&<%3&tG% `,%$%1%%%tG%82%2% le&%D(' ' $$$('tG%tG%tG%tG%$tG%tG%l/l/tG%tG%v/ x/ ''tG%H'4((l$X${/|/ A'tG%tG%tG%tG%tG%tG%tG% 8 % % % H %tG% l/$3%tG%tG%'T$'T'tG%tG%tG% %tG%tG%tG%tG%tG%4$((%$$$$$l$$8$$$p$ȧ$إ$<$ $L$|1>|1>|1>l1>2>1> 1>@ 0 HH%xH%H%2>2>2>2>2>dx;x;$%@Bx;<5> 3>\3>3>3>4>L4>4>4>2>5><5>2>2> $z;x>&&t&& # $;t<;f=(;;0;г;4;| <<;=d;C'9>C'x)()0)d)H;P'4V'9>9>'(''|''h'P|=:ffs|-=:ext2fs̈.9cd9660.$ظ9msdosP:><>S>T> @>PA>B>D!>!> ">D>hV>V>pW>L'P'2lockf@` (;0;8;@;H;P;X;`;h;p;t;x;|;;;;;;;;;;;Ė; <>x'<>0\&t=>'=>'=>0\&>>'>>'(>>'<>'j<<>$((x((`((<(;ܙ;;;;;;(;4;@;L;X;d;p;|;;;;;;Ț;Ԛ;;;;;;$;0;<;H;T;`;p;|;;;<>X>>d>><><><><><><>=>=> =>,=>8=>D=>P=>\=>h=>t=>=>=>=>=>=>=>=>=>=>=>=>>>>>>>(>>4>>@>>L>><>x'<>8'<>|0(<>|0(<>`.(<>0\&=>t0(=>t0( =>t0(,=>h.(8=>.(D=>.(P=>4/(t=>0\&=>|0(=>|0(=>|0(=>|0(=>|0(=>|0(=>t0(=>t0(=>|0(=>0\&=>0\&>>/(>>'>>0(X>>>T0(<>'4>>t0(@>>t0(d>>0\&j?><>x'<>8'<>9(<>9(<>1(<>7(=>8(=>8( =>8(,=>3(8=>4(D=>P5(P=>6(\=>9(h=>l't=>0\&=>9(=>9(=>9(=>9(=>9(=>9(=>9(=>9(=>9(=>6(=>7(>>'>>'>>6(X>>9((>>D8(<>'4>>8(@>>8(d>>0\&j(@>9(9(<:(:(<>x'<>8'<>I(<>I(<>4;(<> G(=>I(=>I( =>I(,=>=(8=>PA(D=>D(\=>4E(h=>l't=>E(=>I(=>I(=>I(=>I(=>I(=>I(=>I(=>I(=>I(=>,A(=>0\&>>'>>'>>F(X>>\F((>>H(<>'4>>H(@>>xI(d>>'jxA>. .. <>x'<>D~(<>8(<>@(<>x(<>(=>l(=>( =>(,=>(8=>̯(D=>(P=>(t=>(=>(=>L(=>|(=>̾(=>(=>(=>(=>P(=>'=>e(=>0e(>>X(>>p(>>(X>>,((>>|(<>(4>>@(@>>(d>>'HjB> ((0123456789abcdef^^3333g;1)1)#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T5cde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @          L;T;4H>x))()D)d)<)`;)H>4H>d,2J>Ht+Q+b+b+Lp+J>X$,x1,8+4,$,9,J>,+,l,,`+ ,,@",J>+ ++ +J>@A+ ++ +=+K+J>`:, ++ +tF,J>)`:, ++ +J>$+ ++ ++ +, + +J>+ ++ ++;H>J>0) dXK>K>K>K> K>}E#(D<8Q @X,K>K>K>K>H>H>H>H>K>K>K>K>K>K>K>K>K>K>K>K>K>K>K>(@AAA==(A* dd%(i @@@@@@@@@DM>M>kxkM>M> M>HM>\M>`M>LM>$N>N>N>;\-d-l-!-!-!-!-;>->->-@?-;x?-?-?-p@-Ŀ;8@-@-@-A-п;XA-`A-hA-A-ܿ; A-A-A-8B- ; B-B-B- C-;$C-4D-D-XC- ; ;PA-TA-DA-LA- ; X`d,E-e,; \D,x'<><-<> .<>h.<>8 .<> .=>\ .=>d . =>`.,=>,-8=><-D=>.P=>.\=>@.h=>l't=>P-=>.=>.=> .=>).=>-.=>/.=>$1.=>t4.=>'=>h-=>->> 5.>>85.>>H-X>>d5.(>>6.<>T5.4>>;.@>><.L>>Z-d>>'XkR><>;(<>P7.=>\ .=>d . =>`.,=>6.8=> 7.t=>P-=>h-=>->> 5.>>85.(>>6.<>T5.TkS><>0(<>9.=>\ .=>d . =>`.,=>,9.8=>p9.t=>P-=>h-=>$->> 5.>>85.(>>6.<>T5.d>>'\kDT> ... ...8A.A.8A.B.8A.DB.hV>V>pW><>x'<>pk.<>.<>ȡ.<>\.<> .=>.=>. =>Ф.,=>~.8=>܁.D=>.P=>.\=>'t=>.=>.=>p.=>.=>.=>.=> .=>h.=>.=>'=>[.=>.>> 5.>>85.>>V.X>>d5.(>>6.<>T5.4>>;.@>>.d>>'kHU><>;(<>P7.=>.=>. =>Ф.,=>6.8=> 7.t=>.=>[.=>.>> 5.>>85.(>>6.<>T5.kpV><>0(<>9.=>.=>. =>Ф.,=>,9.8=>p9.t=>.=>[.=>x.>> 5.>>85.(>>6.<>T5.d>>'kV>.........l. \xW>W>;l/D/T/////\/8/(WEVrdroot2.5M@WEV  08`.G<  .G`/mnt .G`@@<@T 08`.G<  .G`[~ [~.G`@@<@TU .G` b.G$}wHA .G.G [.G [h~A.G .G .G a#_A.G1O#.G1O#.G1O#b8= .G84.G.G [px S.GHH.GG.GGc!.G3.G]fy.G]fyi.GyrE.G$.G^eNU7)r.G&.Gg+q1.G^pl g<7q.Gdp4.G.Gx9oa̵Ymuc>  ȪH1G=wav}N=9zr .@.. ... export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n '/^root on /!d;${s#^root on \([^ ]*\).*#/dev/\1#;p;}'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = "X" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up  . .. bin dev@ etc mntmnt2-3բsbin-3 tmpB usrvarinstbin.profile install.mdupgrade install  install.sub ARCH=armish md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } md_consoleinfo() { } ELFa(t4 4 (::@@@\\ ؉؉$$   $444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x/ P000`P`0 R ^ *0 0 Q P:00ꘓ@ 0S SX 00-SL@  @1S@DQ@Dt @Dt0 -LM$@0S0S -< L04S0 00 h#H   0S00L -LM`pQ 0S5/p@PPPQ P Q088 8mQ  P̙ p-PLM@@P` ph 0-@L FPP \V`2; 0OSP8  (010SPA`Pԙ̙l` -䢟䒟<LMP000ȂS09 pP=v F@T` 8K0  \ Xn TŸ8 n( R<Ÿ8 0a 08 Z0000S0A  10S000 B _ 10S0 S+ 10S 1!0!0Sx!p1  !h 7000D81810(10S0 `R PpU D00SRU!D0pF! @0S 0S  0<9! @0S 0Sp D( `  Fě$ ̜  ̎ Ѝ8h| -LZ 00( `  -LO0  -LG P00  -L<0| -0L000$ ( 0(  -0L00$ ` 0`  -Lp0  -Lh0H  -LHD 0-LMK P%_p@81 0I  R@ 0b0CS$ \\\\\\\\,\8\\\\\\\\\D0D0E0J0AS00 0xS S *S 0S ", 0 $C0 C0  p-LM KP qr1 I PY 0b0CS5ꤌ$$$$$$$$$Ԍ$$$$$$$$$`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "I0 0 (zC0 uCp  0-x0LP h0   aAq 0A0q08@0P 0R0 : 0 ( ` 0 R0 ( `  - L :CƯ - L 1CƯ - L (Cį - L Cį -LMd&\&T P00s D@00Cs0 00Cs0c㕮0X | -8rLP,20  8)P ,10S0q QP1000 A0! 1)P0 1!)0P00 ttHLQPa` \10S 0@g3P4 $A0P 0Y3P 0R3PKH0  Rp: P 0 0; S0`@%,"]H@0h0Q XgBPhm( U|` H$ P `p  0-LM@KKP tH0: S\4 KPX$P0000 07pq@0S0000m @ 0-L1 R 1 0Su*Q  1Q   7A P 0!0  tG l`0 068S0 0 0 0  P0    00 00000 0000 @0  W00 \D L000 2G0 0 00(00  $ ( `   -0LM 0RE0RQ0R_ x00 l@ R R*T bQ O700,00S h Ѝ̎$ `  -`1LMP``p@Q ]P@  . `0S@ G0/T0V000 0T0 0 0 0S00[ 0pd  tAP@0 fR `!* 00 0Rb350 00`    -pLuM0d yK,0 Bl 1b1 P a!  B=9! = 1 U. uP@N0 Dr/ p` Pno JP PoOK 0!dPPA 6 R  x1 RtVOKd0`!A 6  R ,1,R@Kd0!w?KA6v?K!00/C#b10  0 2됀K p`0d wKP^뉁6 @v?K )00 ,0SD,-.A? 0MbD -LMe@Nb@ -LG$ -0L0P0 `@%,"05p7q / 30p`0-  !P 0 pWp@0P`p 0S0C0X @T00  Z <i  E0( H |$  -L Mȡ00 `@%,"04pbq`C 2[ 8c8d0 K00 , !PQ4 `0pSI 0SF 弩PQ4"`0 K03K,` !p  @0 pR' 0S$ [0`PP  lPE@0 pR<0 0S@0p R 0S` m -MLM2 P` p( 堤 h"jp?@Y 4PD(((((((((((((((((((((((((((((((((((((((((((((((0ppppI.KL1 BH BbT(JK L@1k$Rp *0 PbUa=B^KPEPE@ߊP 4 04 04 I>K0C 0CD $ 0t , CP0-S  T>0H> <D0$,DfԔؠ -L0B LR  -LM`PP( @(K,pK 0  (0@S/WD -L M0@p00 0Si PP 0S nSZ =]P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`0^00 ,Kn, ?R0S@p @L0"Sl 00>Y000 LPH00D 0oSP >zPhp -霣圃LxMP@`p#0ipA P0@$S30```````````````````````$<`DP`X`````h`p2`2`p22y2 R2l2|"0QAPc<2 R 82 RpK+6P`,r 0Sp j$P g `P? pKPᚧPX0: S SK FPB1 R 0 5 DP) `j_0SV pW P@3Wp@Tj_ W p0 R  6V   D WW嬈P!PB`LWy<'=......Ԕġ4X -LMp K5@T` P P@ Tj_ 00T 0-x0L0PS0@Q  JP 0S(0 R00 R0鄲  P-L` 0S<nS 0@ ,P@#l0PP@p` ,Pp@0oS` ]B뀢  -蠟L0S 0 R0 R 5 X @ Pp`0DS 0 PUjOvP D0\j/T0 1jojE.. p-L M `K P@ 0s  ppP -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 Æ2  B 0R00 0`p @T T. .4 Tv Tt. .Te Tc.0.,4  0历 Q Q ZP@E50 Z/ e pwl1 R/ @pTg' 3 Z`P- T0 a FP@0  PTToP  `P@0Ax P@X5.0 /. *. 4 { 5Y@A..ТBK@@0P XP@0D\P@Tj_0T@2 R 808ZP0"8$ x84P084 1 RcBKHHP] {P5 P0 , 0  P (P`| 04D000$ 04~ 04T 0 00TP` 7{P` P P P LP`|7 p=,Ԕ(.8x..X@DLTlU`p|܊إX -PLMP P` @ pK- 80S@@$ 00S00(z 0-P@ 0LSP  0S0S0 ꤳ -LM Mß'}KpG` pG , P@BPr #T@U d`MP 0S@PP @KA <0A؉ 3) 0QqA9  ҁ9@X S((2 ,0S ,ۢ廁9@T4Sp@R P. ''KAA 㤁P9#4 2 R uOK@PMP @ yQAaMK@D0 @D!@f}0Sh +0S}0S S 80''uK?P]KZ PZK  P@R0 RuIKA 05P>x`90SdPP@&T6<teTC.l. Ĵ,8HpxX܊ -L4M䗟য়T `D0,  0DSpH  TW' R  0|St7pW h߀ @TP 0S T ,7p DW 7' 0ǀ0VSPBO0fVpW& 6 P 6Qp& x6Wtd塀  pP6PW@h& @ (6pW D& 勀  5pW&倀  p5W%u0S   R 5pW0%e0S$ $  R T5pWL|0x%U0S( (  R 5pW <0<%E0S, , R 4pW0%50S0 0 R 4pW0$%0S4 4 R T4pWL|0$0S8 8 R 4pW <0L$0S #pWH0 $L P T 3W ,0S ,0SG pL3W@#@=l5P% pW )"PTKPK{+p2PTxWB@'0D#DP8 PT0BOSl Ml RJp^ p2pWŸd0"P0St t 2R $2pW0"x0 1pW"~x0 1pWX"sx0 1pW0"hx0w pl1lW"TnpPBOl0 $1pW!Jl0 0pW!?l0N p0W!xPC0BOS 0< p0Wt9( -LM@p`PC Tp K~P  0S -SH0=1@ !@!@P 0@0@z0 -L0 4 p-LM@BPPPP'oPP 1Pp*Px%P` `PLP @ 0Mpp$Mp逥|, p-GML`1 M Xa T!P0@4 8!^p ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 ~P# $04 04 =K 0C7PyPx Pl y|0$L2-P@ 4d8=ؔԔ0Щ -L0. !'4 -LM`PP( @(K,pK 0  (0@Sm#,8 -L M0@p00 0Si |PP 0S nSZ =2P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`03y00 ,KC, ?R0S@p @!y0"Sl 02Y000 LPH00D 0oSP 1zPhp -L y -ML M.0~`P,0 .\p B0@3S񟗦<H,,Hd0Xt44= D>LP PB<P  .< = =`LP l =4Lx'P D d=4<-$< < < < ; ;; ; ;;,; ;;,;;,;;,x;t; d; \;vX; H;D; x4; ,;e(;,n;q; g;j;+`:c: `b0FSQ0:M>KQ0C0C `p  I~KpGpG:P@ $p6Y0S 4: S L WKMKHHؙ@ $ &Pz9艟@9Tx9D 9^ P\ R$ U9 PT ^ \ R U$0 ܤ0J   X3Z H0380S5 0S  8 R 8 R8 R % 5 Sl8 x8 Rp8 R U Ue  H8 Rk i e V80|A0 X00R00S7 P 0@ ,P 10135:3P " h7 R 0B$ 70S4 l7 R R0$ 70S4 ,7 R 7 Rl$ 60S4 60S4 6 0 S4 0  Se4%S04 RPؔ6Y> Ak" Д0AP(  `"6X@JP U"dV000TU 3 5#:(P8 A"0;"V00X@6h1h ? -"6``U 0#5 %* % U UU 4S X0 4  \ P  @ "ؔ  YRJ^   "$X T \% P ؔ PY, <U U%1 ATE Uc cc!Xe 00S.K,5 \px \ IC6<0S@#/Q 0SKoP\0@  TS,50P5 P  P$L%  QL #%*LUdUP4 射 05 0@R8 Q..8 q0nJ  0 C% RP L 5S3 p0# U Ugg Ug gg i!L\0@.L   %8b Z!L5`J 0P@V`!LUU: X X V ^ ^42 v Pb 2Pb`$"#00C4 .I4R 00UV `P'y4SQ004 e$ V04 0S03$ 54 5 X4 $4 $ t<Qp ,0 S ,ԔĸL/XHH /HIĬج/// /$//(/ ,/ث0/$4/T/88/HKܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$<5 (K 4@% 0K.KD5 4 B#4 `5 4H% $D PT"$`lK``V! ` pK  0Xp6BNKx6Q%̠%4%(@D@D0 P5&6 0S66TQ$0 N0o00  e T  ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%0$!]  0 > 40Q1V>d8 \ \ʠ 5+ V:%V#gFU8'L40S@.ccRT5h LP0!01S03,S345)*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 XPBNK@D@D*5Q P p  e 4Pa4: S ܤEnK`F `F @P0 #   %G+`\d4S: 8j\d4S0 P$Z44 D D zc -LM@(K#P`5  uPpp0W0* R00S 0rS`Fv (P@ \P@Z`F (00T P P (0vj?(0 0(0 T0*됯p -PL`p@PDP @T:T @2 *P -LPgM/, `wPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  m*00Y00S ,0S 0S 0S $0S5MK  s pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,0 {$, u (l oX jP@ <4eu0 ȯedAA lج0@ -LMptQ5Q/tQ& ~t,Q0S h(F4 0qtot`8|@|PPfthdt<Q@_tL\tDYt<Vt4Stx̰԰ذ Q-0L $ Q*  ) -LM`@pp $K_DPp0S0S 0 k)$0 UR#U( p-LM`PU@ T<5PP UTUpT4- 0\ \8 0000ӑS^ 0 ^0 Br0 BS 0r0 -0L 㯔@H -LM00`Kq@ 00 p PPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@bC \CP0 0( dP 0LFC< 0p PPDldĺP P-L (( 0-LMt@ 0Pd#sQ p@kp 80hs0(0 s 0SlH` -LM0:(0 5P0( 0S(0 0 (K  rPP) 0S& =!P`u 00,pK 0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 TP,00 0oSP ?,0(0P,0 0 0P,00 0iSP0 T,0$0XP,00 00.(0pꀳhllt| -LM `P0p-S000P(K 0(P P@  0S 0 Q ("B{Bv ĺ D0h0S $ "-,0 0$  -LM@00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 B 0 0`t -LM@ع-o0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@妹n0 0 -LM0@S  hB 0 << 0 -LM@兹00$08  0 0(0-K 00 $ 0g@+$Uq0 -LnhKq0 -LM K00"PO,t8 - LPA,nt D - LP3,ot P -A0 LR`P pfPJ RDA R pYP3 RA R pLP R@ R p?P 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p 鄳 -LMx \, P`p 0LSE    0 pm@mT 1  pW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ 0K0 X" XK 0SXT1 ,0S ,序KkKkkKka0S @K00!d 0Sqi S  SetplhrI @ Han<\n0 Xn$ `PܾHX$Ⱦ̿н<@P`pH(hX8 t0l \hd`p0@LXdt 0-0P@0LS 0@0?00d/h/ 0-|PL0@S d0dm0U0 0HS@m4m$m0000d/h/l -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 \/lU -LTM\ X3XSp`| , xp p <R|0j |0@0T #|Npa@ Pdlllp0| `Kx| MPxt KPJ4K|x P}W |0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,Bx Pm x,Pl((WPP|0 |(1  0P @Mjaj0l0  奶P|0|0<.t  m~pA|@vPx :p7 P'H"t@ht@ gt Ԕ -0L 㗍@ -qLpM@P`!MpF@9 -PR88888888888888888888888888888888888888888`1`00 00Q @` 0T Q" T 1@KឋP0: S 0`S  0`ST 8  (6'p/l/t/|/ =x/X -NMLMDD0S( `Ppu $2$" 2Q0UOINK@D@DP4: SB ,P0S 1 R mP1P l(0 S l(8h0SKAAP0%4R%4R ;0 RP@ B^KPEPE0 @ PINK2@D2`1@D2:h?00 SlINK@D@DPX0 R~4: Szg00|/t/C l/x/ p/ -0L 0cV@ -鐥LMP`0 4 t%Kp ?0@8S񟗅,Hp 0SX$00,  0S (4 v 0S o 0S#00e #000#0S W 3000 #C0P 0 R D 0040 s\#X#; mL#0S 2 ,#0S0Pa0Ua 2 R 2 0 R @ЂŸQ 0@Pp ]0"0CS @l`U BP  nU 5P 00Q U *P@ 1\ ~ `P 40`V0ES @ PP PbP  8K% 0 R, KP+0Q0ESU 7 @e/ 0 P h P00SZ 0 RUUP%XXԔxxXWxXV|WXTmd p-LM@P``0Se/ 0U $000 0 ph$;p  -7LS 0707Pp `0 Xj @@UjA0pW 00PZ -$3L MPU0 ` C9999200XW 2 R \2 0@@  0S (0s& 0S! dBdfiXpDK00CS0X0ӤX0r PpP $B00CS00Ӥ0b PpyUYUmp0SE 1 R20S 0 S,   , KP#  fQ( K@@"X P 0 :0P 0 _+ 00TK 0Ph  kP^e0S Ze0S *NK`0 Rt  QP`ljWX4tWEVxV|$xWmd@HPfdxgd -LM@$e00CS####################0h8$ UiX p-L M 0@QP,ԇ P p@ 0@@dX 2 0R @ ^ 0S  R@X0V@   PR@p(C8pPC/U -d2LM Ro L2p R 0S 0S <s2 RL  0bQq *q P 1 )#"1\R) 8!Q0yM,@0W0 1R PUh70S8SP g<7"0S8S /;0@@`\P$`0`g0 R0 R P  0P xP  %Pl"dPXxVWXxWEV$WDTl|XXWrdAedAsd  -LM( R,@:( 0e/eT *0 SR: -L M0Ss0S 0% F R|3|!x P( h L, \ H0 P D4 D @8 8 <G<PP@ 0 24S "+r4S  #r4S4SP0ST0S{ @\0 S@ oXں Xp 0@@0   Xp  7 oa  0, 0 @@0P`0,  `0 @@0P`0,  ` 0S S! 1,  x 0S S 0 S1 0 38,  0P 00C   0,   ~ pu tpl \pc0  ~0 ly@HPX`htte  -LM0 pPd(`pVP@R0 -B0JP@SA--D.D.D..D.D.D.,.D.8.D.D.D.D.D.D.P.V0 "8@pT`P0  `P   | H P@ `P?@0 A>P?>p= -L 5: 00 X0x 0H\h|8DH\t| -LjML0pD(0  pP ,&P@ 0`P` 0!0|pD {P@\ o_Ke/!P P`D e/ \ PP3 DA@cX`Dh00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnUd(0 S (vsTdpX`k4dT dM<cؼ*TX|T$px -LM@8PKt' P  0ST  R 0S8!8<K05p6 <000 \XTpP`y4p@ P@PK'  bpW_0S S_0@8 52/<* B_@ @0#4 9_00ao2 -LM@_0S@ -LM@@ _000S 00_0S M-L M0hp`P@ \ |0 0  RP 00 0 2@@  -CML 8 MD$ BKL, :L < 8 \ 0'0\8$<P1 \ưP00\P` :Pp` 00LpP5W4w ,(7Pp G<`T *0S P0hC1 @T:BKH@7H ~044 PSB>K0C 0C0<0  2t`P#W4 ` 0S44<X0D0pMP44 0 44 `W 0SD40D4 17P0W`u 0Sr BKHH0 -04P@St  4D <44 !\0P`T Z00R00SJ1BKJ J GP 4WpP<$ 21P<4 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x   ` h p x  PBKH0H 044 S;;S<$(  00 a1DD PBKH0H 044 S<,  0 B1D40D4 PBKH 0H044 S<$8  08 #1DD (PBKH0H }044 S<0jPBKH 0Hg044 S<$4TPO0BKH0H  Q04S<0O7< ;PBKH 2H8044 S㰠<$$PBKH1H !044 S㰠<cp PBKH d1H 044 S㰠<$kPBKH1H 044 S㰠<5P;BKH 0H044 S<$P>$@te4جPldx   DTtDP> a0BS50S2<$8a AR:R<`0A8̑"<W @$  sB>K0CH4 H@O0`L0p H z04S@$0O0W WLO0`H 0p c04S@$00W@4 p1 ?A`XPTp *0S P0h@C1 0 @T:q10  00S044 04S44S ( /044 0@$ 0@4 @TM TZW> `H p@0E.KXXG W2 `H0 p@0X44 ` <` @@9`A@W  H <3@$`L n/D$ D$ h g/#W `H p0E.KPX W H0 @0P44 A` _ @@_A@ H0 4 e  t)/DD 6 "/DD <F4D ,0|S ,9   /DD  /D$ D$   .  .BKH0H [044 S<T440CS㰠ڑ< .D$<4 D$ ~ -LM, (0S4 D  ,,0S  , 00S4  ,40S , Q ,80S,00 8,7<@@0 , 48,R37<,P ,0(P,P ,0(|P,8S R0 a,)(8@P`@00@p00a 8  0@@ {, 0@w@<0P ` 0@V U 8pS.4 , w<4 Y 0@`@0`P0 @p  0@TS8/.40040 ,08Q0 Q2, 02 )8@p@00@0 a P` @ )(0 @P0 P@ 0`p -0  R0 4((00 08-x -,8S-K-4  4 D-8t-4  4 1`- 4T-4 -44 4h4Hx -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 (  0S ~ p- ALM@ 0 iH 0d7 0_L 0ZP`6 0S2 0N 0\ 0W0 Rc N|| J5 0h2B 0X-PP </~$pte8l$T X82P *0P ": -ML M NK ( e/@9 ,  Q) ) )  P  P `OP NK(@4 KAANK@Y NK@P9\N>K0C(@Kⴠ0S04@@  Y(K0G.KS B0(K@P@`p p4T p 徐\4T,S:\4 X4(@KS:X4 00 S(PKYNK KAe/< K@+sP 00CS00  ä0+(K00q+KBK@P@ P 0@pS񟗸SH_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_(VH_H_H_H_YP` 8 0Y u\ȟ8 R@@R@[OKe/KNK KAe/9S     NK @NK@Ke/P IT    P   q  Ke/OKKe/~NK KAe/yNK@ NKK@e/P KOKKe/gNK KAe/bNK@OKe/KXNK KAe/S\  5  2 NK @^NK@Ke/P  P Ke/7OKKe/1NK KAe/,NK@OKe/K#NKAe/ KNK0(@!OKe/KNKA Ke/ Q     NK @NK@Ke/gP )Rb Ke/9S     NK@ HO7 (5(/NK@ Up`NK0A)4 RUIT NK(9@ h4 R> D$PP  R0000ӑ yS0 R000ӑnSU P$$00ӑyP ,0 S ,{N.K BP@ j*NKAe/{NKAe/PqWNK@K (0 S+    0@P00`VpI= 2 0 P(0SNK@> 0 ) 0 SU LP` NK A 0P@04qTZm HHPP0Sc NK@Ke/vPYU  POKNKe/ANKKe/@ Ke/\  V:L1 R P NK@(9 N.K, B$P )"NK0Ae/ KKe/NK KAe/NK@J ,t+Fd|&$AterdAX08H*hX6p|xlX $8`4 -LMP0 v . D3D U a LR004 Rp P40" 0S 0@@ 848#P #6( (84 8#R@ 0@0@@@  0 @KSpU 0`0S@"TSp@0K` 0  0S840S00p<04 O0 00 000 4 P @000 4Y P 4 P0 4 a P 4 P 4H P  0S g+PK,PK唠4P  0@ 400Q00S4a0,PK,0KQ4  88PP70$ ~`, R-0LP5 aN\00?((\` mq  p`V 0@@   0 SS S S0\0L!T  m <<5P0, 0 m,@`, -RLM0pE aPLU00?((U` "` Q0@@ % 0@K P  P. P P Pp P < 44P0 0@, p-RLM0@`5 *\/ aPLU00?((U` ph黲 R0@@  @0@0@V@@ PpADH ph; 44P0$ 0 phx@$, -QLM4 aLX00o((X` omr , 0@@   00K,@ PP00PK0T0QW o 881P( 0 o(@\,@-0@@0`p P@ `p0 S RUT -a0L0p@TP  W ߡP iP0 S R @000?S T S 0?S h`+" SX0 ` BR X0  äX0 (1$te | M-CMLM4 8@`}K`샟KP, 08$ 0 0mK0L }KKKLPT3E.K(@KBKPHtP H `V l R8S0(@K 3@T80 0S S@D00(K0?S (K0*S 2(PK RTA ` 0SQ"0000ӑcS &S %S 0@-S+S@L4 0D RBK0A0AmP@R0"S 04 RuP^g0 ENK Lp`+XS L-QL @v00 C  5 PTU2 4K8  0 % 0 `PP8`E"<($K0S@ T@S`P 0@%,"=K`Qp U@,0 S ,vw `Rp`pPdE~Kf0  2Rp`00p`?$l$@H|Y@P@DP( O E>K4d7< @P@d `0`Ծ@bS>4@D( bP$ 0060@D0 O <E~K@4 kS gS4$(eP @DmS4(4( Q0a#5P4  4t8pPt h1(K R-K,aR(K0?S X0 ` BR X0  äX0X  ' -AML Ml0 0,0 4 P6 4$P0S0 04<4 84 Y$ 88 0@ @P0  0@`p` 0@TS8$41SF p-LM`P@PQ@TpP Q 'P pQ -LIM MJ~KpGpGP @ , 1JnKS`F1A@TP,0 S ,o SP0rSJ /QP@ PrU B>K0C0C4 000 !帷P@0@@ p6 DPP 4S JnKⴀ`F10 "\a0@|$OTʄ1SnBKAA  0zt* | -ML─, ` Ƞ,8@p@00@ 0,@ @ P\"0PJpp`w vn !0Sh0Sd0S 0S0 0@ P @, P(0SD  0@S 00 0S( 1# P0S0S0S000  @` @`0 0@PU`TS0OP0 0SDw 80<w 0$|664, -L$MBp500K0`K`蔀`0@@0P` ` 0 @PSSpp!0Pp`PK uB : 0. 0@   0 S:0S*.0 0 R00*,V00U0PK |0OP0X0\ v 40<v 0$X6X, -1L$M Rᔐ 0S  @P\ 00C W  pǏTJ   B020 K`0 K @`P!0` `Pu 0 uv 0, 00B","0@ LM @@0IMA0 0\IvL 40{@00PKp6, -2L,M R, 8  0S 8 @P 00C   dɯTy   B02/0@K400c @x(<@ 嚃(<@0P@P0P@,0!wpP@L tC QPT P( 0 *; $1$  0 QP0< 0@K 4P0 54B"`P,"0@ L @@4LA08 0u \0duT 800 K{6 @, -ML─ 0S ' @P$!0p` 0P`Pu 0 uv Pv 0頠!Pp `PXP @0P`VUVU4K 0 0 PD,X` Q-Lp`( P% P# P! P !@R BPP @T! 0 /\ 2PP P A4 $0,FP0S  0 S p p-LtM`KP 0seh @T P u0S8 @plPF(rdAedAF S-Lpo UP* %DP " 1Z 7<@@0 (`,048PR3O<(`,048P7\ L1mdP uPW 7<@@0 (`,048PZR3O<(`,048P7 ( (0R, ,0R0 00R4 40R8 80R7<@@<0P  `  UV@2 44 4WP0$ <`|8/4,p-0  R0Z7<@P@`Pp -RLMP` p `+0 p @p@RP@+  0`S  00 0S00Kp0S0S0S00Kp0KpW0S>2 -L M0U@p 55 u  % 5P꼞\T$4@  $xPp 4Q 0SDP PpdHP(D0: S  S  S0 0p{ 00 R000Sg R РР؟Р?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qE0S0||D K1Ps1 @ 00 ~uE!0!@ 00 ofE0!@g0*\E0d!@T P!P00p 0Q  AE0!v@0 0T jP+E0 `@0P 0<0  H0hy4y|lxxpyyyxytxym @x  8  -LMc0Ss0S 3 R S0S3 Rt3 R hCPEyP,K dH0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP! @2`DBHuP(@ 0S 0+0 a000+VP !1aA0 @@AP| @ 0X$1 v@e0A^PR0: SN8 @TI0H@D0 R㬀 00CS00  ä00 妢( s808 $0hyl|yxxpyyy z@ lh yht  xy  -?MLMt0t` R   0S P hDp0S?KK@D0P@D?+fPl th p- LMP|Ut`0   p@0T PࠡC >lxh  -\0L RL H0 @R0,0, 0>0>l!4yL!y z 0-QLP) 0S-@0  MfP@ڸ0 T ;;S0@0T@|0 tT>0DC\ 0T x>00  $fP@0 0tlhyx4yp!! -b0LP@@xr APP PX"000SQ괫LLLUڅ;;SNU8U0011 U00R@@T U 1 Q cP=B!0|!>l1 h=\=,B0S B0S B0ES U0P0 0 R0Q/PUB0 S B0S B0S B0S00PX=00 000thlxx!"p@"!d"" -1LM R*ʔa0S& !00CSYxx0Sp1  0SK0S0 0  0SP=M=[0ȌlȠ@$ K$ @ =P@0 HP U0S \p0 @0T@_0 0@TP 0Q00000xtxlx""hmx,# -P@LM0 U 5ࠟP.0 R  0p`W 80 S80S*0S@0QA@ <000Ptlhx\# -L M䁟P@P!0S갱\pUT<0000U$ha 0X RQ R 0MQtA!< 1 R eA T:P0U$`0 [0 njlȠ( `0P@( Kd$@ HP;A$0H p<<Ttl#h#p#$ym8$\$ -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 PAb0 0PV?KK(@D@D?+cP`G?+cP;@@ HP+X@ QP00d0 P ,0 S ,me@0 ;;@ ;@ @p  @` @ ?+cP}thm$$\$$$ %8% -LMdNK@D0 @Dp (0 Pw P  0 y,NPi,K-F,9,K'@,@ )P, K;0h 7+P9T +Pyyzyyyyy) -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S ,\`0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0Sy 0 002,P\0` Xٙ@0 W-P+P0)`)yyy  zh) -bML$Mx0x@ R  +P P L0 Db=K0C$0CP0 0S _yx- -%ML,M%K0(J⒍K JE(H,0 (H %ɣb}K(pG P`$pG; S/R P58,0 S 4,_ KH%0R/S /00H5 0H5` %,K( B:KBP]:KP fL%$(K0: S 4 o*PsPQ.P|4 R %,PsP00'P@40S(40S- :KL5*KP/QH ^KLP 5*KP:KH5P@0S 30S #a=(K0Q|3|#׸4*P#P* $P$C0S3 R *KPxP0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V ^D*A +%K(JPJuP@ "   {90P! 5t,11 0Qڍ0S0  (Ka=  -0QBa=l (KX00SX0X 90l 4z )))yyy)Hyyyyyy)y* -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4`4P 1@ Y40$P$ 0S U0 R A4P B @0| ,0K8P P/0ST 000 08P8y0*X*|***y -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R H3HX,@\ӯ \h @8y*$+ 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P0X3 83te -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T P T $`P 00T 0$`00  ٞXPl0(&PC3dAd@d@C000XRP꠾te -LpPP 0S ,0SP!&0aV 0S ᰚP0S$0 0@0S# V ℚP00 0$ 0 T %P(@E`PP0000ꤾ= -LpPP 0S ,0SP %0aV 0S TP0S$0 0@0S# V (P00 0$ 0  %P(@`PP0000꨾ -LM@(aMP@ 0S |/ -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 劙@0 0 0S ZU0\|/ / 0A0- SPL@ 0]0S8  R0S+ 0+// -a- `L0Q!0p@[ P20P d 0p QL f+4 $]+ PP /0 00 KS- L}0P 0H0 -PL@LPgb=0  G|1  @d1  9Lq0 241  +1$  $1*  00   0A0a-  mam` ;P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞a=0A 0bPP2 HD 0 P,2 0 P 2  y*$0 S $T1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 *@0l A 0Z Pv A0P0qx00 (,$000 mS- L'|0P 000 mS- L|0P 010 yz -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 P V $04 4`!f0 s L1^  l P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#Rz (,H8$0 |0  z -H$L|M0 ,0 X P $00CS 4   4圐K R 0  1 P3=6K 0) P7#00CS000a=0p`P@00S@b-P ``06  P03 ($3 0 P3 0 P 2 (2 ,0S ,2R2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0  (sq0b= 0P@60 0N PL [b=0P@06\  0> P 0zq 1 41d1(,$p11qQ-H0 4S Q 0 S  qDy -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0yDy (,$08H P& -%L0M0 (0 H .P4H@ AR4  0AS< 0    < < HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 z&S(0 S (P0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#0111 (,$$2L2 -0` LK$KP P0`P| PU*d 0QpL0L {P0, |% y(,p2 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0*\ 00h8%40 |000 0 zy 82(, p-LKtM @`KPP   \L0  Fp$p)0 00$22- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^$Py2 -LtMpPK@P1 R* 0R5 0: S, :.P P d) 0Q` P X 0x @$XG)0L |$P 0R A$yy,3L3`3 -MLP4M H4p , t * $00C S$@H\p3P3 RIKII 4S+P) (#0@P \ `3 RT3T P00#$3 ,0S ,M3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L儑P yP0SBB0S1 R  <IKAAP!0S$\1  $d(4t!#11  ~BnKP`F`FU!B4: S>tp@ Pp6( 0i#00 @,  f%x (#B Y X  zhzy(,33zy8l3303$4 p-LtM`KP(P 0@T0: S ,Pp'L 0#pPVp' pyL4`4 -LtM0@/SP @//㊐`@pKT/ `0Se0S ĵx0\0S0S! Gx z -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HP['00 "T' 0"꼾44 -LtMp@W0 P`0S 0 R KVP0Sp00d0 Rh00HP '00 U"' 0N"̾44 -LM@0Sl`0P &0S &04 -"$0 RPd z4y -LM@ 0Sl`0P &0S &04 "$0 RPd z4y -LM@p0Sl`0嗏P &0S &04 !$0 RPd z4y -LM!@P& 0h!4 -*0LM"*@7:Pm& 0h!4 -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T TP`W,0c$& 0 Y!pWP  0p\!x/0Q`% 0 (z$z5(585H5 p-RLM`0 Pp@0T<  P% 0ph!% ܾ5|5 0-0@SLPh 4 0R0a 0h2y8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  HP p R0 RPa- 0S0S 0  0 ,0S ,&JK(A4A P a=(K0Q p0| 03QX0PV%4 0@  N% 0$ `5555 -0 0R00000L R0000 R0@00x0 Rlh0P PP0 R P$ zHyz z Lyy5 p-PLM@` 0S pPP @P0/S00H 0 S8 @`0 0 PPPPp $6@6d0 R00T0T QH0  \80 R,0 P0 yyTy 0-0P LRl0@T 0S @T00SU0 ((Pyh6ܣ -QLP=aq R1 0S  0S0! @0S00 0 : P 0P 0PP$ 0` G$P }P 00Ly Hyy6( -L#L M0PS44s P 30C S8P('P((P(' (P(P(8(8(P(P(2 R 0, K@00KtP0,0 0y0  0l")0X"# 0@"bMb=0@`l `0 @p q1؁ * RY 7 R$00  +P0 `ç 0!劌 P;0\1 x1# 0\!  R8a- 00 R0 !0 R  R00 R0 00S  0a @0@00m#0SPAd#h 00P2Tyy6667  7847 -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p   T pPH rqP  NjP@P0  P y$@7`7 -2LtMxŸ@0pŸT S, Pp$T l0 CR 00F2 ,0S ,rG0R Y @K_1 R@(08&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  x:TP 0 0:S l R1 0 LP0#?0C0 hXyԔ\y78 p-LM0@P/w&|P00l0Y0SP`ph8<N0Sph00ph zhld -LTMptp % Zp 00@JS񟗈8 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9,8 988 9909 9 9 9<9 9 9H9P9 9 9 9`9x9 9 9999 9 9 9 9 9 98999 9: 9 9: 9 :,: 98:D:\: 9@;H;`;l;x;;; 94<p(4qDTR0S`0@0w,0S 3wC屈Pv  4 uek4Po\j43d Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: 2p2pH2p 2|2 pt2@p}l2pzd2|w2|P1@ 0S `Pa0CS":;;;:;;;;;;;;;0;8;1` 0S{1P1P1P1P1 97t1p1{1lPzqT1z-L1y*D1y'xP0a,AH0pK @p <1P@x   0wP@ P}UH@ 0h5 0'L8yԔy|88y8zz|y zyyy8yyyyyyyzy8yyyO9(9lh8yn9|zD9 0 BXL0@0t0 X X0 t0SI0S| |0 0S====L> 0S@0tP0 0S0 0S @0nP 0$!0S0<1 pP1 RH!d1 pdb$^ Q ! R 1R B Q QA1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PᄨLM@, 0 4 8 0\(Bp 00@JS AABB A(AB0A8ABBBBBBBBBt?@ABBBBdApABBABBAABBBBBBBABBBBBBBBB@BBB(BBABBBBdBBlBxBBBBBBBBBBB w g+P040 6066666&0&00640Y8 P6 l6   s4 8P8 @B46 0 b5^6&6 X0T6  0-S 0 , 0S,  5000 >5%95@5P2d0h ,X0(d%000$T5045@%, 85R Q@b% % 5 00CSTY 0ShChCxExEYpP. Ym 80I`0< 80 VL PD;P< PpXP(L4 RYPW 3 , RC0S 0S uP 0S\30 ၰ1mP@ 婅P P 2 P 2Pp(咅P `P 2`0P<0 20H CQ0"Q0~ `2PtYPN Ya 8 I`0 @0 8 V; @Q rP1<^P0B LP dP}NP1 RY0  ^ilP@ OY*PP 1 K/PP 000B"PP `P`P@  P*/P|$z `0S y l9Ԕy8999999yz9z zDgyyzyyy8|<$`y::T(:L:P:T: -LpM`@pK@ 00RPP>P0: SU/00 0D 00S]P  TC -4L$LM4$䄟P4 $4p $p 60@DSp KKKKKKKKKKK0K>>8?|? -MLML0P`(0  0S ,(0 S (M= @Rpx 0\S@ S  R R .PP`  "PI000S  \R 0R 0S 1GP 00@0@0S PS" GS0000S 00P 00PPP  0 0gS pS00BNK@D@D ;D 0.z(v ???@(@T@ -@TpL 0S `PUP P@@0`S 0 p`PPP P@@ 0-\0P@LT 0 @T0U$ \vP@ܣ -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00o 0 kPp  R/00`v @0/S`0 0@4o R/00pyy@A p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 RptdPT @`H0@PpUP00yy p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQy@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00=02 ;<0C<`0S.000SlS 0/S 000 00C0  y 8A -ML M\\1 `P$ ^KPE840,0S/~0S0 S0 K0S( .S @ Wp ~ P;0W$0 S x$`:d0 K@TTH ztAAAA B,BLB xBBB p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 0NB -LcMZK MpKK K(@DKK( @DN*K", 8}KWLK KPH0`K: bK(J,J 0P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,9T *0S 0TP*0S0T0* K\ 0 1(K R K(As0(K RK*K:K(x}ZKX:KZK(8(s0S  KP KZK(8TKQ :K(0 T\BBBC,C -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV %@\S R0P -LMp\1PU|PP 0S`QP@ 0 S/R< ⵽4aP2 T,/00 1  zbPP 0SDh4hLhThlh|00 R0 th@T0 0S/S @ ,XyHCPCzzyyXCCCX0X P -88L(0 R"8yyCCy p-L,M(@KP P P Pt <8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 PV yPF sP6 mP& gP0  40 _P YPp>X!tp@0S GP@0S =P@0S 3P@0S )P@P P 0K   0K  w 0K  k 0K  _DPyyiD -x0LM @R`0 R P0 RP PaP  p-PLM@3 R0 (a0S= 0#S4 \S. PP$ T0"C12d1@cP 0S P?P P0! 0px  ` 0#S@ HP,嚲P  />38D\D=|DX0X P#3!"c1 0c!R 0S R(/>3 p-PLM@3 R0 (a0S= 0#S4 \S. PP$ 0"C12d1@cP 0S PȻP P0! 0px  ` 0#S@ P,#P  />3DD=DX0X P#3!"c1 0c!R 0S R,/>3  -PpL`@ 0Sd /PPp0 S 00C S0u 0SYP@j U 0SE00 l0S1W 0S !0 0P!10@ @@P000 RH 0 ], ~ Vy P 00000 0S MS CS000 0S 0T cS mS00dv,QW0p0@ .QT@}  (: 0EHElEEEEF0F@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R H -LMP߿0pS@ q 20  00S| 0S<T`q @¿P_0 1 !.B=R pGV0G SR4vlvvlvulvulvtvlvLu 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R @p010!.CDR Pk?C@.PT @}  0-LPL@DT  0b0S0 > $ TF -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00e0hb0$$qv -dpL0S ` AT@0`V01P@PCAU$ p-LMP@T0 pp0Sx`t 0 h0hܼ%{X0P0000 e 05 (GzFzF@F -ML0M (R04 ,0  2 ,0S ,34! L!8 0AT ~KpGR0pG8 @T㛸P@, Q0 弼0Q  P D! T4a=  8,1008 A  荼0`PS 0S010S  [PT 4a=0 S0ń8  $ (GG@ G,GLGpGG 0-LPL@DT  0韮0S0 { ,G -8L@T`j !0pAT ?wPP! @T P@ |bP wbP 0! 0Ah; T  wP   YbP & ,GH(H -@L0`SpP` N0AT vP @T vP:0G0, 0-LPL@DT  00S0  0=DH -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q NP@ 0`0 10 A0/>3tH -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S P 00 0 0   FC0, PhPP 0p p00  ` WPP 0X0@ P 00  0DHH 0-LPL@DT  0!0S0  4=I p-LML`0S P0AT  0V@TPOUp4 -LM䀟pPP, / 0"c12f1`cAT 0S @T]P@ `P pP ,000! 0Aჶ(o0ST 4/>3@I 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00KI04/>3 0-XP@ @LT0 000 w0S00S08dytI -MLM,Q,0S, p`* 1 R 0/S BKAAP % `Ѐ@0Q P@O`BP 00(00 徠 000 ,0S `,0T IP 0 8I<dyII -`L0S$ PPUJp0"S@0S > 0RH Q A婵PUZ奵0008<y p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p w -P 0S\ \P00S0 BSꨊĊT00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CRt 00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  8X0S @T0   0D8|y -LMP@ sPpsP \ 00CSP0 @ ($ 0J JxyJ0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  $z(z -3LCM |3 B, RT4@dLXdd83 R  3 ,0S ,F.BP0SPdU <"KL d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP P@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A LPdC000 (3>K 8PVXCX_K#^?K@|A oPHx!1RS@$0P0;CS040@4Q0S|  `sdĝlA 廝!r 10C1 =At0\ T0 02iP@bT00< KcK0 ! 兵`VKe/K:1  < K eK R x0S:t A & 0S h5  1 刡 @ 00Ì bK 0Pʱέ 0<~D$&r464\&=K@vPpOd&Y?KP0C PhP Y?KP0C PZPwgF]?K E0(PK0@00  O? K ^ 300 0p1  000+]?K W ]?K 7 ]?K  ~P@ 00 yOOK,i@@H 0-LP:㮜0^  x0\*P0\@ PL0@ D@P@4㏜ 8|p{0| |ht -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 1  Q P1@ԡ`0 810 @@0P0?P P$JKx!(@D@D0h!`P m= [0P ,0 Q  ,$ Hf`8#8P#$0$ @JK(@D @DDK<:(<2: !<(K0<:(<2:(LL!<  0呭X0|l{P{<|T|4| ||PP]Pl{ -L4MD 0K` D 0P@K0 Z L7  ,  ,GD h0S '0S0 0R0; 6"   R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $ 0 0c@BHX@000CS00  ä0ؖ S7 S@PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0PHpWp!pW T0W6 'W00,P|0 ă ā Ă< 4 <( "4\,<pW0 PH 'U00CS00  ä0Iv p{D 0T ߭Phß0_0p@gU0#DHL'$H 0 \LDPH0S.W)4S4#0pW@ *0 @S0pW:+0pW@ *0Sp 0W:P@K0/ΓPKP@0/40 \ 8K 48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7   p|Ql{ |<|P{|\,Q|@QHQTQhQ,zlQ0ztQQQQTXQQQQ|ltRMQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004K(IITK(JJT$0 t_j * K\0# Vj* B\#0S`V* XӆVP@͆X0 Ջ - P@ῆV0 8#0 $j *\ * \Q 2 R H  f,0 S ,!2@2@P0 ၒŸp`0 z6@PK0L X0/0j)K@ B0/ϓ0/P@@Z0/P@@忓0/J0/P@ @寓K0LP@0/@9)K0 BP@0/@坓KP@P!<0 @i *[ #i W P@M  if  i *s[3K (JJ0 yi *e[ 0RK(II l*X[Y@A|0|R |8R|PR <||ltdRRR|RS -L0 K M00, 000K 0 ὑ p/? 0@ @ _` Q @0 RQ   -LM@+T (0Pt0P  | -LM@Qs (T\`hQ $LT\dlt|h0S #!Q pW*`XOPLHDhD84L0#$(,"(h70S S0Swusqo0("#SS,SPSpSSSSSTT$T4T\TTTTT U U0UDUTUpUUUUUUV8VXV|VVVVW(W8WLW`WxW p-L M0@0aP0 !P)) 0 噧唧tVP`F `00CS00  0p phw(V`FWWWXX|$X -0L M0 K0  P@ ^0888 g(S0 g|Xz,X -LM@0 01R4 R(  0 $hY4X`X -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @K0 Q00\0S@`.Q,*\ L0S `00S  0 Q0/S0S:0 R P /P R(  -MLMp0P@AnK 0 `FO`F 0 0U0 U00S0 U. 0S l @G0S D 08: S0  YZZZ` -L@!x1hFSP/ 0Q0 0 : SFH` d0S T0S 10g1hhP  BPP 0h|Z` Z0ZHZTZ\ZtZ -LMa0P, 0 (@ۦtt1L pKR `0 T! 00C SG A?K K0 0Q0 00nS 0 S O0nIK00 K pKA/00, )       (\|Z p-LM(`P,@oP ,DP p  L0S$ `0! 00C S 0 0p0000000(\ -LCM MD$E~KpGpG 0,           `$ \$ ` 3* R@ R  ȣd$ 0SP' 0Sk3 3(K |3P\4 4 XT 9@T40 @TL T0@: S< ,(P,0 S ,}2 2@PP 2 P2R( K"\$ XD @An04"T2 R0S <iBNK@D@DH P@1 qd4 S00C0 zy !1@01k 000l<y \0S @&<x0)0S cP^ 0 qPV 0 UP@ x0SJ GP @0S? k<4I 0S tZ`ZZ|hZZZZZX%`([L[d[x[ [[[[ -T0L8M<0 0  8 @ 4 0K0 , ( $   Z@K3  -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P,mE.K B B0h$ !1`$ (@K  d 8 X \ @&?2 hBNK@D@D 0 P h F0D_0 ẍp` "p[T( -LM r`p&Y PP(0Sc P, (0, ( ,0VƗ@0 /j0,000S7ڞP@N &ɢ,0SA&徢00,0S0 00 㫢0 R @@P0, P( ,P6  c Ɨ@0 S/0,0C0BĞ0 (0U[([[\L -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  00001V' @ 00CS00 0S 1P01rXQ0P 000,0 QP(`X -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X, 0@82P @" Q 70$ :  0dPPd 0hƑ(0CC1/|x0Pw00S  n Q<;P9(\\\\x -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0  p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S , 4 0 |00S00YX   D0TPDHGPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:08/|0^ @P0088  <  +( ]\\\x] -0LM PU@p$`H` #T*U0 R D 0喃" l=`▂#0U<0 R 0- 0喃" t(4]H]d]|] -0P0 P00LMS0 P܀ R0 P.:p$60PP5`@2:(P`@,F0B֜$|P0 R0`@00-$FԜ00$ᾜ@0 p]H|(H -!LM0\00 \pG\(:`(P``ᢜ,F0B$嚜0 ƚ \ሜPt0t0l h d@d0 A0(0000錉(D|] - 6 8`0(@ 0L 0SĠP`Q묀pp;P3@00 00`PS P@0Ss0SUP,D(H|] -LM@P00sꈉ -LM@&B ?ˆ Pa("PUp* 0А0 T00P00@ 000p@0 (($`d0 dS D 0 Q00唚P (\^ -P0LM@ᥛ<0 P 0S P \$^ p-LM``0S TPT 01@CT*000p0T* 0  H -LM`P@aUpᰀ 0SP 0S 00C0$d p\0 iDh80  \0   >2<^``D^Z` 0-(0@ LRP 0 ,B, 00 0-(0P@LT ,~XP  T00T0S 0 T @0 0-LM@ 0T0 T00S0 T0P7@H᡼0S|tp0 Rd T0K0 / 8 (P^X^`^d^p^|^ M -0LM@ 0h o\ 00CS p 00 00  ^`^ -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`P( 00@$K?I$ @0 0 /&`$ 000H0G  W00 R`(\ 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 /$0$  00C00%`` -LM@Pr0 `0"pM b0@SBDDDDDDDD(D<DDDDDDDDL1 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ P 0 R T@DG  0;T@DlzX T0 R wT^ԔL^^HSdS_ p-L@M P`K?0S 0S  j p_ -LM`t`ğ QS, @ DdI 0S 0Sm p P0S 3 ,0S ,Rs 0ṢģL0S/ P1먓0S 0S'0\CS 0S 70S 0S @C 1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/o (K0 N@0 ,?0S 0St P 00S(< WP0S X] P D ٗ<I tt`l(a<^`aX\L|P|a$b4bPb\btbbbbbܣte -LM@P4Ppc`VWW1 0S>000 0. $0`F0V$0@X L0 S00*ㅓP (@ R00  0R 0S R0R0S P 0 R IP` gX0 S00Dŏ<</h`fP|LXbPb c$cPuL|0cܣte -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  (XT|` -LM`VPڴp崀S@PT 0S  0T @T R 0S `FVP 0  0P 00T|L`f -ML M0,0   BRHpx(8pxt P d$ PTDT$E>K0C4  L44 _$0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:_$3 ,0S <,;  0S 0 S s S # P"   00C0 " P  000 00C0  TR0S-@<2Vȓ@Z P  2(K_KK@$ (@ʕ0\4  X$ sM!Q& B0O0  0lz 6`X!0SV Eo0 C5@"%$1 R0 P P. Pd P D0:90|f`cc"@Xccccd(D(dTZHZܣteHchcZPbcc -MLM$p\0,0 (`; R 0S  L0 S8(K 4  `0 A?(K  A?(K D KKLP0((K0Q 0@^^>KMK  P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dY X (,0 S <, 00 00CS񟗳`x$0S&&L0S6 `03  00C SK 0S 00C S'800&c P%00C00000000      0S $\NK @D@D0, S^K PE0 0%z5 R 7$\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00q PS L0S|3(K4!  `0A?( K A?(K KK O$\0 0 Q0hNK0ᴀ$00$03  0`0C0 ߔ@@Q @T; Q 0S+ 0 SP $00$0P "00C0"t>KMK ᎓ PH"dD000.S "X 3P00L Rm `0j 0Sg <\@P^>KMK @dS$00$0@1  0`0C0 j崀=@t?PNP( j50.SR 00Ph L0S# `0 0S 0<0P$0  Td(Xc``dpdxdd\dXdddddeec$ePeeeeef0f ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000`\|X 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.p$$%$<%X% 0QP 0S P0  00喎dHK HKtHK4 00  9l%`XtZPf\f0f -LM`VP$Pq 0S8 @T 0S @T0 \( 00C0`FVP 0  @00?ThX -LuMĆ0,0  p! 1PW1 1 1  6 \pP  (` ,6&BPq !,6"! 0&6& ߒ&ے rKג f?KP4 Z(1P*P0Q0 Q00S 0`F' 2 0P:6P P0ş 0P1!5% Q5@!0R# 0<0QK0S   1, 0S  0h` BK_KH$1vP,6 1R rK P0S#1bP& ᛒPl0SV1#SP&ጒP<6 PA0S 0S ) `1 0S DrK} P E CŸ,0 S ,C1! 0 000S  ReKW P !&֐001&:P dPeK6 P & ᵐ!00! &Pq 1z ue,6KQ01,&K `,6xAQ000L0SD1 S@D0S!1 S* 0Q15021 5:0Q 0ׇ 0@0CS(,,,,,101 0`F4,6 0 ,6! yX@0 L;(hdffff gHglgtgggg`Lg -PULp`:4@$@TPZ 㼷U:gg 0 px0p0t --L O p-PLM@P`l0l R ^T D0 Rp80  0  x Mp@g --L  --L  -LM@@ h,X --L  p-LtM/P@TK P0: S p0`rS  0-/L@PU+D0 00J/00(+@+@00X|g -LUMpPKPP@lK80S(0: S  SU P U@P P@0 R000K@zP h1: SD c$^tTCh h0h P-L P  @h -QLM@ P T 6Ph -L5P `h -kMLM6 6@, @6K0A A 6 PP6: S ?PK W&P0S{ x6 Rp 0 S hX0S` H6H&@DfDv@@ @@@@墊0 0垊0S P5P(0%<00PC0S0S T5 ,0S ,}H%e.K B BP XP @0@T H6<4"D0# rP@0@Tşş%56@0T06 v4 R̔3S (0 ତ4 @@TZ0Q $R xP0S $4 R 嘀P, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@k3PL ax3PTChG VT3P= NP03$- 6SR ,@!0@T00 "2 ,B00&0"S P x2lPP\He,(PPP@+iT J/ Int1  LPP?, n&R0S&#0!S$< pv~PL+F> ,#>>  뚙?ATphPbhp|hdhhhi(iLipiiii(tijh(j`Lj\Xpj\jjLjk kDklktkkkkkܣte -L M, Zß ?t3弃 ;mP c+ 弌#x3R,p / pW,P  0bW@ቊ0EOa.6 0@Ɔ& 6F@Vw3 ( &$6pr 0(& 0Dv00 qB 0+00 0S02PU D2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0 1 R,d0\ +sP 0 R,w6P@kU*0 Q@tPU:aA ,0 d(SkkklDlll@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% ( -PLM@ 00 R$hlgl M -LMp@F`@vm Pa0@S p1P  0PUZ c qh10  00S 2WnC` `F R R010!,!mc.X 0P3 00C .  p_%[EUPv0GOa.U&`n  0 6 & `@0PV6@ p$*P l m -0LM@H HKxP0T 9; XedAP PEU@ȃc0S >PPE@ $0S33 |3 00S UD30 0 O*Y U Z U < ,  >U "0p0t0 ڴ>PPUU|>P\PUSPb0S }>P 0S0S20S p ` 0pGS # W R0S) 4Q P  PE@1QP Q d?PE@< 000PEU@ 00S1Q& 00S  >0 5pP (01S00S00S @ =|0 pPp㸓뀌ԍ؍8{tXz pX{h{{ Jčȍ{{ 0-TPL0@S s<0  0P@0000(č p-1LM0`@PPq oPUP  oPPp oPx0l oP`P0X00 DoP< 000pč8i zi {Ѝi {~i d -L,MD0P`K@p,0 ($ : E= uop h0S d0S `0S%@PtP<   Xop<@TU  @00PEU00Sp<~,0 S,či${{{ p-L,M`0P@@K0 +$  <`0` o0sHD ,8 L 0S pči${|| -L8M0@(0 LKPp`$ ᪂ <U0 @ PK(P @Rp0h-S`@d<P8@ 9D0D np0d (0S (e,|H|či$T|d| -PLp M`0  'P`  P 0 Sr200000S0p,KT&P p*,PU V" X 0 Sr4200000S W<P n Ph0 r1000P^ 00S .  AR #     tAR #݀ d< < 00S UP2  p,Z  <P% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPUx,)'V|W<<( z1mt| ||,؍t| -L0 ,;(0( mps ؍čzi | -4L ,;(0( mp] ؍čyi | p-L M$@K DQi8 mp$ $rP`  $0 0 ` mp/ 0$ PS 0@UU0  CR 0 R00˧h 0PU@H00CS00  ä0 9|pčxi ||}| -P0LMH@D0  \ (0$0  ȍ -0L0  -0L0  -<0<L00, m0Sh\či } -80L4000 0m0ShFčtei } -L, 0000 0̍ -0LM0@S/ h00S00S P00  a,0T, @00 0 0 0鼍ȍO0} -$$ 0L00  鼍 -L(Mp0@PK` @ 0 e l0S X:3[x DT 0 T K}lP@ 0S, či ؍{Ѝi h}x} Qd0d0A00d0pzxz -L M Kp0,` %$P@\  0+t0p00dS X:0SHD p@h :$ P0t@l0@B}xz}pz p-0LM0`0S P P!K#P@T 00S 9P 0S 00S` @TV8㽉0%p} H}||؍} -PLM`@Kp| `$91 @`$@0 DP 00 ,(0k0S؍i ~č~ -PLM`@Kp| `$^91 @`$@0 DP 00 ,a(0|k0S؍i ~č,~ p-L,M`0@PK@$ 0 ! ,90S V P0r00000Sp  ,K9PX P%H0@kp8ݎ 0S(p؍ 8~i$h~č~~ p-L,M`0@PK@$ 0 ~ 80S  P0r00000Sp  ,K8PX PH0jp8 0S(p؍ ~i$~č~  -LM@0Pp`P  R0@r1000xSY@Qg W 8PY r10000D0S  rt10000D0SX0UYDD"Y 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S '8P@00 `hV f~`l 4P p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  ph8@T$@Tpl dl$X 0-L0MPQ! @0K  <K}0@0  ; K@ P \@@0[X <0K7H0H <0K0iP0 0S u0؍či p 0-L MP0Q 0 @!K  ~0Sp / KC|0@KL s7@0@ ip0 0S A0؍či -LM䁟0\pK@8 P`K$0 ?}@ ;}0tL0 H0 0L0 Q P L0H K2lpK1p`K01@Tژ2 gp+QtPP@1@SPTUpPl rp200000S 0:SP P8l PPU t@T0, CR 0 R00ꛡp0K1S*U@ Tڴ1S0Sp\X1PT![ L0D gP 1S  0 CR 0R00^l0I00CS00  ä0 \N00S),0 S,č؍i i8iiii|i|ȀCBЀ؀ tei $ԍ8 ->MLDM1圑0 ,   >KK(@DD@D dlz` w4P fP` 0S;,68>{KL@K(pG $pG>[Qz Mz 8P 4p V4 fP@ <0S <0TP( 0 0CS00ä0 <0@T|PZP ,0S<,Ѝx|č؍i Li|dx| -x0L`! @ T @ 0 CR 0R00ꆠx0 zztSpRW` LDLYTTP@VPQTtV$V_d0S B0S 0B 0 CR 0R00?505P &d 0 CR 0R00(x07< h 頁|́CBԁ܁ 0-0L0MP0@@K( 0 ey p3|0| eP0SX80 P0 H00<$ o 0S(/0鸍؍č6i(|Ȃ 0-t0tP0Lh@h  \0\00 0043@08 aeP$0鸍|؍č5i ܂ p-LM@`00X`PD 8@P$NP^Pp鸍|@ -Lqd0d0`pT0@#nPp@@Np0  0鸍|p -LM@KD004 (ق 00鸍܃| -LM@-D004 (㻂 00鸍4| -L M0p$0  @pp`0h\㖂$KP`@$0@@S 鸍|`40S 0S0Su-L0S 00  S\0S8u 0-@PL0 Np0 C08u 0-@PL0 9p0 .0,0 -LpqPP`@l܇d0p0`@0 @8 j@T( rt|Lzx p-LM0@S`P 00  SXPp@0Sp -QLMPp W@}cX0$t o A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt? H; H00p@0S% 4i.hpte,xzl| -LBM MLCNK@DP0 @D/㋏KKoK,0 PP>w I11 xcPp2(K 0Sc 0( K @<PP@oP,+1(0K 0(K 0QpRKH K <P@PoPP,1 0D ,0S4,؍čKiteĉ -LM0@(0 4$4Q4QT00CS00  ä0 aT 0S 0SSwXp@K Ddv 00K( `0 bP`0SmP@KX( v 0 bP0PKgPp 3 ,p bPxYpB @4 @0R0 0  CR 0R000( CR 0R00 40) CR 0R00֜`R00CS00  ä0 8ʜ80< LH20@S& 4Ÿ0S @0 0R 2!0S 2^ 80 00 0S1@1S^0\0CS00  ä0 8p10S P00@T`10S V8` 0  U00@T PUpX0@T  @0S 0 0$0S^ (0S( M؍Ѝ d|či 6i(Ċ܊؊xxLRtet< -LMX0Tr$0 0S0+S (X$B$ ~/4PK s5 Dq/ DaP 1` 01S OuA0 x! aP z01S D:u\4 0B/r< 14 8#"0! 40K@  DZaP M01S u| /P r00CS00  ä0 d $0ST$č8,؍%i Ѝ"i 08#i HX|h -(0L00S 0  0S 00S "48<#80  -DLM08@,0 0S0+S 冄`p㓏Kpp <_mP,.Z30: SOK.t .O_K0d `P01SD@ ft,3 (K @OOK < mP,^.SOK.Gt R.OK0 {`Pn01S hMKP.%t 0.O_K0  X`PpJ01S <1<1<1<1<1Y 10SB .s4 -0L `P01S) (b&81S<1S o@8P PdP Pd~{ ,0 ,0S,č8tetЍ؍"i %i Ii ԋ$Qi 80DLXꈌ -LMPP1@q`P4K $ psV00V@/P 0 K0p@ 8PK 0`1P #.00`_P:P@ 0 rtP  <Kf<004 R} $0S$ldhX{| p-L MK,` 0 AP0S |.}V0000 P00P0S 00p0P@0P0P0 `20pl p-LMR@!X` 0S   TZ p@0< CR 0R00_0S7 0CU3* V ,0 CR 0R00G` \0 CR 0 R \ 001 \0 S0 S0SD>0 CR 0R00pphp阌| Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00 ` R"R000ӑ0 CR 0P R  U 00ј R0 S0 S0S|l -LMMp0UK,0 d1`@ Qr0VP1 L /,P MK!,AP /,00>0@` V?K=P i` 0|X1 R  |p0S 00S Q0S !"4 40X ,0S$,| 0X{ -LMK,p0 Q`. 0@S {W0000T00TQP  q qT@D0T0T0 d20|@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  ! -L(MHq0D@K$ 4a 0 6q, A+ q]pd0S5 `0S1 4P%bP0   Y]p0@`TU0+PPE V|` p@00U00SV v0l 0S, č؍i$ 0l - @LM0 .ԉ 0-L r@TlPll 0h鉕* 00qU404 \0S 0h?0<؍či \DD*D0D*0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`pX P8 ,&00pEP6 P@ &< p< 10@GS񟗶$HP\dlt| 8Thpx4$P@@4@@4P$p4@$P@@@l4\4X4T4 H4H$P@<4$$440$0 s 4 #4@@#3@@330샟80 ;0e#00#3@t#P@@t#t3PT#@@3@#PP3|3x3t#PEl3(#00?$3#< s<82"P2@@@"0#s"000qS`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0S\2 R 80S0Y 0/;40$"0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   z11 S41 R!1 Rx!x!t! 0S SX!S0 R@!0 R0!0!,!4K< n< >mP L 0H 0000 KZP"[R0 ꄎ̎ЎlxȎl|ԎĎ\ppLphtllİԲPphhht@ -1L1\0@p *P`h Jp1 R\0SPPK 30CS4D0.S# A0SW @C0@T@S@@T  003S 0 R Dx偒D0 SDTwP0 0S0}봎0p -LM H 0R,0 0 0 0 $5 R5 R 5 R @@ ` 0KV㼐 嬐 娐 夐 堐 尐 崐 帐  @  QQ \  D0.S (0^1Q o @p0 D0S@@@P 80 @T@1Y1Q@ 80S @K 3 R E 3@T PPK0 #\@K/+0 #*+P @ PXml QR P   gP@ 0 0 '0 0 0'0: S S 00R0 d@ `Vw R 0@S |@ p2KL"0 ST2  `V g`V2 ,0S ,D@K"0 *lx !0t p *l! 0l *l1h R0d0  ` `!0*ld  000 &0-S gLpl 0R@@@ l P [| | ?0 R0 0p Q0 R =D `\0 ]'|Ď̎hp̍H< -LP# \ \ P  \  Php P 3S40 RP \ 0逎l 0-@LTP 0S@T0  , 0 0CS00ä0| -L MԢ ( 3S 2 R2 R 2@hpQ[ 0SU l2@` RL2 Ry<@K囀$ 00@z(2 Rf  r2 RY0: S SK 0SC (080c!0^1 R 1 R0(D1 R&1 R# : S : S h00CS00  ä0 pW (0S ((I 80([ "88 #$ , x X@ 0B ?Q@0 hu  Xl̎ĎԎ$teԍ|| 0-0P R 0L0x0 R00d0 RX0 R H0 @Tgg00Ďh -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@4g8 4jgP80080 3S 1 R1 R 01@^gj80 R< ;a/᳽P  : l00Sb0@7 \f0PdS T0<0 0ꄏ dMbďЏ <d -LpP`H QPP=XaP@0 X P2f `VMP0`  (`G(0S<0 0P,` P0,,0$| 0S0@)a'aLL a,0 00  dl00P 0 RPd p-LM`kPP@0  0P0`\0dh  z00TTPPPPPPP pMupr꜎ؐ  -LM,K2嘢@ 4pKT ' @,0@PQ h2 R,0S:P0 P, 0,0@40Q9 @T40Q& , Q ៵00 0cP l  1 Rʄxx!=9 B = 0 0R 0S(,! 0R`YV `0 0,00 R D Q $08 0bS$0$00,0a00STd 0,000,0,@ m 0Rdd؎@Xl p-LM, 0@<080RF(400 S407ڤa08P< 408 8 0R  K=0l!8 0Q =9A =C@@  0<1@ Rp<0!s 0R@ 0 fp`8P0800 Yp0 R`8P0t`8Pa|X`8P"2n3c1@./A)b2b3c13N<000S `8P0?BԑC -PLM@ 0S & \0\ JXL0 J d0PdS " 0 I 0 (Pl --M L0MpANK0 @D@D\ 0 P0 ` p0  U` 0S L "4 "  -@bLM0 0Cs0$r r@ 0_0 0Cs0Pt@$K@Pl$@T 0)@TAQ Z_P |1 p1 R0PQ$. 0<{0PU s  0 R0PQ 0S 0 R _P㘀P  0P 000hD0PP 0UX^00Ēt|̒ -"L,M0S l0S0=^P L2@P@ 8@@ @@@@PP`"1h: 㑉쁟PYLPKp)$ 0L` p_PI0)% pL` _P6@ H0K: ,@ 8 H@ D@ @@ <@ 4@ 0@ p_pP HH00D00!81@P,!0(1 0 10 `@ `,0 # 0x ` 0PDx 0]0PP d<@ Ўhؔ(@Xd -1L$M@HK,@ |H0KP0T0@0P 0P @ 0` S@)p. p ````   @P ^@ @/@@,P 0P20 ֗PP0P 02S I 0\` 00,000,0 Q 8,4,0 R ؔ܎h̓ -LLMTTC`0 $0 RPPp0 SP )Q )Q 000  R0S^ " $0S $V \0P R T K.0l_dK@_\0@L"0SZ0S T K.0_dK@H\0!W 0S T K.0_dK@4\!000SPP `T K.0g_ ,0L!(lL0, 0RL0RR000,0T K.0I_dK@[ T K.0=_dK@[0 x 0>l` g0/STR `Q0.SK R pGꞲQ< 0@lȔ8\0 h0 -L(Mlq0@PKda @ 0 cH yMPD3[1 ,,!0zP"P  0 S  00 0 x 0x 3K01 0 R 000 ^0 0-@0P0LSY0S 0' ; b0PP 0x 00P 00.8H 0$$ D\@h`4PܖX -!LWM0,0  p&PUaKJ/ ^d T KP=WoK0PS @W 0]KS  @P U00R00S|n0 ,0S , \\ K.0 F\0 O \ 궯iD0D <꭯` 0$ 3Ji(h<X -LdM┑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )0.0 PPPP0 R /  \ K[l`K@ X0 0p ၓP ,0S X, tX@< 0 4xX`p̓ -RML 7 M(% 4% @% , 7) ǟxx   , 0 8 < D  t' p2 H0@/S(LXd0DT0@Llx0Ɵ:;;@00S lVA0C2SE  0<00S|090;0:0;0:080gş80:( 8 07IgFKL L4EG.Kx t :  B0p l UP 0 [5 09tK@ g0:;8) TNKA @ 0S 0 R 4%RQ #NKA <4P|ß0 R 4 R Xh 0@0#rP00<0{,0, "NKA 23 R 4 R0 S  "NKA{*l2`P0S2 4 R.". 3P"5:肟@70 <y/ "<(:T 2P00(10 \qP > T qPp!NKA P L0 R 4 Rk (`rlXDD a080 00V00NKA h1Pڠ0 R 4 R Pø;d0 0:;7B/0<0:;:?.AlԔȶܘ|4Tl''HNܙ$@8TpMКx (D\xܶĶԶЛ4'u@`ĜМܜ<|\xضtOԝж1 bZ Z0% 1PFKL@ L@@@@@@|aGK@Hx t : 0p l P 0 R11 P0Q1  t.Z2騁<P 90 I,%R0 KL@ L@@@@@N>K@0C, @:0C D uPJ$0S p0 00 )vWP"0  NNKH2@D@DP)`' 0T `_WPP2)( 0`TWPxYp 1Np X 0S Q0S33 0 $.0% >5 UP$  #0 5@T @@T \T`$0 00000000@'W@Tt@0D @T4 @0ROK4 Iq DP` 4)* 0 Vpr FKNK@D0D% R44:0  4 $: 0 VPO0 8LuP00 0 s0% 0% 05S8%R 454 00) .00   ,0S  < 4 (%R  <5P(%. 0s 400) /0   0Q4 Z|&0) %R P0Sh&\KPEt '@0@YVP86'0@NVP&@)$ 0 @BVP6)% 0@9VPE(@C @塮  囮 50C5 堫| @ >qFF,(0@ Lx00MKBKK dhdKL@AI L@ A 0IH P L PUd@T]0SV(0 NP@0 5 @^P> H804 =KL0Cˠ 4 $5 4 HP5 D 4 IP L%$  R 0SLPڴ0   ꃪ0S Ӯ^Uz0S  @Pr8NF@:0=KEK0CL0C 0 0Up: Rh[f 央; 塮/h }D0 S \N>K0Cɠ@ 0Ct* @ZU }05 KPP ;@<\0+0@0 )<5. 6UPh0s )|; (UP0s ); UP@P 0)3 UP%]P$O.K B BzhPHphPJvF4%4 0 @% 0) 30  @0mFP@ V @ThOnK`F`F 0P@5@ 0S>oFPFTK,3F4]:S@=PH) P04 X=@O>K0C)0C& D TP 'KNK@D 2X-D)+ 0 TpDOKI) 0wTp$,.N>K0C 0C@ hTkPT.00 1l|$x>x 0P  1 PPj1 hJE  0 V$ RVF,%0a/PP0  P$ 000P ꘖ -LM8P |0 R 0 l00 =7L z8h5P 00 @4 @ @ @ D K )T@@ж<1<00    0 Ķ -3L$M R 0SS@@@@@@@@@pp3  T\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p 同0P0?@ P`2 X00P 8 k},喬@Kw<@@<4 Ġ̌(<"4!Č ̌$- |{P a!480Pж -ML,M"0"KiK0(J, KŸJ@(pK(I @I" RA * -딂0" 7 * #tr0p" - *0SP `Va (" * *Q 1 R @P  ^vK0\ ,0 S ,8*P@0 0|p`0 00 P@/0 v/+K0L $1$ yK0pG@!0P P  *J*P@F*0 P/T a/0 v0 0 t   *vY@ԶжR̶8RR |ܠ -LMf@0 @ 0 PRh77,8X89999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999998889999 9(90999T;Q77777\峠 0S < 0♣$  048<("#0S St0S S j 048<("d`ZSPLHQ@<840,($ PPKI .0!LP 3 .0LP ). ~t. yt0dpC 04SM:4;<;D;L;d`2  _  R$ R <W 0PPK .0KP 0 DRWPPK .0KP pU 1MKӢ @D K@D @ @ 0Xt Ptpnlhd`\X嵢 峢 04S;;;;;妢0   Q1q@XdPSS|VV0@ThUSĢآ ,<ĂL`LRxĶ ̣ԗأ, -L@MP0q DH0`LR!R 0 U8,#44$<@PČ! @P@KP6 .0KP. | p) .0 KPL.  ) 0S , 2nsls4PĂt| -D0 ML@( <@@E0 R ĶlĂ0` 'S0-LP@}(@0dSK<Qo?h@h@h@h@h@?h@h@h@h@h@h@h@h@h@h@?h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@h@@ @h@h@h@h@h@4@<@h@h@h@h@h@h@X@h@t@壡001@T0d*Sʸ0h颞 0$0h鍡 0|xt傡0d`{001 @<0ho40kꄤ+4X`XĤؤ -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @K,P u@0SPE .,U 0+S-S0S .P.P .U@PE PiU`@PE0SvPfP wPr P ~00S 00SQ1 1)t<;RPBPcj_ll@pxHT p-LM@5KP `p -LMJ<@T00.0ħ0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SJ/;R 0p -L0MԂԢ 0Pp(0 PTPK 2b.30S @@ዜPH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K^pp (0S4(PT p-LMP`0,@KHP 0  G 0Sp 0 -LM@P  00R0R  00Sh$鼻 -LM@P hk00Sh#鼻 0-LP@P $00S0h# 0鼻 -L M K5P@![A[R0 ʐP 5x0td P00TT0@LP !400 PP00ht@<DH -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 CpP@u|*`0A>@t 0 001 0*l(pP|[*?T A.0O0P000B>0,10S 4PU/0K000 z*Z@040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0Ļ,\X -pLM@ 00s)0@X@-`@? 0"00\ 0S0S000\Ļ -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$Ļ -x0LM@ 4 BN@Ap@0t hz 00NpĻ 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0Ļ(00S00B>0Ļ@-(0A> 0$Đ6I Ļ -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 Ļ 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hcĻ5=?0/9P6 0S000\ p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 06Apqph(pĻ4 -LMw3Px 404@0  0000 0 00 0 Ļ0 00  0?\00Ļ -LMX@ 0S 00 0< @0S0 04hĻ -LM@0 @pq @ -LM̀p`(P@TC@!3A>B.A 0 0$D4 dD P  40 40 4sto(Ļ 0-tP@0L 4@ 4@EQ 40 04T<0@0h0Ļ(00 ĻpD0 00000Sp00000S  p0 000   -p000L00 0S0  Pt t%P@ qL0 0000 0S8 0(0$    DȻHL(0 $ 00 0 лؽнܽ -L 00 0нԽ p-LMP%A$`$@000A000pнԽAл -`Lp00S 0P@@x 0 0S %@0 0 00(`S@0S0Sؽн 0-L@LP 0LR0 0CS00 00 00нԽܽлؽ -鐠p0 刀0b? |`PUL@0S 2@0 P0b?U0S( 0f0@mԽܽлؽ -錀p0 儠0b? x`@TLP U uv@0 @0b?TU,0@ 00c0m^Խܽлؽ -PL0`0pS @R@ 0 R J@ 0 0CR00S 000$8@000ؽн p-LM|` x0RR@#@`0`P0 0R00C0@00`00S c0SpؽлԽн 0-p@LP@`0P0?D P:00@P*0P0лؽ 0-t@tP0LS 0S 0S0800 P0S00ؽл - 0L00S Wؽ 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0ؽл -LML@00 S00 S S 00 SSؽ -H0LM0@S ,0@$ 0@]00лܽؽ 00l 0-L@dPyy\xdxxlxyyDyhyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&l4 h4|ԌЎ,Ȑ؍|`4XЋ4@DD4̑\L|Џ$Lhd44H 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S   -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S R,UVP i; R Ry <20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S, 00S 00S#pWZ00S0   ,0S 00p 000 00SYk 0 o~ ($P| -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7  -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0 -LMp`pP@uV iE 0S<00S,00S 0 0S00CL$'I P000PT -P0Q0L00 00 000T| - L00 00C0| p-LMP`(!@0  000p P0-L@P@ 0T )0h )0(0PPT0PPT -LM@0S00| p-DPLM@`T Pp@TpT 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+_p@ LP@< P00 P8p0t T 4  P 0`V00S100 P``V0P@` P@@P@Fx00S00 S 0 P@ P p:P@<P  -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P b @0Q P 0Px00Sl00 @,@ @0PU`XW,x  <P  p-pLM`Pv ZP2p P P@0P`40`%@0P`p P P0`p4< -L0SH hp0 s 0 0  Bh( -LMp`pP@u P |00Sh0 tW V P@(0 f K!HDh -L M@Kq O p-LM`pP@ux<pP@uPph UT0 phꈬ p-LM`P@P  P pyjP@$00S/ phH -L M`P, , SP,0@cT A dxlP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@H -hL-` 0S 0 0S<0040   0+0  -p嬀0L`%PPጠ %@T0 %0P0@:  cW*  bR*P@`L0 0DS@0 80 40 00 ,0 00 0 x| -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 *$1P a,1UP0!c0@PP 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8( x4<|H p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 |x`@P $$0 000@P h`t|$0 000 p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pp`x -@LM80 00 B0 @00`0x| -T0LM0@SJ@000S P @TZx -0LlP霾 -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000X|x -0LM00@0T0p` Pcڴ10U 010`@q$P`  TJ1U RZT010Pe0 DPPE0 0U00| x -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c 鐾l|x P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P?&0 @@0@0@0TP 0 PX 000P 0 yP  000lx`Xd| 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000鐾|XxP00S 00<0< 80Q0(000000ᄾ 0 0 ᄾ p-pLM@0`t cPP:p@ p%#@0t T T000CUP800@P@0 V000p -@0LMTpP$P $@0ꌀ0P0PE P@ p U `ZP @0<0Pf#(0PE0@W0000@-p@T* R  :P0b0D 6@0@@0@0 ľ< @-P 0S 00Q 蠾 -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 頾 -L^ 0  -LMH@0S dR 00 000P00  -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80      -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp+P(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0 頾 -LM P@p` P@t0u00X00S T00XtuP@tTU@0 -L M0-S \GECU, ,2`P LPp% 0S" 0S@PP` s"@p"@@?P 0`,AU0SP!51  1{Y L W40 , oꀬ Lܫ$ 400S A$a0@S<0 -A @L2$0R208 -'PLM! $P .P ^P@0 00 WP|@000C 0`@`000T@P@ 0s0s(((`L -LP 0-LM@ PKT 00000( -L M@K0,sώ0s 00@3 ( -L M^@K |0^0s 0s\0000 H00 0400 S P `( -LZP ,0, 0S (\@-, (02 S@04R$  0-PLMP0K K@XP# 0S00R0S$ 00  0x P-L0 x huTC 0-PLM@Y P 0P[0=0C:SGlPhPdP`P\PXP@8Pv040K 0(10 e08PPP0PPP= -@LMTd ThL0 !@<840,h}霭0ȭ<t -LMЁ0P@$0 * TTbA`6 00B S10 0C00B S0hQQ@`#0,SVVE1C B(1`$1 <qK 0S#T`VPK K @ 0@1` 0`V@K 0@  `PK@P0@`0P KHP  $0S4$ zlUЮ -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 ehiخ -l0LM@QT T@ hN$0  h400 R00\ -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RV,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[VX$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4h@hhh W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHx$ -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSWUF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS0010$K0$0 U 0  0  Ld ȯQ PP -LMA@0 wp -LP0 0S00 -LP  0   0Px -LM0K0 = -0L0hx -`LPp@x`0PSE 0$S T; "P80 0C$S'4@@@@@@@@@@@@@@@@@@@@@@4@@@4@@@@@@@@400@f C 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X`  -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ R(Lи\0S R 0 R000000ӑS$0S(A0@Sa @0R0-P00 p-LM@P` kX0@0P SP000000STlm0Sp\ -LMK -LMpWm `W@T@@# 0P` -L  M0KA 1@ _P1$a0d {P@00KT0d  U0K lj0 e -L`P@M\0K0 0鐆P@ !) M0 K4\0d 0\ >0 K:00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS 00CS ($@T U7`KPP0DS { 0@p| p-LMD`DP0@S 00PAP0  Pp`|0 0-@ L08PS@00 0R+0@00x`{ -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hyp`0Z-00hH  ,0 S ,Ő -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hCp`0Z-00hH  ,0 S , p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0Sgpgfff 0-LM@P0$@K 0 O 0S N0 0-L M@P0@K 0 }7 0S 60 -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@] T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShLD000@000T(0 ht0pd 0-L@Psj 0 0xx p-LM`0PS@ t00SX 0@S  @00Sc?(0 0S0 >p0ppT00C p p000C 000C?0010@-H 0\8001000\0 0100@-<00 CR,0010 BR0 0000@-8 0R (0P@0100 R0 p-L MP` 0@R$K0S ];0 &00$0s 0s 0 01$ Kp|0@-P 0S0S0X@0^! 00S 0SN00^0 0AP<00 r0s  P@-p@0\`0 0r0s 00000\0  0P PPB@ -LM\X@TLD@0 840 ,{(0̥LX p-LM@@`P8 0S BPl   >0  pHH -0LMK0K00K 0-L M8P0@K 0 . 0S 0  0-L M8P0@K 0 N 0S  0( 0-LM8P0(@K 0 n 0S 04Ă -LM@u q0r00T00S 800T@qr  -LMB@6P񟗓h|$,t1 p1RDT10SD1@18B01$1@0S, lpq' P0mp@q XQP@@ K0 SPO@@=p q  (0\PH(<  p-LMB@6P((((((((T((( ((((((((((((((((4@((((((8(((((((pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?J@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@ut0 u SR?P@09 \p0 s2  0 _0 S*P(Rph=Fp0 s ph| |0S0S S00CS00S S p@,0RP phph-p(HT 0:S S@.S ?S  \SR R 0-0LP0CP@ SfLdddddddddddddddddLdLdddddddLdddL0B0C2S=<XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX4XXXXXXXDXX,XXXXXX\0 00 0 PE000 -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:gHte0 -D0L<080`00 ,0b A0 8(0$0 0b0c0A} -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00 l\00SH00S800SSS00S`lX0S r0000000S0S 000  $00S00Sh -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVpL -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CV4< -LU0S, ,h0S000hVL< -PlpL† @:0SX L0SD@0S0P\h -LM@PD0  p-LMP `@ (0K l0 0"T\j^PP (0 00 ph 0-DPLP @T000  00XP@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q4<<L@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@ @ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0RV@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\00S0 0 Td` -LM@K=0s0s n0 c -Lr 0 0S0 h<L -LM@P  pP@udP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u d -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@TH < -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P <hl<Ld` -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0PXp@-`^@P  \\ 0S 0\ 0SP@Up^p 000 000 000 -@LMTP oDl< gdah]556 -81LMXH @@ K}sC@F`9a:eK0  @`Pp0S0S 0 0?00`0  X 0S L0DS$0   i5t  -LM0$ KK 0 0 P$ - L P00L -LML0K Ap@T0[S00KT[ -GMLM7GnK, 7ǟ`F `F@0pxX D D E d'Cp 20@FS::@@@@@@@@@@@@@@@@L9@@@@:@@L9@@@L9@0;@x;;@@@@@@@@@@@;;;<@@<@l<@@x<@@<@@>??@@\??$6 R6 46 R0%<0UK1 L4S 30(8UK1 Ll4S d <%tT5  n@5k$UK0 LQ4S 08:$000S000;ꬤK0 L34P@S X?04@ 00@008<4 R$ , KJ @ P@DJ PE,$ 0 Pv /P* P P#0004SP0;000@P Pl3 Rd3 PP`3080@0 P;  PD3    P 3   P2 R0"<P P070$H P P060$T 060$P 070$L 0H70LPT00RK1 L芲4S >0$000QK1 Lt4S (0,0dQK1 La4S d0 0QK1L N4S000 1 bXq$B^KPEPE@bP  3P $0P ]0-S | yR'PppԔл4Ld| -L4M0 4 00[ ,0 zZP@K0@hP@P 0L0oP 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ $8#8L0 T3 M 00CS0|S0 00i2P@7^@ 000<%0SC0S #0P 7]000 0㱁L< C444 00 0hBD@0pxꔻd2 R  4@ 0SZ ,K00D ]PPJ w=D080 ` 1B< @K0 00!P@$ P 1 xᓺ]0q@ R xቺdS0`1 RH@4@0t0@Y.@P?/@@B@DRPN`,0 @P`VP$@Z -@L MX &>opn00}X$`pZ p-LM&> @`@X NP PU$@pd -LM@_d0q,' PQ P@   x,` v  V  U0 0 -LM4@_d0q,' PQ PP    wp00P0S@,0  ,^  ,0P @t  T @ T0 0Q  )@sd -GMLM 0`p,0 MK@D@D 0P]%0 )K oO~@0  pW `V@$p,0 S ,3yx -LM堐UZ>,0 }nP 0  @hP@W,0X H0\S ,0 W,00XP`p,0  )8 - 0 S\R$ -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@&0! o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   5Tp -L PU` -`q00 L 0p0S2 @ԛ PP#Uw 11>p S11>.QQ$ DS<P pS x 0-LM P R|@|K  0S@ pX P@0TD  <KsQ 008H*,@ p-MLM`@0 0 P᪡p* AK@@+0YP! T*AKAA 0r00000S  r\00000S 0S@\:%0 S.tp Ы-Q* rh000000S  r@00000S0S QQ:  p-PLMU`x x0d X) 0@0-PP0P0p` p-LM 0@Px 0`0X0S 00 0 0v@P @ p` -0 SL0S S h0 hr -0LS S h h -LM0@S S }  h -0L D7s@L -2LM0, S Q 10S 1 0 RA000Z ,  00S SJ10S? t1 R;,00 ^SZ 00S$S0000 0 a@!T@@@@pPL0 0`Y P00QP 0 Q`,  i pa Pp P`lPd0`@%P 0, 00 0!0 0 000teX$(,0 0-LPcP ۶@Te 0hU 0-LMdPhP@ 0 SEKP0@   0T -9LM䙟 000`fS0  eS gS )))000P@00GS񟗲4444444444Ѕp؅(4PX`tІ (08T u6 0 00 R5 5 5R95 ! 0 B 5E ,Kݞ0, R( P00R0S p AW`5 `EPH%00D%6 ,K0, R P00R0Sp44t44  44 4 F$4 4<$$000jxx0 0 0' \4\XX 0D4R@4P4AOA30000E3 3<3   83 33/3)3 |3$3"3 333,CP83d P LP 803 M 3P0@S@ # 300pp6L20 P2U0!0 `c TPV00 S&V00 S00`F00 1h0dS"0T00H2 0@T03 0 h1R0S040  00CP \1 I!P !<{x!04@T<10S\LV00S0  VTP0P 0 p `Fvp 0 `F0 ?vpWo@  |Ԕl<@D| -LM@PdpK# H p P0Sʄ0 Q T p`p  00 00  -LM@  h@- 0@R:T 0 S* 0R S R  :0 0b0000h 00 0lp -@L0P00  S T00 0D S0<PP4 0 0PS0hlpt|8 4R00C0 R0 ltp -LM@T- -LP p-0LM0Q 0R0SP  10P` 3S S S 0T-P 1P@8J0S p -PLM`bPP20S|jN P `20S5DD"0@S82@@ 00K0` <@ @@ &0K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@tZ00 R00S H!000 810S,10S 10S@q0S 00S0?M 00S_S:   P0S r200000S(0_S% 0S! 0R rT200000S0_S0 Sr200000So00S_Sk  Uv 0b00S10PcUmp]0O00O0SO 4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU,  -LP ܊ -L0P p+ -LOP Ē0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0-\0Q 0\ a p-1LM0`S@PPP10S U t0 CR 0R0 S 0@00,/IP$10S U 0 CR 0R0 S 0@00IPU 0 CR 0R0 S 0@0TL@0 00CS0 ph0  0p|lUH -LM@PXE`p!T)pF@K 0PḌģأ` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$Ԕ X p-LMKP @P`J011QhTZ P@Tj_EZpD]P TP`4TC -LKM MCNK@D0@D,0 pLIKKPPPM.KAA^gP@4: S  S \H,0 S <, imK`F`F P@ PP  㒑P@h 2 R_2 R B PO {P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K )KKNN( 0<K @jwP`! $04 1D MNK !0P %0 0ex3H{p oG@㢬P p @RD@0 0Pd :㏬P $$  pvR:0P 0 2P T]] (P@T Ph5mK`F`F P8 ]X,8P -LMp(KPP3 @T `W@ W Tjo(TJPZ ( D (00(8PZ ( D (00TGp 0-x0L0PS0@Q  tP 0S(0 R00 R0 P-L` 0SnS 0@ ,˫P@ l0PP@p` ,㹫Pp@0oS` 뀢 p-PLM@ PPp$P .㒫P 00P @Q T`P. }P 00P 0Sp  -L 0KM#+ -L 0gl -OML M\3PJK@@| ,  =0c(#&ph 90@?S_DPdp404004 0408 0404 Q.K B B< 040tq 0S BnK`F1`FQFPB 0 4 04 $ 0* ) T XQKAdp* Z5<4 Y584 X5;;44 J>K 0CPAP P| As0$\-PPL [0<1 /fԔ`p -LM@3P L  q0@0  R\. j  -LM@b P L  q0@0  R\  I  0-LM0P00CSK @ 0$ ϓ0 R  /00@TԔ -L0Q e -LM`P_P( @(K,pK 0  (0@S -L M0@p00 0Si ~DPP 0S nSZ =P0`0@Q CP QLQJ  0V0P 1 0* Y0  0000V 0`0@00 ,KҒ, ?R0S@p @@0"Sl 0Y000 LPH00D 0oSP }zPhp -L$M<@K`PPD  P40K*PsC圃 -0,0K * K#u$pr ?0L:Sl444444444444444444444|44444444444444l444444̷444444(440000S  @@Kp| @ ?@嬋2000,K +K.0Se D 00|!0`VQF `Fv  )PPp   0z`Fv 9P@ p姨P 墨P 坨P  P@D0S  Dp\0l 0 aC#40K`6Xt0 xtԔ\lpxX@إt@hX -LM0@S\ SPH NP8PCP xX@ -ML M0ß0`@( ,0 @+3P`d088 B~KpGpGP"04 0X 048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0B08@Tn @ p@` P- U4X@ 1 ,0S ,cKAA mBP<8#4P   \RPC00S Y B0S>0S 'cY  BBBBUt4r48tB08@TBbTk ,txte|8pl 0-`0L@PT  㫋P @T(0 R00 R0 l 0-D0L@PT  ㍋P @T 00te p-LM:`PP 0h 0@T  nP @T0 ph  Jp -`LPp@0   0@ -PLM  0SlnS `0 @KT\A0S@ @ 0oS0  ꀢlzte  0-PLM@0P L\ y TU0KhpR(@h -L M0 40 (KP`* A2pP@0H U0S -Sl01=P APAKP@0P0$`P00`40z0 -0L a@ 0 00 --L ⨪a p-PLM@P`l0l R NT D0 Rp80@ o 0  @a M@g --L  --L  -LM@=崛 h,X --L ua p-LtM/PB@TK _P0: S p0`rS  0-/L@BPU+D0 00啥/00(+y+u00g -LUMpPKP_P@lK8_0S(0: S  SU P U@P P@0 R000K@j_P h1: SD @c$^=TCh h0h P-L P @h -QLM@ P T &Ph -LqP `h -LM0 $40  8 Pp  lP@=  PP a`.W X X0SV  0o 勚88 0SV  04 P8 W h r?W X0 8ßR030#00 00`QX0 ,K ?pz Ÿ@T 0S @T<T ,  "4pp PX^^K R0000 0W 9 00,80 080  0PP 00  B 0S00C0V 0R0R`V` 0S 0S4P  0S 4P A?=  0,<Pߙp  0 >, 8 R" 0PU 0S  0řU  0P嶙PU884P00`XKc9LL%(0@te<XLR  -LP@P : q00  R.@P*`p@T  "P0 R @Tj@0 0 000< @0@000eP`* ( 0-T0LPU @7> @T ,1>@T PU0(0 -LPp @`T mP @T@74 100 00 @@m < p-LM @`P 0PP ,0 R +p 000p -`LMP@($1$ Pp` !B0s ?S mS 0Pp) 0 PbQ VU UWt{V f^0 pR0`0ste@X`Ԕd -LM0@0cSZ bSZ4 `K   0pR R    0 P `V | $40"WĂ,(0 ("4S @ P Gx p-LM@PP`pP$0S`= -PLM808 4 $@,  ]@D -L(MP4`K8pK4  00 PPp 8P@ 0 PPp 80( (,K ,@ $ 0 C]  P-L 0 ,0, (岗$9 0]P@d -Pp@LP;`"pT@6 "P/l|`1`1 11111a Q@b811 RP |x10sL P " @*P800^p]00 0TԔp8 -83L,M pR@`#TT` 0-S  P P 2@2P@DK  H0KD @ ,@ ;RPp H0K  PP9PH0|p>PW 0 W DtX 4Lp܊ -LMA$QB$00000 000000000000000000000 0  0 0 |@xx0  Q d\0S P 0R 0000ڂ$@`  -86L M P(R@`,P 0 4P {0gS 5K@DT%U0-S 50 , K P5 RןP ttt%w:00@DT\5\%0Q4  S4  040 5 s 54 PppRp@600 /PP 603S 60S4 R0S ,Q  0S ,0@ ;0gS 6,4` R484P4$ ,00:0SU V  V/ :U7V  :U00T00S 3 R39A0@S 3 R 0kX9T6 b0 0, K4 [0@,SAt<Tthhtt (08LTt\ttdtt0 0<2 z|@T , KO4 0 @T  B@T p!00000@T  @T 000 0 w@T {$1 1w @T  w{@T >eyyph0$ @T {|Zte\0(XP4ܫL <` p-@@LMTP` 0-S*@P!`@DTD0ph_`,0 ` `P-P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S  0-LM@0 S  0S 0S0S0SP 00 S 0 S |zY00 K 0 (0 $0 0 PDPU <ᤝP , 000H0J -L$MğP`P4 t4E @ Q(s3 @ RPU U ß 000U000DS񟗿dHKLK 0D@ H @ < 8 4 0 , 2iP7L R/0S ,L R R H0S U 00S S0S 1#$0$0 0 00S  0H hP X00U @ AP BP X0 PH1Z@ 0 P P 0 ( "# v P P0 R   $00@Wl dp`p\pXp@PpHdX80X{8H\Ltt -LMP @00S p SpBT  0ϒ005Q^` ^ T0 U   V CR 000Rh 0 R \0R \ 0 S0 S 0-,@LP0S tP@0< 0-LBMP0\0 @ \ x 0S dS0 L1\F/K < R | -0`PL@ p 00B S0B a0BSWBA0BS7BR@PPlLx`` `Q:0e0b``` -L@LM "00ۖP 0;0, -L M0 K@8 0R -LP,MDKHK`@  0D @ ,@ 2p 4SP44  RQ  0|@th0 XB0 ,0S@,Ithd-|11 l8&L,8\DL -LR6@00CS00  ä0 孻0S t00S h@h0hP`0Xp01P@`p`p0$0垿d-T`, X&@&d, -ML M" P4 , 0 ʂK@ A@"/P 48 2}2 48K t2@ l2@@@)PP H忿8 @Tp R 2 k 20Sg KAA2P1 N[480PU 10S  BK@R@ r100000S0 R0t1000ӑ0 RBKA00AD10S w ,10S  Q10 S`0 pp0S00S @PpJ0P0P0004 S/P@8?80@ ,0 Sd,GTdd-|1X&T|&d,1 l8&L, *D`,X,0 S -LMHCD\ <<3|8#0 ,媁 寁30S]%0S 2 嗁圁N%2r20 \0倁2 yŸŸ"2p2x2`l2P`2@ L0Z<242@ 0 N2 G21@{ 0;10S !12710S !1%*1`X1@T10 |p1pqHh \1AT1T \|00<0S(0@T Q 0@TP0 T&d-XteX,H,0 8 \ 4pe1 0& $ L&L11$8&Dh1T`L,ph-,"$"t&T,d&  D, 4X|1 p-PLM@P`0S00P x^oP00 \VoP L0 D兀pV 0 ypd-@X -0L 0`0&|1 - 0L0 0  l|1D, -0L 0 |1 0-PLM@ !0S000.P 1 5nP nP0 K1 u\0 0  |0 0T0 HPH@DX 0S40 80 $"d-T,|1\ -0L ? 0 |1 -0L 3 0d&|1 -0L ' 0(t&|1 -0L  08 |1 0-PLM@P\1 T NP@!0S000!P jnP  enP0 T;u0P @,Ή0@0 @0S 00S 0Sh0~00`0@0 P\04@b0 00 0d-L H,|08|1 -0L 0$ |1 -0L 0L|1 0-PLM@(1 -%mP1  # mP K1 t\ 0 0 00 0S000hPt 0@S00000.,0 D0~0( S0000d-("|14&  -PL M   KK+P 0S0 0~0 00P|@0}S t00S\0h~0\P H0R@0 P,0  <Pd-|1l t&\, -MLMp0P 0 00P0P 0 ~`?-P0 KP3$ ANK @D@D%P X0 \`~P $ 80 V 0S( qDd-|18 -PLMd   KK_+P 0@S 8080 .~(0 0td-|1 -PL M0 , ,K0K0!:+P 00  1 ~1 00 1 0 X4 $ R0  0S 00C,0S Z0S0@0S 0P0/,P0P000 9+P0`@4$@Tdd-|1&X&Td,`,   -PLM   KK*P 0| SKK*P 0\S T0T0 }D0 00S$0  (d-0|1P -P0LM0P01@0P1 q}ˇp 0\``P #,P0 P᳇P 00|S ,P +Pp0  X0,0%PU h<d-X|1* -PL$M0 , ,K0K!?*P ,0S ,K0K!6*P00 1 }, 001 4  4@ ZP 400|S 4K+P 4\D+PP1 00@ <1 41 9< $ι1p0S. ,00CW*Ww0a050K00`!50K4G0pS0@0S 0P000 +P0P00h00S ,00CW<4@0 P,0 Thd-<|1&X&Td,`,  -ML Mq0$0 ܹ`عPP@P@@Tʹǹ|uPP 0S`Q/#P@Lq@BnK-0 K@`F4!0♆ 宆P+0 K0 10S AN| Y-X00  !0  BBK@Pyv`Pt00P!@ $0S<$0B("d-h&|1 -L`Mq Px t `tKxKd!)t0x 0CSL1 D{@1B8SP-t0S x0t00t0 x0CPt0S@{pPK峴 PkP  `x0 Pt00t0 x0 `#P \0{ Vt0Sx0X  T0 0S@ Ad-|1$,8@$ LTT& 0-L@0LDP0P 0000}S$0{P0 d|1hd- 0-LMMlPANK@D0@D0 "P DD @0W{! 0S$0 mA0d-|1 -PLM   KK^(P 0S |0|0 -{l0 0PH00}S <0<0S 0"{0$d-|1   -PLM   KK%(P 0S |0|0 zl0 0^PH00}S <0<0S 0z0$M(d-|1 0\ -PLMX   KK 'P<800 z(0  'd|d-|1te -PLMX   KK 'P<800 z(0  |d-|1 -LMM(BNK@D0@DP+(0 ÄU)0`P00V00S B.KQ B B 0BNKp0@D@DQ+a 磄`P00V00SBKA0A@)0KPP (0S(`@ -PLM   KKS'P 0d SKKJ'P 0DS <0<0 z,0 0Ed-|1 0-0@0P 0 0RLnP0  0-0@0P 0 0RL[P0   0-0@0P 0 0RLHP0 (0 -LM4@0S 0S?T& 0-T@L0LPSH %P׮40,0P 00T&8:8X,P  P- L<80 y,0  jh@d-|1XL -L-800S7 (0( 0S00/mX,T&1  -PL M0 , ,K0K!&P00 1Wy=00 #p4 tAtUy7d14  40SDAL 4  0S$A0Ay#$Pㇶ`4  0S 0PU @(y q0 PtP@ d ,040@ L0 P0R  M鼋dd-x|1  LT&\1 -0L 6 01|1 -0L * 01|1 -`VLt Pl@lph000x000H000V ,00h8&|1d-h1T@-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00Th1 0-PLM  1A00cx P KKw%P 0S 0 0Gx 0 00 P0 v0@0S 0 S  @j@00D0HD 0 S , ,~0d-L,|1h&X,h-," p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(vpph-," d-, -$0L \00'0  H|1 -0L  0X|1 -0L  0hL&|1 -TL P D00}S8080S00v( P 0  x|1 d-\, 0-0LMS0 lKlP@tPu @0 \ ,0|v0ov000d-\ 8 -L MTr0$ S( D P8"$K(Kx#P $0S (0 2Hv 2 10S1Fv(0a z0S1 0 14v1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0n@t0 S@  1 0U UP 00PUP00CS00@Ӥ0N@ T tt 00CS0? P0 R0@0u @p|d-|1 ( ($ 0-PLM   KK"P 0S t0t0 ud0 00$pP@0<u   Pu0@0Ud- |14  -PLM   KKʟ"P 0Sp0p0 nu 0$0sK0  BH( 0   [u 0 Ud- @ |1 0R H P  -LM00 @P  0 0h8u*X d- -PLM0 ,  !,K0KM"P ,0S00 0u0 8 #P0 P  0S 4K1p] `0 p吀@ 00 h04dP_n4A00080S9U d-|10  \$"  D -MML M<ğ P,   % OKAOKA$@!P4  S0X C4 lcP@ 0X30X 4 3t3 NKI I tt#~1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 f~4@iQ4 Z% P 4("  f~4 `000SP0S0q0#00p`1(t1`CP 0S 10SX1tP1 1h10S ,A0 t 0@0P,0 B xQ  |A "  ?iBΟP  PB $B (B |  tpbPp \ hbP@p @ _bPPp" U`/}P` 0ST PV 0ST  "Rt! Mt t1S t10ST ^ QB0T00V hx x1SLE x bPx1p x bP$x1pW 0S /FY}P 0S00@P}P`( 0S% 00:E}P$  0Sx *$ o*0$"Ϳ:.}0p@S *000@SpbU ጳ| |1s  |}Klp<o/K<00t*}P;01  t+n 1S0 1 孯Pt <P@< 0! pǏ" ĽP E;b  !1p` P 10`S1 l;0S, `;0S(`+0S!0S:L;# 0C\0\00A:0 pÏR0S*:M|*6P :0S3 |:0S/|ʟP*0S'P:0/P0S*@:#0 CR 0R00: 00CS00ä09 AT .P"90S9 ri B )0[S ]zP 0:SSPp :oP0@0x80S 9t` 0`q^K  48T0~Kl1 0h1 8  0YHp70X L@K 'P0  0HHP t LQ0U|1 G SOK <寺PX,{70S7 8q,| |1s ǟ $ | P0S |1@ 0@|1  L@K0@yPPU^|1Sh|`̪F( 0S6H"]qxQU% 0S6$"Sq$P ƟQ$Bş%0(@0LRşUş%0(#?ş%0(:f{P fP@t0 %[{PP(X%0l( %0X  h{P0%(4\ 0ğ$(050S(5  (^  کp /K(P  !R 00S S S B B0! 0!R0 0S S S 30Sp4 "p zP` NK` zK> jf2SPKPP3P 3R P R R xũp3(/K]P  !R[ 00S S S  B0! 0!R0M 0S S S 1SF X20S3"ip L_P"zO0`0K  f2S2 j2S P 2_Ph2B0 `SX2$ ?p(RU `|1s|Gx剻击 "  TtzP101  t!Ȱ 1St-01 P 1S) d%H`L1P@H1 0! pǏ1 O P0 1 MJ   (Lt<|18w("|0lU0<8ȜLP`te( @ |     K    3 0 L ` l  v $"t&T, D&\&  d-  D \ h  ":(H  b0@PP  (p` P PU00S, 00S( 0S!0S:0# 0C\0\00;,1$0 pÏR0S*D1G1S|10S3 10S/P*0S'10/P0S*1#0 CR 0R002 00CS00ä002 1SX-Odp0s 1S"0S 0R 20S 2o20S2oMP R  t(\ |1s|.x,*P#,0 S`,4 -LM$@G"n嬧庫d-l1 -LM$@5"n嚧娫d-1 -ML M60H ,0 0L P$ D4 剫P@ 60SD4 ߫x卽PX  0SX T僽P\  0 S \$ D4H`D SpD4L$:xPi D4LT d P `   =]P   7]P5\P$   +]P @gX$R P$ p/+@/ox:Pkx@pgxPW3 W1*P0#03U0S* TD @@Tx`@ OxPVV*4 T4S 0S Y 0SD4L$ttT.T +T :+x/`'xVP P`3V U  R0305`1:` :xPT 0S U ppU 0S /6PpP30S t3tT$ 0PP m30S@3 0V@4 10S 1U! 0;mV BNK@D@D0!o{x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 O1!0?2cS D40`4 \D4`$0RD4 D4HSD0`$0Sr5` ,0 S, 3D+T& L("d-@ $ <\, teD   |1QX P-L`7 6۷P@ 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00gd p000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@  -LMl @2[0SX  +[0S<  $[0S$ >0P 0  -LMP0  B -PL 0   -P- L0  z0 -$LYM0@,0 4p@` [K) %p4Kl  0h d `A bBpP4"0L@K6vP 1vP $LK 0'vP#LK P0zL0[S LK 0K0C0C0 +, 弹 %@$ ڦ p< 8 4 BK J4`J U0@S񟗾||DP 0tDPp 0PUi@u04S1440S (D(Li.$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 iX30 CR 0R0 S 0P0Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0Yr4$RB>K 0C c R+#$r8Q 00 S Y44044 1V 0  <徥 0 YRE 00S <$`0RR0F<,0 S x,l.<㡥 0 X|18: d- 1X  386T -LM00 (@(0 'h Td-T4 -JML M@͟@<͟KK`4͟VSp(=(͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$gTU< g<@T $q < <Rxp

K0C 0C)00P ㆤヤ4S ~4 S9T 9Pz PpI 0SG lqP gqP=T9`0S 0CS0Y` 4P907pq `v  4S8P@80<HKP 4TSt8P- 84 $R 5P& 4DS8@4$P 4TS7P 4S 4  4S  p7 0S m0CSjppT7/4 Pp``@VP70S> 60S 60S6&4S.ʸ4S 4S'46# 0C\0\00K.K6 B BƟ0O4Sʸ4S 4S5BNK4@D@D+*P`60S7 50S 50S/pşP*0S'<50/P0S*45#0 CR 0R004 00CS00ä04ӞV WN0 S 4" VOl4#0 CR 0R00,4嬞K.K3 B B0Oh40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00\@3P@ 0 CR 0R0 S 0`0C2P@ p`$30S2 20S 20S*|"4Sʸ4S4 S4T2#0 CR 0R002 00CS00ä0140@ 40@ 0 S 1 O4$Sx1 44t#a^4S2  X.TQ4DS0@ I10S$1 "@P004SC4 S0  4S4T 0S0S ,0 S,*T, <&\&D&t&d-(X,  *4Ph<$T|84|1\L 2$"X` -LM00 (@(0 ds偡Td-Tl85 -LM$ϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` nPH H0S > 0RS ,0S X,00-S h>, `=dQL>P 6dD>0S H0S , .0 80 R@0  D0 H0 S  L P! =0S {=0S$NP00@0S@\<0S<W8= p 8=p.XMP0@0 H< X,,EnPS ,00|SO ,6P@/,L @G0S C0 S , @$<! = T00,0T  T,| T/0p0W\<0S 0 S,1P(<0S 0 S <0S ,x , ,0S HQ;0S 4 ; ;R,qL;"PX hPH0S h 0S T P0S  4 ( P@ 4 40S pW%,mP:00 x:p) ,00|S 㙠D ,0 00S,  *0S:p: ,U0 00SP:, R80 00KP0S;0 Z0 SI`#P0`0 `20: S ()0S00$9 &T9@T 0DS< 0S 000"QIpp\#Pp90  cp@80 S pWPdUOLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00b|7XK |ǟ0OT0ST0S X0ST7g4077 &P`ʐ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00h6 00CS00ä0 <6!V0 S6 W W,h$V 0S 0 UPPU 0Rp P@0S@0 nUP,80pS45p85 080> VP00P0  V[5#0 CR 0R004Ě4XK 0O50S p40S t40S \$T0ST0SX0 SX0(ğ@04  P`L0S 000@20 0 CR 0R00gV v V 00 CR 0R0 S 0`0O@3P@ 4p`~P0S CP iaoah30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00T2 00CS00ä0(2400@ 0 St1 000@ ,O80 S1p 1p080@c<`D0SD [4&f@ RH0S R0S10S 8 d1Rp \00 0,K0 p{KT.x3 0$, `D0S`0d0D l00S70 @ < T,t&<&\&LD&D d-(X,185<8TCXL&  \L2T|*|܊$"(P|1\&P4 0@P@@80S 00S08040S4l 0S0Si@㵝<㲝 -LM0 S 01 `0, 1 a 0 S00SS 4 0S( p͟|` XP L B500$= =0 >K 妬P 0S S5 Q<0S) |0S%̟L0P 0 j< <P?B1cSQ < ! _1SA l< 0R0P<X _\H 1  B< \iP,:(:?B1cSQ< `Va  V@ 'jKiKKgK qK mKo/K=KnOK@ڢ PW1S_1S\1SY 8 Y!1 (,10$10 <4<  4 KP"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpP0DS00p PaV00 0Sd >K{P@0S S >K  iP >K ) \PPC -P430 >K EPxrXC0r/K1 彽P@SfP_Q ZOK3(K0S S 220S3 20S/L3(KKoK\0P1 \ S_K <@@PnP 0P R d2 0S82  @2H`] QA Q^ ^ 8 0@\@)0@0 0  (         $ ( , 04<8@@D  ! 1S0s`0a 0 \^(1  0S >K  兩P X@0P00  ,0 S,"2T 5P84& D, |1gfffd-("(@T|$}~05Ȝd&@\OМ -0L,MP؀0p0U$0 D @KD K `C@TO囼00啼?[\H0K @H  P<7֕ $0S $" 2P$, -LM4 0S@0S[@\& -L 000T -|@0Lp0呙T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,_fBΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 f f  f f0+11b0eb+e +e+e 0S00 TX, T&X5238:  L&8&1h1TL,h-," -LM`@00CS00  ä0 Ha, 0$0000fd-32TT -DL$M0D ,0 H 00 @ eP4@ 3#3Q040 3@T 30S 30S@@S0SP 39[t30S \3d.[T3 0S44P(PP7fc0@H ,0 wP@ ,YL00000 4D cP`B000QM,;82`D H0PZ.4"0@0,eP 20S @"eP10S {Q0S 0@T4D $PK Q0S1Pb0S0@T 4TD  P T0S. +0A0S1PC0S 00<K0  <0 KᾯP900S0  T00S" 0,0S@0  DL& 1 d-8T&p|122XX,3'3 0-h0LM0 0PK!K0  t@T0(0 T03 |1 -/L`PPU1 1U`U/0p0W 0Z@+9df.0PW0PdZ 9X0l0006Pp 0X0U.S100E 00EPEW TCX8d-0 -LBMAq0 S P 10S1  RAnK `F`F0X!Pg0 0wRP0b, Y兒10U B>K 0C0$  0 K(4 0BK @@ ǮPʰB00S0  ]U 0K0 +PP@00S 0S8 z8:3|13' -BML M7|'|70 t't7t L , Bd'P  0 SD70@7+ 87PP07@P(7(wP$7$gP 7 @7@@PP7 7@6@P@ 0S bcPP [cP TcPP NcPPP6DcP@6  hd&P 0SL60V0S 060@T$@ӧPP@ 0S cP cP cPPEᅑ5P\5  5X zP UP y40NBS񟗩````````````d````````````````P```````````dd`$`0`8```<`H  T4_#00#0\84Q440 0 0 Q33 I|3CKL1 MH3\  +6 <3033 xbP#h3% '2 2\3 2LCKL1 MH03\  3  l2 0"LqpI2202 2l0 2L L UP ,Zk}P BNK@D@D+bX2@& H04SBL4aP 10L P4嘔P@  L@1 0@$ D4 < 8 4D 0CKhAA A0QS R  1l1 Ẉ0S 1 ,dP@@T Ĕ @< 10 T,$    L( t&1D, X ܉ \@H,tepT\d$`,d-|x&4&("Ԕdh<  X,1d&D+T&  -L D+ p-LMP0` 0S @0S )00@P 00000S T@0S  00$0 $ 00K`pT&8:P1  p-PLM 200CS00  ä0 10S AV夏AQ FP  P^ @0 SP00U1P`1tV0X!0CS00Ӥ0 PB p?0a0S Q00Np@ P 0S 00S0xV0  00S 0S d00 CR 0R00! \0R T㡓L ph靓d-`,\$(p&1xT&@&0&tPp@-& @`QP 0R0S  0R 0S 0`S`PQ^ppp p-d d0LM\` X0X PPP0@T000p\,&1P|&p&<:p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p,&P<:h& -PLMp(c1@ 1QQ! aUU0p2V*Q 0S 0S ^0`2V:;ioP@U@p`0` l P \<&U0< UPEUX,d-HH{P -,0ML  0U@ -LM @ T 0 釖P 0-0 L0C@R P嗠P 0 Q000 P0-L@ 0S Q 0PU*00PU:0h0 -L MS( 0$ S 33 P$K(K"վ$ 0BS (0 2T2 B0S22R(00S(0 2P 0SpήmP 0S (0PP@20S 202 ]T@ @^2 @^2 @^1 @^1 ^1P0S1@1P(0 z1d0S0`0PV  ]^P@pl V^P@ 0T.S@DpP0@4! TTp,, BP 10S11  V  `0 S R00 V   BP0S `T&d-HXt|1 1H,  ,eP&T4P,F1l&1   ("8<686 X,14@ -L`M"0pVQ@,0 #20S *^K"_oKң,ΣP@1CPpB@@0T"aX`@B @BT'P@+P@T    0nS1jS|PKP!GC0S 00|0[S@T P@V+`P@ Whp`@T 0W0Z00S ,P &X00S&0P  _]0 0=` 0@P0 Pc]P@P 0T0 ,0St,x&!< d-$ $,8XLX,\1p& T&\  -`LMpPD0@T0R0 R 00@dP BP )@T0P S00@@0 800P00\d-$p&1 -AML43M0ß@0T,0 p0 3 0S3@ SP @0S 0S 00@T@0SpP@ 0SBҢ00SP/S  0 S R?uR@GiBnK`F`F+\00S/S/00P+e\_PPE1X0Q  \ 00 1P0S 0|0lSd1d!0?2cS XH100$R 1PBNK0@D@DC00+0SX000Q x`P AP@@3000 ,0Sl,T$ 0HCPC(8 $"X,*<|1Q86T\d-0  -MLMpp0 S( P`L Tq0SHHA0 @Q~BK@@$!mAP9 1$K R01000ӑa0CS'0t0dQ 0 \0TQZQ(0 S4(j @&d-$l( 0-0L0M0@PKS@,  c0 0S\@0Sx 00FP, l 0$  -LMp0 SԀ0@0mP`P 1[P (KG(0`P R rp000000S`P T 0S8@,P (" 086 d- -LTMa0qS!0PP'PA[ 0r10000S@ Pr1000PU@p V?P \1\P000 00200`KdKhK\0KX K T@KlK &, ᱠl0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 P"pP X0S 0h [P00P X 0SH@8WP bu0(" |1886 @d-D -MLMBNK0@D+p$0 pZ᪌`ZP ^KPE`P@t0 K0/S ᄠ@ >P0S/S$0 S$X 0-LMH@0Ps0 K`p 0SPP0wt@ -LMF@P00s;@t& -LMH H0q,0 Fc6&6KY60S |&Qp6\Ɵ  d@ ( A@ _P$ Q@T@dTd@K0 %]50PCUڔ5 ra@ ş@ş`g0%]p `P`Pp%5VF%T5UWPT  Ÿ@ ῟5@` \ B0%@P~]0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 yP@@y/ 0 ~%KHP;%.K|3/C0ur b@ _@`0#$] V@ S@`t#]%K|T3OK0ua2g 2crB?0@; #? 2cc#aw0S0S%NK/ uPڄŸ0 S 0S* @ @" <2S @ @d"`\N !P@1P@;%K 0 %K T~n|1Po0uv @ @`0!\ מ@ Ԟ@`x!\d1OK0uf2g2crEŞ0@8!?` 2cc,! G\OKᲞQ 0H~㋋HP 00CS00  ä0  (,0 S,7.AD4\<t&D&\&1QtePų(d-8 -x3LMp 0@@,0 KH3H0b0P a  B=9 = 0 xP@x/ ~0 }K{ KP@/ uP @K ~]QP0吠KS0SLŸ HŸH2@K00 OY~/ ~/ }"ŸP@Y00 d!p[\P 0SL0SI@K]/ tPBڜ R>1 P@@PR50S1:PP@ K \~0 @KV~ (}B{ 1@o0ef2f2c BD൝P Ო0Ϡ#PE0l 2lADd`0 @n[@K᠝0 S00<@,0 Sh,=.A>P? D\&teD <&dD&\ųd- -LM0`V *0i0`YV@: H1 PUP@֙`VA0S,0 :p0AT0L 0S :000CS00  ä0#  0 P@| 0 @0 C\0\00w T,0p0S,0 `V1d- -L MD00 K4@p( P0 1[SP00@d-ht@1 -0L M@K 0 K  3 -T4LK0C( P$0 05R+ +P&00S" 0V0 05R00Sd0 05R X H00QD`   $0S($$$@I<DIPID+L+T+ -4L M@P  ? ?'P#p4 l4 h4 T4 X4L4 ?<$Dpc@$40@cTQ2TIdP bA#P 9sP  RP0S00#ᵋp Y3  |C)PtXD ᰘ`3 0000C<0PPP8  @  aH 30SbHT @g;0"0Z ڨNHTL2%2더0ST. X:HT ׈H2p@4M 8倵PP({$yPP@ 0Kp; ,0!0",1" 峈pPa@) 91P  !0QF   vl1pd  |\ppT P岗pH  =p0 {p  @p ߷L0G@0 00D@Ԕ,I d+@Il+DIx+4TI+++++0I(ILI+ ++,, ,LP, HIh,*H,,L+$,,,TC,,,M -0L yGl @, p-LMP 0S 000` ph `@,0OP0080 04 ,0 $00800<`phDI((ITI -t@LM0 \D0,000 0000 04 $0 0080hHDI((ITI -Lq0P@T Ut` ,`\ 0SP0 UV@ 0U0A 00h1S`P 0 = 000 00}=00  00'<0 0 00h|00 00 04 L0 D0080 D0,0h"DI"(-4-(I(TI Mp-L$MDb (0SD(DI(ITI'K0C0C@^d F l6 zό< NK0 ,6 p@ 00K?0S d 066KSK?6 0@00 0A00 0B00C ,0D0000L0P0T0X \!pDITI0@I p-LMP$PZ(PW@`40S8Q`V@ZphK p-LMP0S `x10 @T @T0Px0 0ph=H1DI -QLM`PDB0S00`00@r0S  ?00?1  ? 0 ?( R?$ R?, R ?`@4 Q 0 8h!0!\x?`V@3  0 @ v> 0^?   0 v>  0I?  0 v>  0\4?P:?hxD:H11 1@I,1@1X1l11 #1111 2 p- LM0Qq`P$0  $ 0 0 }$0000 n K@ $K $ Rzh(K0 (0 r( n 0pHI -Pd 0`&@L6Spl06S s40 6h 060S 0P&00D0D  V $,$ hDI$2L2te@I +(+ -MLM P, p < 0BS8@<K⛍<0@pK@0 @G 00T`K0T0 S" Da 1 S@KHK0hPK0h0 S XF ( R h{$ R XvT` Pg D@ QN 40S0@L 18SG\9h9998@4@1 0@冡940!1ZsNK@D0 @D&1804 04 1`1Z\H1X!_sNK@D @D8  1 40!0 04 R8@Z ZK'P  0f 7`0V P7 {NK@D @D0h L  T,0 S@,p2|22U2 #TI222lU22 -LM( 0R@40 ,0 00  , $P 0 X 4 , K 04 (pK0!=0 ( $0  `40`V0 ZT90  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0PI4HI -LM90 @ 0$0 @ tp$`KP 0 0 $0 $4QD 0( S@ (K(PIHI33 -LM80p 00@00f$@ p 偳PP(p  (KP00P@@TP D (@ $K ဘ$([TIPI$DI83D3P3 -L M?q`0P60S 0 6 z+P@0610=S 0`61SQ0&P 0AV2p_P@00(F0F0F0v0 61 p 0V@ 0@@@ᔇ061S @0@$S `Sڌ0Td : ӌ@ Ќ0@̌0@6@ 0 JDIh3333 p-LMd`0P60S 0@6獇0&010P61S 0 06pDI-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@pT 0s 00p,IP3 -LM⁁@P4 8 0^ 4 8`@UPGFPGFFFFFFFFFGPGPGGFPGPGPGPGPGPGPGPGPGPGPGFPGPGPGPGPGPGPGPGPGPGPGGFFPGFFPGPGFPGPGPGPGPGFPGPGPGPGPGPGPGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGPGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGXGPG^@Th00pW 0< 084p 0 003 4D4  -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @ d4 0-LM@P@ .R r0\00000S0S0 S0 S K'PP 0  -PLMp Qi@[0T3* Rr000000S 0RQ 0 YHጊ``P0'S"S $S `S \S`F\000`F0@0T:V00SH:4 @4 p-L M`Pmp P 1巉p 0@`ޙܙ PK0  ` 1Kp@-0DST 0 p4TC,@I44 p-LMa 1 1<  1  1P1K/ 1@P 1@ 1!1 0 ,00 ` 0 00,000 0< 0 0< @  0 ,00P  0 00,000 ̃0< +P@ PK_ 0s ?' SnD0PpTI (5$TtI -LMp@J d*P@ K r 40R ,ZnT 5 0-LMP@K  @@%P񟗮ODQDQDQDQDQDQDQDQQDQDQ OPP`P|PPPQDQDQDQDQDQ8OODQ(QPPPXOOO8QDQHPT2c0P@ (6( ?U00@@,P00Z00SP;P   |886 -LM0p$0 8@K 0S" `V 0@0lP00<K0`v,P ;P @o l $0S $$8TI0688 p-LMK(P PU0 0`@T(>P" 0S0 % 000@ K0D0S P@T\W  r>0D@PU,0D0S G )p9@I90 P 0-LMT@T@ D1 0R00$!00@0c!S0"c1AP0S (0s 0 (00$K0 0$ 1K2K$@/t H0#S D0S |1[ \00S (0s1[ 0S 800S (0 XI(IL @I89$X9P -LPMq0D`K0K 0 pP@#3  L00L00S H0S L0S0 (呓0(@0P,K TK X0 儂P0K[X0K   ` 0S @Id99P9 -L(Mp0P 0 ߩp@s @`K ~ = opP #[A0AS 0l 3KopP@<8 0 S @9i i 9 -L(Mp0` 0 囩p@@PK. : E=t uo0s 3[X  Kho0s  0S 9i i 9 -LLM<oP,3[A0AS(0HQ&l@K(  < $oP 0S 0SpF 0H0 T  P00 S$0 S $@Ii 96i(: p-!LM@`TP 0S0P0 @TT P0@00 v}P@} Pt` R 0S @p@p0S  0S0S0@0pXIL<:T Q0S 0R00Q$ 00 QXIL -L0Mp0` 0 坨pP1 H@K( < G< wnp j0S f0Sl 0  ,00 S0 0 S 96i(:`: -L8Mp0P 0 T`K0 2@ mrP@P-0`S PPP0D ,nP 4 0 S  x::@IlB :: 0-LMdP0  ( ,  p@8  0K~p 00@0@I:: p-LMQ0@ 0 (0( KmP1[S1[Sh0 @K(X mP8QH~0@( mP0v0(($ KmPn $080@8]|4 40S8a 0@<@0 @@0D0D0,`K, ( ( mPL0< 0, Q0( <00( mPt:0l( mP\2p@IqB@;,;pB`;yB;fB@;;TgB <(?wB4<vB \< -LQM0Pps`KKWK, KK\q  @@0@Ɯ WKD\1@< 81 4 0ƞs`OK VK0 0 ,?t 0 T1 0XQ P L1 0VK Yp@0  0 ,0S,DI@Il<|< -LMp`A< @0R 8 (4P`i 0<0 00@0 Q@<0lS<W44K  "[<0,@0 R!(0P0<0 <43P<0 0<0,0 `, <408P<0, 000<0%<00<0,0` P,  <0000<0h@-@n0< 4@, @, <0000<0,V @IDI -L M0\S, `Q*\ 0H , Ypӕp0, 00 0S 1 \ZQ0S40 qP@0  ~4  pyqP@p0|  ~ ~0 00 !{@0 0, \S: #<<<$= -L M, pY0  û~`, 匁00S" P0 0a00 SU0`  U@@`@, `0  4 ~PU`4\ V00Ƿ0` 0H= -L4Mlǟp, XP T Xp @gY@8Z,\    \ !00 S T0S 0 X 0LKX 0 0A0C3Sgvvvvvvvvvvvvvvvvvvvvvvv$vvvvvvvvvvvvvvvvvvvvvvvvvvvvvX 0 BT0 X 02 QP0 0R r50000S  Q QT  x0: p 0\ T 0T0 t0 0 K0K p pp0  &!0 0Sx W4  0T|00 W00S4 g TP {T TQڗ Q@4 aLT R ZT Xp WL K0B0C6Sz{{{{{{y{{,z{{{{{{xz{{{{{{{{{{{{{{z{{{z{{{{{ z{{{{{{`zx{{{zPP"00 0PET3* Rr200000SP 0RQ 0"r<~P``0'S"S $S `S \SPE\000PE0P@ 0T:Q"00PE00P 8 #" { G8P` z0!4<pPRP`@/08C808#8d!<pPP`@:0@lU4@> M-M LM‒@K  , |d2`@@QLD2 R\}P~~KpGpG+}K }PM.+P` 6S 6S 0  `V 60 l@ `6lSP 0SXQX SLQL SDQDV 0S Q,,1 (1@TU @K0P <K@ P{@TUU 00@K@>K0C 0C1 BS 1S8x@T ,0SH,DIT>@IH=tep<0-!<-TI0<<P0-H0@0 80840400,0 hI:tI:V:`I:lIdI -0 0CS00LӤ0b ^00# P 0 000t0 00p PPQ8 00C 0000 ;V:lI:`I:: p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00p:: pI\IT:; 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000;pI;;`IdI\I; -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000;\IpI;;lIdI; -LM@p P p-LM@`Ppp UP\PP "P H0D0@T80T0s@D0   0p|>;>; -pL`P@xP000PP px0000D0SX0 L0@T<0T49@D0  0;  ;>; -pLPBo@P -P_P p0 00000S0 pt0 000D\0Q`T0@TH0T@@D0  , 0h ;  ; >; -LM$@" 0ZhPl" --LM @0| &xp !0S \5{T SH O<!0S ,,*$cD@ ?? --Ll i0T T&LD !D080S {$  D@  --Ll C0T Tx&LD ]!D080S z$  D@  --Ll 0T TR&LD 7!D080S z$ Ӡ ϠD@  -L`@P pR %R0mSD*0L Z8p` PD"@`PT@D ń R00 --L@ 0C<0 2/P@\H+P@`@@TF0@@0 /P@5 P@.T40D0 P@#T)0H0 :P@P@T0L0 :P@pP@ T;TT`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @PPlPQ,QXQxQQQQR`5 0-LP%fP@4 o0S0o P0$R p-RLMP@` 0S(0 ws000p4R p-LM`@ 0 cPPhx u 0 0bU *Ho0#S 0S uc opho@R`R|R -Lp`P P@TPtTF;t 0S 0#S h9RRR -MLM$0KA ,0 `hQR Q Q d8 SKAA ld8 S:qX lPP vePP0 l(KA Al K+B 0d(0Rp8:spP@ TeP@ p(~oo>K0C0C`#8 sd8! SD5;<#fKA A`t(d8!M@S:rtP eP t( GKA Bxd(0@R:q|xP dPT x( )KA A#|(d8@S:rv|Pp dPpk |( PゎKd8H@ HS( ];KA A01(81(Rd8@ST:rGd0P1(> (PUڈ< 8 e `n ^n\nP(1S>K0CTnPU!d8PS 0 ( hX d8 XP@t KA hKA A bx40 ,0S ,R ;4$RRS 1 P-L`( 1ȁ 0@Qd 01 00PVq` Qxh!0 MPTP *@ 0O  Q0 Q@L00CnP 0@0CS0@0 0h* 00CS0p@0 0R*< 0R|IIII(S ,F@S -LMPWmPpB 0@ S 0 S`ev 0S耟萟0 XPP *h lm`0#0O\ lP<00)() C XSIIIhS@SF 0-DP@L,000 @@0 0 0 0LKd0 S- L 0S S 0SP S  |IS p-xQxALM00P06T1 P!QP3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  [\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  J KDKhWV -`0` LRTLL0<SS,0 0Qڄ0JJ KSK -LMܠPp@* W* 0 0S@@T0TbW`CPP l0 R   0P 0#T 0EE@LKWJ -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00TWP 0@0CS0@0 $0y00CS0@0 0`00P @@0@fJ U\X ,FWJ -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 Z5 P %Q00!Q`uTş0 R`l00VP 0 0CS`0e0 |80"00CS0D0e!0 0 Pdt Q`l000oVP 0$0C`$S0d0 =|00S? h@[3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000-VP 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000UP 0@"0Cp8"S08r0 0l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000UP 0!0C@!S0A0 x4000CS0u`匐0 QP\00}UP 0T0CSP0PP0z Lw0$WJd`LJK ,F88WT -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0003@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00LJJJ J,$ -43L M0 00,  R W,T P@` <PpX آ 0S2X0@` T QڐR2 Q@L000TP] 0P"0C@H"S0 P4 000 S/ S- @PP pP `0S PP@` @@ {P|0p p0"Z%P@ T,@P0$ J@'FWT -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| S `1 @ RD1 0o(0 Q`l003PP 0`0CS0`0 0X 00CS0@000 SH@P@(JJ ,FX X ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 ]p00 PP 0P0 P JVL -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000DOP 0,"0C@$"S0B0 0g 00CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000NP 0 B0R@ q@0k ho0 lY00CS0@8h0SL(@00Pi0FJLLL ,FJ$JV -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`U@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0J KLW L, -LM " P2 P@" " q ğ0S   ?KRPW"R 20R2 84bPU$0S4 /Q"0S \ 2 1    ?K#P 3 `d 0Q,V,K 0S 2Pß0SH# P030 P\ 0 0%rŸ0 QP\00MP 0"0CP"S0R0 W0 P00CS00B0 B0 0o࡟0 Up|00KMP 0!0Cp!S0Uq0O L0n X00CS0$b"P U" 0S  gP0 K9P0x 0uꬠ0 Up|000LP 0d 0Cp\ S0Xp0 0" 0MJLL Y6 1 R,0  !0S [[P QK_P  0R|1 !ᯰP H89 P}[{[  !'80[@Jp qa[][0\0Kl0S4  Tl,X !LNFP8G[LLLLYt$LLL܊ -LMMpA^K PE0PE` @ 0 Gp 0T0 @PxphPP\0P 0 S @ @(ᬠYtYLYY -QLM@l 0S\TH~0S@4 40 0Rh.ꁠ0tYYL -QLM@p 0S`X H-=0S@4 40 0RhY0tYYL p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0kIP@BV;  ᩁP ՛0S $@0<0V$ ጯP @㿛0V0 LၜP 0-S |l@pL0S LDI4p Y$@LMbtZ ZZ$Z -L 8FKP郛0 R  џt0Z 0-,@,PL $ @H0090巔`0wS  0  P  0 @X@H@L@P@T@i -PLM@Pp`(0S 00wS` rS`U |0 0 0l000d0000  bVS`SD>T@H@P@L@ -LM 0K# tiP p-LMD0@S PH`U ;P)"P0 D0` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0ZH@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ rB0000 T  <Kq5 0 pS  L@ i -LMD0PSp NRL @T D@H@)*P0D0@ P`.  gsp0P $ 00P  00$ 000 P@D`  L`VD0S0S$@  g<0 cP@L@ȠR0@-,ȠP @ 0"\LL ^NNQ0RPBu 0PEu |2\x2LL7&c2c0T2RCV]EH0PE0 0  0  0  0   0   0   0  P @l1'7c2Tb"U cbUI U30 0  0  0  0   0   0  0  PE U @PEu 0PEu 00'7cb2" cb0q[ -`PL p@(.0(Ã$H7c"( 2'H@`c\@^B^BN00QA>AAQAAq 0S 000  b0 QŒ00 , P080!Q,000SZL -0L0SL p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#pLQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`pht0%0 0X00L0 0T00P0[c -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b=(0,0000004PcUP!f =`V 4f =(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K Z<+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K ;+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  ;/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K ?;+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  ";/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#84p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PKw8x0 00o8P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K 7U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K b7 G0B @T0D```Vx010 abXddi 0`d@3 -Lv3 -L4M@P\ &v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&vmpH0@ 0S񟗇<HT`lt```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS00,K 0\@0S0 t,0 R0 X@ 4@ PL nPP `oP@ 30C S $$T$t$$$H RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L6P D`0S @0SD ]P Z 0S0SPQ TX 48P ZTX {F@0<> Up l`[0S <`[0SP 0!R0C0Ss F4K8 K0K)7P0 #80@ 080 Y`V+ `000CS&,K@ 7P@0S ,0 R D@ @ = P @@ F "00>P< @@ +0S :@P` _X 2T .P@ 'pT IX 0S0S0L04]@@Pte@Q Q$QQ@jPjdjxj -LM0@Sp SdP`^0   K R W0@j -L M0@S $G^ 0 K R 0^@j -t0LPd0 R X0XP PP00L@0( 4P000( QQ@jQjy k p-LM` `P0@0@\  0S 0S 0S pY -LM"40Qp,0 x(P^`0@0 P`O 4d[$K4@04  PN$\P4 K` 4KR>K0C0C @@_`0 K~KpGdPpGPU0\%S>R0(5 5^ x$=L0OT H$0\%R !040US  Z$08 3 #00\0P1Q>KR>K0C0CE.KpW B04% 0 45Po0C45 |0\%t3Rh 4!0. H3 \5<#SM>K0C !? 4%1 @ 0 0t/1E $pWZ`P2 ,0S ,40 S00X' @BNK @D@D0P9'HD"P0\%2R  0S@2 WM>K0C !RBNK @D@D0 '"PWdd1 \5S0000 /PL1 kC \5S0S%P00QYYY,Q,YYTYYYY] -LM@P00.%0Q -LM 1\0P00 L` @_0 s P``V1$,$P@] 1&t1 X00@00 000\% 1R   V01 0#^ `*p쀟P$p \5S(0 ? ^ : VP` \5SX0 ? ^ ZlPlp0Q`` 0 A00@`d%P s,YTpqYWYYWq -P0LM@'&<0 P 0S PRYW$^ p-LM``0S TPT 01@CT*r$p$000pj$0T*WWY 0  tY -LMp@PT* @0SP 0S z @0`P``90 |0\Qt p,'`0 i0: S88 8 (9X<^D^Y,YTWWY2Z` -L, 0 R0  0 '0 0-,@P0LS 0PP0 P 0(Y 0-LM@}T1 T0UP@|}0 \Qp!GP# p}m}0 R0 \Q00`}0p \KQ0(00 婧 \S}eLN}0$ \8QpP^(Y,YX^Td^Xp^|^ M`^ -LM@ 0l@ N\ 00CS  00 00 /qY^ -4$L MP0  T0 R ğp0P*S 0S pW:0W `$0 0_A 0/p@t#T 3S \#@0$<3T\000@O000$ 0 0 X0C 0  XR  000"@ @z0"\`Q \ p00x"\Q(0p  0S 0000<"00\Qv &0"\Ql &0!\,KQ00d0X0F0!\Q,00 ,0 O0!\Q000D00!\Q,00 ,0( O0\!\Q000@000q-P 4 `_ PZH4 R 0$\lQ11Xu 4 R 0\% R1p((0#\QE  3\(Q8 0S:0S : (5SL3\%Rh0  0S0$#\Q  0@> S` @CT`0t0@DT ` 0@#? 0S:0 2 R @ R0SR0;S00"\Qh0 0S "\0!0Qp"0Pd ( cpp00 8P`1 R 0!\Q00 00 d1\Q 000  PPu #0(!\Q  (O0!\Q0h0 0 %N00 R 0 \4Q000'u`()P  h0\%R4040 O 00 0S0 #  ,YTTYr4Xb<^WWX(WXWYXaaXYYX4Q R,A2   (0 PH0 `X(0,0 e! 0 @Q6 P3 P' `| R0pl0  0R 0S R0R0S 10S0S jP+  0 R bq dP0,0 0  0@YTn Xl<<M YX`fKMK 3-P( (\0S#  R0.S (0&(00\ &"F 00CS񟗍<  $ $   (0SX ,0 S ,, 00  & 5 R E0 S % 00P%00C0 r0S$ (\NK @D@D0@$S^K PE0$0%5 R mP (\00(0S0 R$ 4 R4 R$ OhP M0:  S00044 0 0^(\OR$ 0.SH(00^P[S0 41 R33 (K(K  (K0AO0KK,}0S<3(K (K ( K(K0(00\P000 Q0hNK0ᴀ(00(02  0`0C0 @@@\+0SP (00(0P l"00C0x">KMK P8"4300@2P \ *P !0l!00S 0S 0D0P>KMK Pe(00(0 1  0`0C0 崀t$v@P_ l0S V0x0P\0 R\ 0SY F<00M0 X(YXXTdXc`dYxddpddYddXDtdWdeec$ePeeeeef0f@- 0$ $00S@T T S -LM$$ @0 @dPYXQPt -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPʚ`@Pl000`0  00C00 0@0  YW(\ XQYYYY -LM$$ @0 @PY\Qlt -!L8M܁ܡ0X  (0 ( K\0 T0 P0 L0 H0 D0 @0 <0 80 40 00 ,0 , `Sq 0!PUT 0P!@U `,0V00 T@ 00CS7(  X 0QP 0S P0  00\K =\KY0l \Q  0  0S\KD @0 0K ,Y(8 WYYVtZTPf\f0f -LMp`W, 1 &P, " 冞ᥡ0 0P @T 0S @T 0 (  0@@0PpG`W,0S0@00)TYXX -LM$$ @0 @PdQ`Qt -MLIM0 K0!,0 K $ ϟK0(IKI41 p?d_ R?K0X^K0$ET/1(K^00!1\$ł0V`0U30/>1 10S|8K01$E(K0!Lq Q`8L.0\Q0 T (K0!K010X00P%0\0(K0!\0K0/>( `000/> (K,dK0$5S A h $5! l `0S10>!d d0 `8K=K !0K(A0A(K@1 9 =K(@0@ SK@ X8 ZK(AD0A(KD1@  K0848 00C bPX 0 2X0X,8K01,D0-BKK4H(KL!00(K!K 0,00CR8K01;1 K<K f0$5S8bp000$08K41K( 0,R0 Q 0( Q,0,00K0:\%R KK04 x00Rx x0(K0!Q0t0Q0 ɟ0 RP04080<0@0D0H0L0\08K !LK0pL5(Ks K00! ! PX)0 00CSp T H H H T 000  0(0CQ 0\0 0 020K 1PX(K!R 0R\0 0020 X B K8\*K08PUԧ0O!> 00R# PU^ ^ $0'0Q$0.`0!008K01K8 > b0Q0cP4 001K088K`81SK<\K0$5S,l p@h0PX`P  ^ 8K01$%^ࠡ101p@0SX^ K0$%^ࠡ101K(@,@$K0O(LK0PPL5Ks(K$1 P50K?NDePx4 ,0S ,(K@ P 8KD K0$0PP 0K8K 4!AP84 RK4W K(XK4&(K4!cP\000/ QP(K4!K\0400?000S @}@TK( X(K,!X"XcQ(K4!K`0400/ P`000?0P00S @9@TK, X"P\02QK4K\048K !PJ K@h8{PC K4\0T"SK4\00S\08K ! ,Q(KK4!40?\0000S4K0(K0y8K41Q(KK4!40?\0p000S4rK0(K0]8K41eK@p%P/ K8K4!  %(K@Pd0 0008K01$%R(K0!8S8l  000D,YXWt\tTXY`QdQ (qTWYlgtWttuPK$KT1 (KK,1̠A/08K(K0 !P5MDA0S`` P 0S |K0KP%0 00@K/0>$1/01^ K0`0T30/>11K0=8K01L 0@KPo002D P Q$5SlB0S xj0S PK0X K$10 $52 X^\0  0  (0 0$ --L ɉ p-PLM@P`l0l R LT D0 Rp80h m: 0  h㢉( M @g --L  --L  -LM@d h,X --L s p-LtM/Pj@TK ЇP0: S p0`rS  0-/L@jPU+D0 00/00(+w+s00hQg -LUMpPKP哇P@lK8ጇ0S(0: S  SU P U@P P@0 R000K@hP h1: SD hc$^e$TCh h0h P-L P "@h -QLM@ P T "$Ph -LoP "`h -_MLMx/t?@, @h? d__K AX? A`P P5: S ,$PQ DP0S > R 0 S> {g0Ss >.@@@0 > @@ @@ 0 0 0\S PP.P(04.4<00kPMn0S@T = ,0S ,d=-K B BP CPd5PTt%x $O2,% @004Pd5PU8͟84͟44-4=4 gd5U `e = R0  V0S  C>000, 0,0 t010C@_aK0Po0E" $`PaNK  0X Z0S0<cQ0K QQ " 000S c0S} Py  00H0cQ  000cH00S c0S_ P[  40L0cQ h  400cL00S 8 c0SA, P= 0P0 PR @0$g@P0S c0S# xP 0P4 TR @4 g@T0S p ic0Sd _P Y,5S05 FS.S 8 0a.KS>0S Kc0S AP 0)\(5Qx@<@S  0(E0S 1c0S 'P  iH080@_Q l n H0S.0O 0S  c0S P  hL0@0@_Qu P L0-0O0S b0S`P\ $9 X0S0,%R0S0L%r P%0 0p/>1/$E0ࠀ1TPo`0W30/>11=L 00@UOX @GP%0 0P/>1/$E01T`0U30/>11=`L 00S b0S$P  7\%R0000#DC0xQ 0x@0S nb0SxdP 6\%R0000A#A0tQ l0t@0S Rb0SHP E 0S 5 R @ & L L3S 0X%58 p= 0000`d 0hLCV`@0 `P FXT 00 X@0`P`/>0@@!~ pāO_P``5!?VAQ!or4PW PLDf4PW \p4PM TPL4@7 0,H,4P0 ,, T#T0 ?>T(0#3 .C00(0#S P  5 3  4t3d@+S@0T@PF uPfx$Rh q*$2 2  2  Q0 0 0V0S8 "0p00Lu 0P5?T5 V>X5P%0 0P/>1/$E01T`0U30/>11=`L 00 p0 p?P 0S" b0 00,%0aKS><0(5 H0S.0O \ L00O ,P WXWYphPbX$Yh,YWYYhYXXhhhiuLipiiiiXY(Yuv$vcHvlvvvTv w0wWTwTlwwwjY(jYLjXYwWwYYYWWW xjDx YpxxXxX,YWxxk kDklk ykXkkkteH0 0 0D5Sl0 0 0w<5S_s0P O@0 0 0045S+H0S0O L0-0O 1s1 P1 P(1(! P P<1< T1T hQ0 0 0xx<P  0<0 ]2P 00 O~$0!Sv0c 4a "P{rcjk_ <bc_ Xbdd -4L M , RtPp1 xdx@ dğ0`$ȟʠ 0 pP8ğ8  \5 SS P1s@, Sς S3S0S1s 3ß:0,\,՜ڴP,Ռ\%l3R X#h0 S,d0 0B RR,<40L\?>\, rd0OSh" #&l  ?"2Ÿ`V<, 0 B0_@r h0/n0S ("P! @2 R,0,F_1P@h00`T*0 QP@T:aA"b!1\%R  1  0COL1H $0C.O (0O 0-O 0?O 0/O0O 0+O  S0LRK,!T't0lȟ 0 ʠtP@8 <0\%40RR ,$X$nY,YWTTk4Y,y@yTypyyWXDllyWy -PLM@ 00 R$haXl M -L$Mp`P@u Pa0@S pt3@  0@T , q830  00S, ,2WC H R R2!" "  0P 00C   I 4 0C^Q0 0C#0 0 4`0080P40 00pp, (! @| ,000, 80D 0,  ? 0 @  00P8 H $@ 04 < P U 00S  0E000D0@ @`0@ T0,d 0S d H08/>/1@ 01R`0@\30/>11< 0SU0 0Ŭ ũ,P0(  <0Q`,P lydY m -0LM@H HP0T \妻 hUedA00c0Q3@T TX0X  0S  R1 018Ġ0pnnp@-8`PL\ ^ P^ ^ ^ ^ ^ ^ ^ 0 Rp!>0  ARp" @0O0 \p @0#O1A-8pL\  _ H_ _ x_ _ _ _ _  00!> ,A "`P?HA0?`P@0A-8pL\ _ ` _ L` _ _ _ _  00!> ,A "`P?HA0?`P@0-8Lp\ ` ` ` 4a ` ` ` ` 0 R!>0 R! "A"!?`P0HA01 ?0`P@0 -LDM@PP G@ <UP ( ! PP fY sY !1 1 !|9p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL  i  0P ,P 4` % !00yzz\ z{{0{g H{L{e e u (y -p-L M$`K 0P$0 P @ P00 0 P Pp -0-L0PS @ CQ0 1Ñ0T000S0 --L <D --L 08 --L M((K0(K 5z0 R  -LM@ah{ -LM   K 0KK  p@fT|{ -LM @ \K0   KpBT0 { -L -LM@@0S  hlte -LM@Qp$ pQH,{ -LMM B~KpGnK0pG`F+`F(0 ʼ+ƼrPÏ)PP"KAA NK@D,X , 4h 0X S]V|,`4 0X UV`L$BpDa008 NWP6KAA EWp@S0S' T 880S@TT 0S 0@T8800 |  SpleT(0 SH(+x4 |D|h|||K0C\J d 1 (K 1(PK 1(`K <9 @09 ;9 99 唠@9,9 0 (K   0(K0"@L@`xԔȀ08@PDl|Ht(P,$0` @[H_\ Ԃ[<[(48<X[$,[[[[ /QPl  0喸KAAnp 0剸ܐt00S d* C Pd K^  K@ PpKP  X\  P ``pWJXZ @֘0Sr0@0n0S hPX* T X:pWj?X: Z0S BP 9EP\   \:夠e P` WK   \KAA` p PIK  8:: S 0S  PPlZ  P`Phj`0P p2000P` <l\  r8300000S\ \2WC J0 @@00@0l: h 0 SlZ a |cBQ0 @@0@0Ƞ, 0@ `p0 S0S840S ,lP@ P0hP/Ht0S\ (0S0Ք$۔D0S 0PP 00C   @0S\(0 S;300S R1 0 # 0SD501 S90`%0Sh5010t50S ʀE0S 50s00%0S50S00#1ѣ10'-K Bx* xZePE \xZ    Po̠0 00 @@00  \_p[To',"0 @@00@"%!00 `* d:  R  @PĠ?O  Rں ?C4 00|G0S  x P \*d10Sd  ` gn 00-x Lt@PdP \RX 000CP@8/ 0N )0YedA_[0P p-d0LM0`S@P88 0S Mphp[gd -0-LPP@ 80   n@ -000 0LS    m[@ԃx p-LM`0@K0 \Ip0P h0 \0,0T Q oGIP 0Smp___l -LM  , TtP Md4P#K⇣0S" 848$0OSa &V I0 4 3p  00S33 ʌ#0S0s  z0S D#0 S2N0 @0S P@0 0`Le3DS 0$2 0$2 0B0A  |0Q  R: RÈ8R0t~00 04 000cH0 400cL0 H0S.0O  L0-0O@0. P@4* T 00TS180@8P004 Ϡ΃J `H@4 d@d yCN@@4|0xX`0Pe0` $1\50 SS?  00#1t0 003x00 S<0(5(5  00,50 00 84$00@ <0D0 0000X8_[[[8__@D,؅(,\[00`__4[8$[0,50PH?0 001t0 00#4x0 x0(5pPJ4 B ?8P0Eo0 5Р0P4 ?L8@@G00# 0 0800 00S.090CO000pǏtSΌ/1`G P$p`Y`Z11嬁 T0xR#R ` <4/S84S*8dq x00P`0xQ08@@0 0S`P@x@@0P`0xQ08@@0 0S`P@x@@0P%00@/> 1$0.1^0 `0T30/>110SQ:0 40 c | R P P r ?CKPY 娐8 0 `00P @xx@@s`0@PCU ?%" ?WᣎVP%00/>$Ŕ101\0 `0U30/>1 10SQ08 0b0P @5x@@0lE00 Qˀ50弐U@C B ?,``0xQ08@@ <4pǏS 84S*C>0( @N`C>⼠0 ?@0XW0 80 0c0Pp@x@@0Ħ0 Y Ć0S 0|  00 00 ,00P%00@/> 1$0.1^`0T30/>11=L 000@嬗`0xQ0 00 0 . .. catchmodchgrp cp dd df edexpr]hostnameT9 ksh sh ln lsmkdir mteject mv pax tarcpio] rmstty]sync]sleep ... . ..chowndhclientT9 disklabel9dmesgfdiskfsck] fsck_ext2fsfsck_ffsT9ifconfigT9init]mknodmount mount_cd9660- mount_ext2fs- mount_ffs9 mount_msdos mount_nfs9newfs newfs_msdosping]ping6reboothalt]routertsol$umount . .. tmp dbզ runEempty3 ... ... ...-O  ,@5L 2000P P@5LV>00h0 h0 S:h0`8 0<0l8 0\ x8 0 0R0E>0XT0P0P0HU0 00@0PP40@@ ,C> `0]0SO0SOP=` p`8_@%0VO 8C>0LP@+P@_  0`@_0 ,0+0C@0P@?>0 Y-0SO0 OC.0S 04 0 @4(0 H40 30 30 40 40z0S=PC>0 @4B/ d p` @ȃ0 P@T0H@p,lP4i"/ `P80 H 0S'P@'R *0\%2R2 \5~*0@Ÿs0*l("(2Q0\50S lE P)P 1  Y0 00! S0:1A0[1P& l1*0`,0V<d1`01吀KpW,d1K 00@_0 A0K d  P@0dPF@cTc@#t0  PSG0`0,0VP00S  l00S! 40Ph>@p+TTL|[D _[[_r|[$Ј[__(p0SP H@ 30 30 40 40EP  `圀@0*00YP=T0Ypd  0 0 i R 000 0Y0@a 008P40 H @@HAt 0, ;00R,h -P:L$M, 0 0<$哀`R84S*C>0 ,@ @K00@_0,A@0K d ɟ9P@3ɟ0/S0S*(t{\,@P0 00 #  h04 h40@ 9 Y 0,@280 3000 /8 00h @0 0娀t0 x0 0Sx0x 00S0\& ,0p`0CT+ ! 0ȟ0000wq0t0x0T T0 1X0 X0 0\0ǟ00\0/>`00`0/>dd 0R%h˸ 0,0^ 0,p4G4'0S\0ρ0 0! pW 00C 0,Pk4XgF`V8r6 R`0 >0   p&0SG0dZD6 RT000T000`6 R 0dC @XPd:P5P5p`PYd@P(0 0P p000 508040XU 08@P# 4` !400400800`ZD$0S`0ρ0 0 ! $0Z0$0l4 80 0S 4j`@80T04 R`0  00030SG0d3 RT000T000`3 R 0d @XPdP5P$3p`PZdt@P0 j0P f}p0002 80 0SژŸ 0X!0h14  4 0X0`" S!0`0@Ÿ0 0! $00$00X8@0a0 00 S 0x 00 Rpp@WP 0\%1Rl@P\pW,Q,` 00O1d `p 0F00S080Ճp&.ࠟP0U@l0Px0@U`,P0 0 O2d 0O[00 0080p `0x@`TW_[[[__U $[T -LAMK@Pp,`1Y0A SA A Pp ` 00!  ,K01B00S{FOK004P0  x0F?K-0L@P/ d@004 0[A$_[ -LAMK,@_0K0Q 0`004 00 080^,0@ d 0 000K__U <T|_$ -T"LM0, S2,0l.,PPbR@ d  0 1Q) 00C 0 q0S\0000  10@ d  0  0@`1 00C0帠,0Y ! #4%+  (P0@o%,p"P`@0 `  x`0P@`pd p0 0`P$l0@ d0R0x , x ,,0 00 o5$__U <_[ -LpM\pP Ph0o5G,$mPD0o5G,, @ P0 "[[[_̉ -LMp\ 0P0o5G,$m\00SD0PH0o5G,, @ P0 $[[[ 08`.G<  .G`[~ [~.G`@@<@TU .G``b.GA.GmP .Gv.GvnA.G'!.G'!.G'! !hA.G ".G{.G{b PA.G1O#.G$.G$ SC.G#.G#.G# j/fA.G#.G#.G# (rA.G#.G#.G#4K .G{.GGJ.G^h #P?I|xoąR"2*!C% f곏%tׯd),)\Ѓ6k َ!$7iV1hw28#3nC;>lDFp\*߈r%LS &l̓>]% J=ge!;<7\'#O~.H=_/Z% CE( `?vv84 *X&TGbX: !/t'1Wu·݀iՊ^7RdI@<kxF8SJpR^s 3 7e4ycgq 1z&'lX-T`MK/뫢|k|/8.c68N:afʻrBi^ "}@N@Ѿ|&FKLgb4{>nu8V!!u䶜ۖPzD'$z-CA3 6=JS!os)m[_ -8L0@S" | d P 0S0 R00 #L10S0 #1N  -8L0@S!d H $  00 R0  00B0  20 10$ -8L0@S!$  @ @ @ @ 00 R0  00B0  20 10< -L M@H Kb0s4 A[TP @TP@ht@ - L0R P$T -LMP@p1儑儡`px!9!pP@4 "P- $ , $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $  $ $ $ $ $ $ $ $ , 0`0``p0 PbUA20Sh0aa>X0W 0 Rete___t___ -(bp0LS2 R2 pRpW "PPr ԡr#P@b #0B SO ( C 0pu0S@ bP o$ 0S P '  0S R R 0 R-AP 0S@U<0Sw0S@ #P #W;<0Sm" _____ -LpMP@T `KOP 0 R <0S d@0S@: S p0S : S 0 R@P 0S P (0 Rg____| -LM쁟0Q@(0 Pp`i 0: S (0 S (o` 0S ? p` K!p 1 S!3 NPpE 8@ IP P ?10  p0 X ,P {P0 G P iPG MKP  _؊ -LM@`P  Vp@0V U@0 @WPPU`VUU -1L$M℁PUp$ `Sd1 R 0: S P$0 S $$_4K@ +[ Q003 Kpw@`D`00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU ,J__te$ p-LMP`P @n@P0/S+ /@P0.S P0S@p0S .S0S`V d 00 Q P0S0P,   @@P0/S _ -0L ^@4 -L0M0`@/O@d#P000L1P<H0K ㆽ0 AT0 P0 ST  TP@@:p_0p0Pphd0DSatPphPhp(=0 TL_Ԕpmm @:ċ9ȋ 0-0@LP R% AR@ < & x"t00CS00  ä0 H< <0h< $$A0h<|0D -RLM@p 0S   <Tc W@` 0S] |Q<0 CR P00 R%  B02? X 0, CR 100  \ `0 CR 00  \ R@0> CR 000Ri&0 Rd \0R R R0R 阌| -40L R(0$0$   &]_d| -LŒ<0 R4  l 0 $_ _t| - L 뤌 -LS뤌 -LMhq0S \\NPPL @!PD 4a@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0EP 0;C 0 0d@d @9ˠ$0K $ @18\ ܦČ__ -0LS \|0H0  00S_\-\0S f   p-LCM``GOK0PL  嘤80 Y 0S m\p -LM$@0 S A00 $ 0-D0L R 4410P@@T00<(c 0-LBMdP0FOK\0 P 0I4 0S \0,4< p-LM`@e,0  P]Uph_ p-BMLM`0<@KP0 B<0[ES FS AS A R0r S00x ;Kڂ0 S X[pCNK@D@D 0 <0[FS 0  H| -$0LM K YP [_ p-QLMP`@00H @| ph0PE S U@00p鈍 -LM`P对Mဋᨋh!pXq mP pP P@(@ 9!0AT3 T`7 y@P0/S Z  1P0S@!`MP X: p`:  @@P0/S O@  cZtečԔ -LtMp@ᘐK87@R6 00 RPPEY0S``0 0: S U PU/00V 0: S 6600:TC -0L 嶔Z@ȍ -\@LM80(0( 0vvvvv -LMp P( :   Qq00  R(  R00#R@@T;Rp 0P00 p  (0x嗞P`@@(X0S 0DH00S (S 0S(0 0V0 S񟗫 h t H t \ 4  (0\(   Qq00  R( 0000((0\( ,  Qq00  R( 0;Sp( \ pSg  Eb(0\(   Qq00  R( 0\S  d*(\( 8  Qq00  R( 0S  /  (0\(   Qq00  R( (0pS0Z00 0PX(0\(   Qq00  R( 0S 0(0;Sx  ( K_ (0\(   Qq00  R( | ( KF 0S P(0\(   Qq00  R(  $s(0\(   Qq00  R( 0S  3 @T00pp#(p}v4)( 0HWt8S(( ( 0\SS, (tP(  L( ( (P( t  Qq00  R( 0;S @l(\(0 ( P(   Qq00  R( 0;S S ( `_QZT(@(KP( `  Qq00  R( 0,S00\(   Qq00  R( w(P( `\  Qq00  R( Z ld @Ph$v 0DdԐ 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ !0< Xd@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 v U qP T0S5 0S 0 jW v -L M@X, 02 ,0 p1 100 ,0 0=P0S4P  \S  RE ZQ@D0S4 0bp00 g R APU0 00 !/P \00, 0 S0`B 0V, 0S`3\Q&Q\00 S SP$ 4  0bp@, 0vl -LMr ` 0 ( P0 (P`Ÿ  Qq00  R( 0gS{ 09S,1SUK A A pP@P@(S S (0(8 0 S x V;SpSD wSP( 4  Qq00  R( 0NK @D@DS  S ( 0(0S0R0 ܅0PU ( p 1H 0tvdr00U0P0e( 4\v Ē -MLM` P( 0\SSL ~KpGpGPP ? jK$`FP@ `FPP3 0Qq0  00SPC@@T 000S0S   0S(0 S H(U8,ؒ  8` -ML MԀ0S P R" 0pW ` 0@ ,0 S0 ,%Nq)0S! Pf)yPJK(@DP@D *03\ 40 ̽0Ľvv|vT -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@(0S ( \H0RC0R P(;0\ CR #00嗑P 0 C0 b\ 00`0\ PD,`0R tG)`vd:P HtfL$ KP2[S<00Z$| ht@ -PLM؀`pP@) T 0 S R@D @00U00  0 "P P &D <0S1vvv$ -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   *000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@v  -LM@P P`p W00  0 0  W P0-L@P 0wS! sS @T0 p %P 0 0{'.0 d[{Sp P00b' 0Cb00 0-PLP @3T000 0-LPP@0 0R0 @@0^H 0-SL@p  P`qP@4 U@@V@?H hP @\0000Q00 -L,MS @P D #$mp LP ?PPP|#0SA lGdVH \SL Q 0S 0S0#0S$ XP0 #PPe2p D 2`a"P  DP0@ >|"@ 6PPd2d ; 00 , D00 0<80 4 AO= m8,mmĥ@М4@ȚH  -pDaL MP44!ep dP ?P aPtP`` 0PX(PKxxP@ 0 00 S0w CxP@p 0L 000S 90갛 4 p-LM0@SP P `K 06PP 0 RPPSp@$ -PL@`p Fep nP ?P lP`pP` zPPPP 0P GPp G0PpS4 -L@͇pPPP0S?` e?P 0P E0 SU0S E 8@<@T -tLPMB^p`L  0@ P @l0 @ PXd -LM@pTP 0-S c@#dp lP ?PsPxPpPV?`W00S!0(R00S l@?Xd R $@KaP $0ASA2 A$ R20S`?1S2 R hBxR` R PdBd`VZX??0D,0  P5?BQc U`, (` ,pKPB0 R,0 PPV`U ,@0!@3eWpp@R 0%S# $K^aP $p`P`AT|| >>;DP  0p00  00S& @wPp6 P`7d僆P`2 pt@0ܣ@ DHgfffȚ =   0-@0PTL 0Qc@@0@ -XRLMP"@c?P 0A`V PU / 0S 㲄0S ;>1 LPl 0S0@  $0 S  1SqQ0S 1-0Sl> @P@Pc?0P0P00S` 0+0 0K@KKV0?0 0K00K?V000@ ;0 Q't K0P@@ RV  0 @, 00=(@ $М@d@l -PL@p` bp lP ?PmPp`t 0P0 PP =h0P0 0PPS0fP p-0LM` P@b?P 0AT K0L3\0 S0 1 !0l p$M=pH=М@0D -LM0@P,0 #vbp ?P SPP,0 S ,@3 AT #0 P 00LS!00LS0B \L =p\ p]  Qf` ΄XIP@PR  Q8 „P3 0X0C SH G G G G G G G G G G G G G G H G G G G G G G H G G H G G H G H H PI PQP'SP0-V +V ,Q@ |P \ \ =V1h0liP 0a0CSI J J J J J I J J J J J J J I J J J J J J Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<<3@TH\`lxܣ p-(QLM !@ga?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPpy P;P< (;pyp@@М 0-PLM @a?P 0PPKPKAP 0@0 SR R 0@ -PL4M0p @P0 TP XP $ `p, rP' ?P pPLKg=PX L;sP uP`PX  L K<PX L <w;0T0 0P0 0!R40*X<$Xe?@;P` 00X̱PT0Sc 0 00 ,  00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0StP0;0 T0S H00c RHK[pP800c R8K[`Y U u P2 P$ R Xr P ,PX2  SP0\U00Su US 0"0  40VG 0S 00h|0`71 R,4 }P# 0SSeT0S Xu XuXY<\00 000D-8D<2e  0(e U0S4V  V 00S`FV 0V0 R fPF\`0  @0 < ;@0p0H0 D 4:-М@h -pLM P_0?Sl@ M0P 1 00S<0< `W@9@М@d p-ALM!Pj_?P4 0P@ P 0SPU @Zp: '`:;sP``V 0-S Pp,sP@P lt0S,9p0S`@| p-ALM P_?P`p0AT Kb\P 0 ! 0 rR @0S xX$X@P00`h0 R 00C8S` RV 0  9@dМD p-DAL M` vv w -D0D L0\0 P H wv w P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` 00H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0U4wvw www(w -L -L -LZ 00v -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0Swvv w  -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0-vw w  p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0Twwv -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00  -hP@L` P Lp0T*0V  0S 0T*0V ww - PLM@ pH 0 0  R ^T@?hh  -D0D 0L0Q0 P`0Tyvv w -D0D 0L0S0 P0<avw w -p0 @L 8`P00Cs0 U0 T o @R 00Cs0(0oP@/wv wv 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00v wvw - L 0   w -$0L; 通 -0L?8 -0L6Ԝ - 0L0@* w,w - 0L0 w,w -D0L R80000 ,00@$w8h wԜ -0P LU:0` pUh0P0@  `,o p0 V` `01 0Rh?$ 8Ԝvw,wvw(wv-000 0 0 bL1C 00NhԜ,w0w000 0Q 0 R Lwv$w -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$x*U 00eU@  P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 00 vv P0-L@P T t$|0 0h S`0 ! XT0hb$H0<\$40 U$ܯ 1 @  ?>1 @ p 0P -'kP @, 6 ,Pd00@TTPUXxWT$#,1@LQ 00DwPW񟗩8   ` V񟗜 `X 00 "" " V  R X V X 08.0004, `@[0T. @0T* @(0V0 0 0  00 , F004 080 PL=@` DA OA0@0@0@0T * 00 r  < @`DA .A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh l D T l   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP dP 0 UPuX p=40UOP  @0T*  0@8@` DA #A0@0@hu0`0  `   $00(   0 S 8  b R8Kښ<P00 0S )00 HKPp c  000  $00(   0S 8  b R8Kf<P00 0S )006 0 | dK@K 0c000 d^0@S 8  b R8K8<0P00S00  00@0 }c KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-D D h 00 ?00A `@0  (CXUl4pUZ C0  0A 0  00#0CSO p p p p p p p p p p p p p p p p p p p p p p p p p 00)  000p 40P]  H R000 0p 40P"@ 0 ]m]0p00 0 40@U Ѩ k  X 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D D3[Sp[0DF `A YF`pN 40 U B GH0`VH0 `Pク ,` @Мte$P@PT@D@ 4Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X ll@-X=X ?X @4R44@T0@@[0=X[[aP 0@S*S0]S =X Z\@00  #0HS 2 0,0 0 4 bZP 0/Z40 0`CA 2020@S@@^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 [0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[`P 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080,Z>[l0`P`@a!ZL0 0`S`Z Z М@@x -LMtP,\aPP@pNPhUpG 0S ,K| ,A@B`(P  ((2N=00@0 R0`V 0S 00S 00P>AP@`40(  VМh -L@P_@%Tp? #T U@` :P`T`T TU@ :P@T0e  mG8P@:p`p :P`DT*P@: :P@DT*М p-LM 0CP`CA)P @0T *00ấ TpX0 @`DA wA0@@0@`Adph_< М -0LMpH`C -3<; R,0 Rr 00;00 ,  0S_,0 R[ ,0 RW ,0 R ,0 @ R P:0S, 00CSt  0 L L p p T ,8 004 40*020040S 00  4 M9 R 2,00w00Y000 0 0 0 @0 @,0 R PI0 0  ,0@00@00 4 `@K \,00`  `00000 , 0,0 , 0S ,0 R ,0,00,0 , ,0 R ,04 ,0 R 4, 0S00Q0#S,0000<00 g,0P^,0T0  7P 'H0 D 7'TK@0 < N0U0K, 0SVH7 0478  7@T@ 6  PT4 +&2?4 ,0 R@ 8U[)P0P40  U@K,0T lV,004 80 R ,0T80 80 YV,004 80 R,0 x,0,0P , ,0S ,0 R,0 8 80 R ,0 , ,0S ,0 R 80  @T 5P80080 8 0S,00"4 004`@T@ 4  uPsTn040 ,0,, 0 S00P0#S ,004 ,0 R ,0P,0,0  00,00,0,f,0Fa,0 @Y8 M1,0, 8 ٫0S,8GMd KhH#0P@O4#0S 0SFS]0 @_0 @Z``K`P-BP\0P0P 5dK 㸞x2 0000 000 ,0e`0\ 0 00 0\ P  `dK ㍞040 4 1V 0S0  Q@@ 0@ 1, @@p1,,  AI8 00 4 1# R 80 R 80 Rm 80k`gzST P 1?8 1S p880!1P00 ?8 @1SxX<,8KOK9O P딜d@М|  4 @ а@DH -L,MH, \00 p4 L H  0S 0@S \ |<V T,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0>0 0 R^ D 0`dVL@Q D0@ 0J 0!RPU7 ,0S 6 R /XP0H, , 00CS h x x x ,4 0044 |6 e/, 0@3,0 R,0 R @ ,0N00 ~040 0,0 0-PmH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00P@> @48|$,,#0< <00, 0< S 0DS     44 4 c#/ 0\/a,0 , 00, 000,,0 RP,00 3@  00 0@(EM, 0T F,0  ,0 R  : ,0M.B\ 00 2,  0 p00 0S B @KK <$U,0 S X0 Uo:oQR$ '=PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` u0S00p000 PU  , ,0S,P |=@DH@dHМht x@ a ^ X+ 8̱ p-LMP`PQP@ 0ST 0S`@0 0@l;L0 $ 0 0@ @ 0-L@F 0GPP$ 0h Aꤜ -0LMp@`T P FP L 0V0R00S@R F 0 0 М -LPp`dF  @0;` 000W eM0  0S;0GV0 0N p-LM@`P0=S\ *SZ +SZ@#F F 0 ` p餜 -LM`pF3/SVPP` @0T00SV 0 S PTQ 0S 0 U @2 Tx2x2 0P@ T2U  H.T  82>000 OP2P 0 PQ0@00Y @ @ Q0000 5F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 ܥP 00000 0 PP 0dXOjP\0P 0 d4 E@G@@,x4Мl@ p-L M PK`pFFP@  V 0 /R 0(00 0p鸜4 -LpMPK`@}PpoP@U WV 0Sp : S  S pp@Imp -SLM0@< /0)UP < P  UH1  000 , 00PT080 4 4 :4@UpW7 `eW 80 0c S8Kڞ-@ @ƙ/0080  cR8KPڌ-@  ᶙ<4 zP 0SPU4,4`, pМ -x0tp00lL @`0PP60D02 @\70000Ț| -LM0X pP `ጣ $ Q bP0,K  PX`A00 R  0S AQP ,K \7 X S7 0,y1!0  ,K؅;70 h 0 q 0< }9K,K 㵅lW,K 㮅T00 !H\@HȚxDtx`xl$Ըܸ 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@lxܜ@<te 0-LMPK@ K80@0S 0@S >0lx -L M,K`PD p-V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T   000!(@lxȚ -LM pK` ΄@T P0S 0@  00CS0<0@T@T 0 H@T0" 㧄lx@ -LM@K 8㔄00 \000 0txxx -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8@,i$tx|xxxxlx (00 000S  0S$4 0S000xܜ -LMP00좟000 SQr`0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BPY 0SN P 0S? " 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  m 0  <m-40 `|P0h;0l`0P@j 0`00@0000@00Za Q_M@ȜxDx$4(D -LM0` V 2 0S{ `VpK᠅뼠K  mPPhڸpKᔅ`V 0@T 0S @T`VH `V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H 00 0S0 0SS000l0000 lxܜ?Bx p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS0y00$ph@Мxtx|xlx -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@S|e lg g g lK@ i=V 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,"0 SVt  V  PU 0S0 S t\h10}"x 0P@LDTr"l0[S (!T100l Kx` e" `" p0Z"V 0SlK~ lK@ W"{0l0Kx @VT0 SS 02f 0lK2a R4P x X+"lx@ȹعHD  0 -8#0L` %^0?Sai Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj i Pj Pj Pj Pj Pj i Pj i Pj Pj j j j j j j j j j j Pj Pj Pj Pj Pj j 2P Z0010S P 1 @T 0S @Tep1@PT 0 PX@TX Z 001@T 0PU pP XPU@TZ 00Q00p @T 40S 0S @T@T 0S S @TZ0lx -p LP00 X R 0S R 0SRl㛫xlx4 -L,,0@ S00 鉫 x40SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00lx,xܜ|xxpxtx- RR  RRR00Q00Q <R 0S  R 0S lx p-LM0@`TP 0S@TpWPP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB |20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S   X X #X  $0 0$0.0S 2   hb  P\P Ο0S00 X V V0P.020c RKCp Vp ,s z < x Ԃ  = R $010!X00Sx P\P ͟0S0P0 PUf U00 UPP!UK u -00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  p PU U U U P-0KT:"0R0 K6P; AT 0 !R 0(000 < H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P P˟0S00  (X {XJ [000@* 00X  " b RKnp P\P ʟ 0S  00   00X    20c RKEp00X  @00 00$0000K p P\P ɟ0S00 :X %X#X 2 Z 0`0 K r 2 Z 0 K    P\P ȟ0S00  P\P ȟ0S00 t (X A 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00|7 ` R< R 0S BR RB B+R ' Kf  P\P $ǟ0S00  $X "X 20c RKlpX 00\00" 00\X `X00" Z@ `@ K& \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 u h2 Z 0 K "`R 0057P )K P 0@S " b RKp  00 R<4Un0(20 00 < b K0) @# )X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`w|q0FSGLAz@T *Xl (Q dZ}X0A0EA0US2 " / AE'2`A2&  f'P@ 0 0S 0S <0S 0( @ 0, <0M `hМ@ 8|hp М̜xxL(AE ''P@  P0R }R\  300T*X 0S0 0 0ΦU0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0xߦl1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "Xy2 JZ `00 K}X]2 JZ `0 K0S ԁ (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\07/0S\X `X2 JZ ` Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P ay000( `p 2 JZ ` K5\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  [X X'00C0A p-LM0P0`0@V:`p0T:Ĝ -LM 0, !B0001 < 40 0 Ҥ408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K` @P`S UU( P\P 0P 0R0 P U<K U$ <  b R: @P<00c R1 @P8 0 08 @@0 `0 00C00,xhМx` --hLM 00CS0< 00CS0$@@ Eh@ p-LM@@`00DSp0P B    $ < (`8 , 0 4 p<408`400,@ p-LM0`%0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 (1  tuX0001, dP  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S $<0 0 3ua@<hL 0-0LPp@-P0@0逺 -0@L MTP@ T J,\-0E,W- 0, 000 L e@TP0H , W 0 0М -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,@!P@ 8!mK `F0`F(0 r.xXPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄x ̕ ̕ ̕ ̕ ̕ ̕ ̕ ̕ < p d ė $ 4 H l Ԙ 8 \ H B^KPEpPE0K,0A+K0+0Bw`XP@p86B^K PE0PE0&]5p6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%95pl"luB^KPEPEl%0l"lhB^KPEPE<%`}1 P00{RPPU B^KPEPE0$ 5~KpGpG+ 1}0PPl"l=B^KPEPE0 }0@p}B^KPEPEl"l$B^KPEPE0$B^KPEPE +0w*+uB^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDlM"lB^KPEPEt#{B^KPEpPE0K K,0L+ A0B^KPEPE.0P0p0"3B^KPEPE0)}}P CuP@ B^KPEPEB^KPEpPEB^KPE pPE 0` 2B^K PER$0#0pPEB^K0PE`8 pPE 082B^KPEl!lB^KPEPE "B^KPEPEo C0P  >0P B^KPE@PE+=0 )*@)*av`F0P l)*>0P B^KPE~0KKpPE,0L+A$)* P0/S)*B^KPE0PE 0B^KPEPE0 30 S Sh8`8  p S \Sd80#pd8 h Y`00`8 hlU@TdDȫTC 0S 0O -LM䡟䁟p@`P\P 1 R0P0 PV(ꠜ   , #U` 00``` 00c R*@P000  V[U(K8P/ P(0PS  b R0@00S(x0{P\P L0 R0P0 P0 `hxМ -1LM  0((0 $ (0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `V00Мhx p- LM0`S0C0Px0U  Q@@T0 AQ 0p( P@ 0<0xh@ p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00plj@(0  0P 00pxhx 0-8 P0@0L _ @=00М -LM0@=C0 0 ⁞]М -LtM 0S00cS0P@$ T P0 0@TKXPx0: SH K 0S 0X S `0S X ,'P 0@@xxx̺x0x 0-LpMP0@S|0lS`t0 TK  P|0: S\0 0 00 x4 -LMp@:``OPP :-`PP%-P@ 0T\S T 00U0L0 R T?-@s Dqx4@ P0-L@ P@(T 崝T0寝4 p-LtM@PHk08`KP0: S`0 0 0p4 0-L@D' P(,0P0h+ꄴԺܣ -LM0S L " 0@QOK08G/7s00 K(h@*&&a    @ 0@S P@1PSg@0S P@1PSXgX7 0P<&8 /(0$00-Pw'00  A6 ! P PP @0 @*0SƟ@P0PP @ *|o&`'0@/SP@ P P60S0@6T  'q@$V&F(R& '0USqUe%5Q00>&0@ 0S 0PP PT5P` `$PP,00S"P@T $@@45p 01 ZPK㩅P2: Sx 0`@S@` 0hDSk4$02 e0L0  T$P0``P 0SO 0S<@T 0,33 R$P PUY00 0S3  000%&P %&4 R  0X 0@T<! 0$I 0S cZPs @$@$  $ 0 00 g$2kp00  P P 0m 0T1X1pSP00] 1SPCp@pTW&#+P &0S 0S0S p!0SmKPKP!$2R! 2RT+Pq qPppq0 @q+P`@\5P APG40`n!!  +<4МL|@X <ܜd@TОмXd -TL$  @0 <0R4S0 h*%03{ĂD -L$M< @ D0  00, 8  PH s @ R1@000  000  040 1Y]P@. ,P,0 00S X00 4 0 0DS| | 1D R&0 R  @0S 0 @000 <00P4, ,0H 8 ,@ ,%,0@ L00S 00 40Мd -,0LM@@@hМ -LM, 0 ,0#$ 0S 04 80  00S2 < @ <0S2  2\P@) 0@S񟗙ꬲ <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,0< R0S, , $0$000$0<0SR,HP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0$  8$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 =:,L7y@  0 ` ,@hМ@(dHD P0-L@ 0S PP0 R @P 0Sе [T 000%0S TT @М -P`LpGP@pP P00 Q @М -haLPp0S  0R7" \ @0 R@BT0S80S W` p0  h`V#0 R!0 P0@CTT WU@ wbh0 P\  0P$ М@d< p-LMl`PU \ @0 @Rڃ~ T ̘0 0PU 00pМ -(0LM@T @TМ -,@LM0 01h\М P0-L@ (P 0R @T0nܜ -LM/@P@r_(P0 0P0霓 -LM0P0@cSZ bSZ k `K C 0pR R 6  0R `V  $40"WĂ d,(0 ("4S ``PB /x 0-L@qPP0) P- X 00Q0ڰ000Q0  Q -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$h -H`0DpL0f@P9j00fDjP@x p-PLM`0P m@a@P y'0p 0Q0-@PLN0 00hт0 p-LM0`S0 00@ 0PLPf0P00p p-LM<`P@1S@$TpQ'Pp鄟 0-LM@4P,,P$ 0 0@Ծ -PLNMP! p0PH1 `AT P$UHR?K o'mQ?K-KAQH1`PH TP@<`0S 1<SP$U(ܾȚ` @H 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 0@М -qLMPP0` 9 PP. P, 0S0P00S R 0V0U00S00 U 0HS0 0Q$`k @K$ kڡP0 _V 0000`QR b@ܜ< -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  r0  goU<PP@ 2 V 21   N<V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S O$0S LP0S D1@S @1S``!T RDD L!T'D1 S 1 SD  0S0#0@0-S /P 0-S 0唐 @6@( y%kl@0* Pp%kLT@0@S 00$T000xx @ $ 0 0-LM@P K0 S  P00 Q0 Sp 0 0-L@PP 0FD -LDM耟0QP`@$0 P$0 S $?k0p;kUP!P0dP@UdpK  %P40Ҕp 0e8М -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |$P X pX Y X R0!S@ R0]S@Ȱ -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  #P``FvȰ1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  P" 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh P"Pc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P 0?00P000:S00P 0T HD0L0-SX^U0 00 teP@l 0-LP0 S@5 0  0S0hq0S 0\@ 'Se U 0S C  0  00SU0<0hP4LPIP0AdȚ -LMh4 4  , 00 @Z4q8 3dPPP@,dTX` U`V`P40cdp0S0W<0 ^ ~,@\8   00@T pWP8oU, 4 0, T < 0МTDL@ -QLM@ PPp `PP*PU e*0S P0S0@e P:eUp:0h0 -L`p PPZ 0#S 0@P@ -LM @$rP 00 rP00 p-@LMTP` ᴽTP pU fP0  ✐P00ⷐ0[x`М -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ e 0 SP/R/00040 bf @0 bRP d8 R00 4Lf0 cR@P ,d,  P0 S/R/000.S0S/S  8 @0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` eP0 Ulp cdT X0T L0h驏P像0P@@ꠜ4@М -LM@e|0     O00 K 0  P 0P/0000 `PМ -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /.P`dU VO V> 0/ c 0 0c RPBNK ` P@Dc@D` saP0`(K P/R P PP X@,0 S ,0S 0.S0.S U0u/S U0.S e`0/S P -LM@p|0`ᤎ00 0,0< (p0P UP@20 P00S 0`` S`` og opetW@,宎М -PLM`lp@82 T& V`0 0,0$ (` p ` P oꘀ[=x0\500@0P oP PP PPPPМ` -pPLM`l@*$ T P (0St0W< 00$  `  Zo\W QoP P PPpPPPꀿ -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@Pᘍkpl⑍@М 0- 0PSL@FP isPP0 , 0,媍 0- 0PSL@ +P Ns 0P 0 P0 0-0L@P  0S0 0  00 0,w 0- L @ 0  0 0S[ :Q0a0 /;b0 P0    0h Y$0 0 ؿ -@L P 0 Sw p   0:0@ #  = S , @0  d0d@0 0 90   0p``V  'Pp``V@ 90 000S@ ;0 0W$ 0  `000@ϳ$00@ -LM @   0S9 / &:0  P 0S0 0S0:00;0啳0 00$ 0:p  遳$00  -LMP `p* V# @T T@ a0 `d d0V0 pX f0;p @T pl( -P Lp7 WpG2 @Tdp) @T!  JP @0a@T@` `pW00 V dP  X@$< -LM @T 0S  0C 0 P 0S P 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S h p-LM @`A v" + 0`KS" PK  㛇P Po0S   ;0f0 $0p  \$0 0\  R 0 B `0p   l P0-L@P 9a 0h0 -LMP `pZ XS@T 0PI T@ _0 0 d0 `dpV&p" VQ@ z]@`T`d  Pp@`TV  _ 0 0f0 0S 0 ;0ױ 00$ 0X  --LM 2 -p-PQ LP@4MH`KH 0 0  @p --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l, @T 0DLS \ \ \ \ \ \ \ \ 4 \ , < \ H \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ T \ \ \ @TYT A0DS 0@%0DSSk 0 <0<00 <0 d0D,pK< S/   L , L Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< ^08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E C 0-0@ LP0 SlPl0  R0S RR 010000 h4y(y8y -L!PP@`p 0S 0|R0P 0 T  0e@aP00|P4y8y -LPP`p 0S0@0 p0T d0T 0P <T2P^@X4y8y -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @4y8yh p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EPy4y8y̜hĜ( -LML0@S 80  Q 0P4y8y -LM$`Kp@H P 0b -(L P0 @`DA SA@,@ 0 4 ,0@ @dDA AA@,@ 4 0  pМ4y8y̜ -LP 0@S x0  V=QT 0SdH1@P U0`0?(0 VPp Z 000F@߂0@؂ P0P0 :00 0p0 p@ 0p P{  0 UhМ4yh -LMq@⢂Q@0 0 R|a0$ ( 0P d1PH0S00?  P( 0\*,1  ( $ @`DA ⒂A@ @ ( $ ;0P0 P@@T,($ 0`CQ 0\*@ $ `( u  p10 0 $ ( ∂D;P00 ;`4М4y8y̜ p-LMP`@@P`p -LMl@ll P 0S0S $l0 00 0 0괠p4 0- 1LM!1P@@ \ 3 )\0@S0  - P 0 S P0LSPKKK }PK 0t `PE\X K0P <@ 0 0b8y4y,yh ̜P@- 000,yh0,y -@0LM@ 㔁  @     М -4404 LM,@0Ĝh,y(y 0-0L R@0x SP 00SXP0S8 0S$ P@\(0P 0S $0<P 0S -LMPR0@SD2Q00@A2p Q`z T1s Tp Te T_ TY 0DSLTEQ;1  0BS51R1Ep`0T0 W P@0T*0p0@1@` DA A000 000P0 pP P0`p V P 0P`)Q``(Q``P H0`PL0Q``,0 R4y8y̜Мh p-LM@0`S0@ %  R 00P0Q* 00p@t0 @dDA ~A000 000P00P 0 4y8y̜@М -0Q0L0 7(0 0 04y8y̜0S  0S R   -PpL@T`01@T 1?A1cX0P`+ @ Tm/QU 0   @ T 0A0 S R 02SP00C0gfff -pLP` 0@01@PT  0R U0Q@5TP0 -LM0Sp@0< 8C80C01P`U  0R' V0aP6U0Sсd0U@w000 P@ 00 RT00C0PP 00 0000CS 0 0P0 000CS0r p-LM0P10`P@ 0T S0 0 R@0P@fDA %01pМ  -LMaQ @ Q1!0 dT Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< o04h@y! HyD@` 0 )  p-LMD`0@TP Pp)QP 00@ "QL -LM0!0Pp@ `0P W %P TP`V @Z 4PPP TPT P K#P PP0L p-0LMR@እ`\0 @ P0  0S800 0Ss`p0 R(ꜜ4 0S 0 0 R CZT 0S R 0S 0  R Q CZ p- LM@`T P0@0@ x0 P0S V 0 0SPU @Zp0 0dLP - p WL` 0S XX P< 0@] XX@0  p 00<}0  @ 0 *d4 p-p0LMd `0`@` P0` 0S 0SPU @Zpꔜ 0-8@L P0#0 @ PUZ0b 0-@ LPP.0U< 0 0R0 00Q00S` 0h7 <0 R 00Q00 0000S}4! @ 0-\@P0L  0 S 0P 0 ꠠ0S ꠠ -LM@p PPP0 "  ` 0 R$V` p0ppS 0p(K (p $0 0 R`( K0R(0 S  00 0@!  P 00DS / 0 @0 H0 X0 `0 T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P & `0-0L@P^$,@0h'S^$!? -LP`p@ T1 1 1 1 2 t2 2 2 2 2 3 3 W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0p -P LR`p %R s R ;0B:S4 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 3 3 3 |5 5 5 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 5 3 3 3 3 3 3 3 3 3 3 3 3 3 3 5 3 5 p0  ;R   Z @T @DTʜ @D T  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G y p 0 S P 00P @0S`x@PP200P @0S`x@PP00 P0 00000SP p-LM`P@ex phM p-LM@`P0 S8 8 8 8 8 H8 H8 8 8 8 8 8 0S Tdp@P0SVU@ PEP0TVU S 0-L0MDPK@ B 0 P9 |9 |9 9 9 <9 <9 8: : : : 9 0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjw0@S Pw`00 R 0S0S1SP01^  p-PLM`P5 P0P 0@S wPwP 0@S w0Sw P phwwp p-LM`@PT P 0S 0Sw0S@pwww -LMLapPC]00,Q, p=P@, XPP XP XWi#]5{. W]00o"x K@@eT A5Pp5P@ i4D L$,Px -LM@0S\00D p-LM`Pv0 0Pv0@0S000 L000 D@H@ 0 L 0PpМ -pL `L0P0A@TJ0S 0 @TZ 0 (Hvhvj  ~М p-LMd`dd n0PSpAW ,P1 S0 0ġty4 -LM@pP` 0[S 0S@┐ 00  @ᯟPv g  p,K0o,  R* xvEМ -L MB0( K!KP` 00Po![P`r00000  0   !0 0B0\0;00  H10 R 1! L0R'C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C 1 P 0?00 00<0 0@ PpL0PS !0[pS 0002P0<0(p!0[S(哽МTy<dX -LM@0, K%K@p`@00  Q ! 000 TP 0@L@T " P  0 00  0000%0[S 000P0<0,\P\МTy -L0M\0 p(0 N@a<    0`7 (!(1+`K @ 0O#ODP0U0f PG00fGP@ U 0 UBa1#  f0E  f00f 0S-00f  d`(0 S @(40]@<gfffdМ -LMK @p 廼D -L@,50 R00SP`p@K B 0Q0*t0 V0   0 00 0W 0t0 00p`J 0V0 Hм 0 0㑲P xT UМl@ 0-@0pPL  0 000hI80/   v0TyМ -L@ P`rM    RG  0 !@Up0 00SB Q/ \Q\-Qp% #Q, 0 % q0  0  R0Aq0 0  RWAq0 0  R7AQ00?$QW@d@T00S$T@` R XRxR00  0R `00S _@  0-0LM @KrpPh  0 R  R0P  00 s0 -L M`@I0P  0S082`sp   ` P P q00  R@PdU0n@P 0!0!!0eP@ 0S pL10  00S Q8!0000ӑ0Q 0S p00  00S Q 0000ӑ00S q00  R@ 0P  0L @m00S  GМ @l -LM0p  I` I0P00r@ G@=  0 0c0 GZ or -LMP, 00 AP` 0[S =S `@3 R  %0U p[0  , RV0 xwV h3r,  Q 0X40 @L , 4 @ )80 <   0T0 V0 S   v ,0   k 0 00 008 0 R00S@0    0T0V0S  <0S0  Y%@T4 R} V 0   W0S0 ?S 0S ) A <P 4  00 00400Z  r r ONDP PIP ,0h  Q`@P  @QL@00  Q 0 囹@М@ - L`p%60W00S PU 0@PqU 00WD0<0 0h> q q ! -PLM@ 0T0   R0 0Q [R P@-0S00 0\00 Q\0[S 0S0 [S ]SQ -LM@P0 0S00 -LM@P  0S 0=S   -1L M p< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 p0@` DA pA@,@ 0 4  pL@T   P000L@T0 4,0Q* 004 0X0@` DA pA@,@ 0 4 Q0<0 М 0 REH -LM@0 $P 0 ty -LM@ {P hty -LM@@P:Z XZ Z Z Z tZ Z Z Z Z Z Z Z Z Z 0<00<00 b0 <00 <00S DEB0T <00< <040 0<0yH؜y p-LtMPy@P [ [ [ (\ D\ T\ d\ \ \ \ \ \ \ ] 4] T] ] BPtV00LpXop@ 42 p0<0a@ "@`@0<0p0<0jyupqp0<00<0D!0<0ĴUpQEp<:0 ! P 0Ӫ0p p0  0 S0`P-0@/S}OPK္P0: S`pLuo000<0qD0 b< @0<0k@4PyHT<ly -LM@@P-^ ^ L_ $_ _ _ L_ L_ $_ $_ $_ $_ $_ $_ L_ (_ L_ @P000h逩t-old0 hh<@P o00h@4Pl -LM` pE0 :0W0 PU 0SPU 0SU 0S  n@  0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@0Sd 0  hМ -LMpP%0`KW1S} @1SP -LM Q#ph`a0S  @T 0 S 7@t 1 R Q 0T2 0T/ 0T! :PB B @<t @ XQ YB 0  0 0  R X0 Q\@X T?}D@܁ -|XL0@ Sc f f dg g c c c g 0 0d c 00dR0c00P@$h@0S\0PpH0P0  c>0  A Pꀚ,܁h@ -LMPP`0  @P0 04? R 0LyS{u t \t \t t \t \t Tt \t 4~ \t l~ \t Tt \t \t \t \t \t t \t \t t \t \t \t \t \t \t \t t \t \t \t \t \t \t t 4~ \t l~ \t u \t \t \t \t \t \t \t \t \t \t \t \t \t u \t u u v \t @h0 Ru M00 pW-00Ĵp k  0pWur`܁TPt@ p-LM`@PT# 0dR 0@P0@p^v0S0C0 Vvt 0S00Lv0S00<0 P bPQ  P0P ehdl -LA9 0-XPL0S S 0@ S0 00ld -LOM\0X,0 0P S ,0 S ,,դOKKK`VT UP W?K+yPW?K \!QH1SD1 L1@_0P S Tb818S <3 8lte -Lp`@T TT#6P0S! P T0  0S T ,+@T TT 9+8l -Lp`PU U @0S P U0 0 00b0bPU U X8l -L MP`p@T T T TT T$KPKP@ (KFP; 0D S0 H         ` t $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S 4         H ` | K*PppýD*Ppp=*8*pPp2*PppӤ+*pl p-LM^`P0S p.T@0S 0S uP0S l p-LM``@0S pP0S {@0S tl 0-@LP|UTp0 \0@ R0S<OPPtehl0 -@L8Mp` M\l2` N\X2@ L"Ybp5&LKTpK`H P K0T L` *P@P00P0 'PP 7 P ,0H P0 T @@*P |<<K +P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \wC0[SD[0 CR 0R P 00x-Sl\0 pW@X D00CS00  ä0 SԔ4<T|| -0L 3&@ p-0LAM @P` ap sP` /0 @bTQ!P ,PpGOK.PP V ~.2PP <D  -0L ԡ@ -LMnQ@0,T  h7}00000 0 000  -LM0p (0 TP@/UoKK/PKU  S?K\ R0SKK,L1 H1 D1 @1 <1 81 41 01 +,K]L0* R;(0 S (吡 -LaMb>K0C 0Cp( @ẟPv$6: Sg  S+PW(0 S (d:PBnK`F`F|!|1u+0S+@aDPP$[NK@D@D  P-;2W>C R0 RW W;ƀo|0S o+@PPW d岀BnK`F`F+EQ0)0KW @edA(L -LM@KX C0s aaaT0:at -SL Mp@P|00!1/P`!  CVx |0S@ 0P P* ,W@{?00 \@a` X0P P* W@{?00Tteph -LM@ K K 0K @@V(P -LM8 < @ P`pm 4KP@h 4 0R SB B%P`Z 4 1)40@#WP0PS ,KL mPP 0 P@ U10  XPP 00S0 KP 0 R ;;S BPP 8<P 6PP 0< @0T *PPV %tT̳ -ML M0$ , p * P`:{?000!1 ,0S ,废AP@ PP 0 9P z0S08z0S !0eBKHH F}(0@C fPP- x0@S" 0S 0S+ 00L| \ 0$ 0:z?000, 0.e$tX -L`S$Mp0K,  Qq00  Rp0+S-S-S +S 0+S-S QLq430  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @//z "00Z &z 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUy"00 pL1  0P81@@K1`E% 80 ,,8 2p0@0KX0 4 W$0K J40K5 B"0@Z$$ `JPU *0 K0 P00KU:@ K00K ,@ }V`-V` l -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sty"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0 0d|8^,Q@00 K00cPE: UcU pP/tgfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?P PPڌ@PEUp pT00  0<0S000PC r0 0  R  -LMp`#0P@ r \P \0 P@ -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 WPx 0 XP0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 ? -L Mp`@P@ <K4K0H0S񟗦 |  , L < d   d  d  p L d  L      X L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L |  , L < d   d  d  p L d  L      X 8D3#cX Q0@ 0 KD0  DK5P0S s!000PKp Hs!00CP3L#cX Q0@ 0 KD0  DKP0S s!00 Hws!002cX" 00D0 ?0PKQ@  DKP0S [s!00h {HRs!00ŸH2D"cX 0QD0 @ 0 KH0S DKP7s"003s"0020K00!1cX! 0QD0 @ >0PKA0S DKPps"00ls"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLr"00Hr"00D00K000 0cX @ 0Q@D0 00K DK\P,r"00(r"00$G|$,4|<DHL`dh| @@0D cX 0QD0 @ <O0 KX@0S DKPx0 R r!00 Gr!00000KP0 cX 0QD0 @ O0 KA0S DKP01 R ]r!00l }GTr!00x100KQ1!cX 0QD0 @ kO0 KA0S DKP1 R /r!00 OG&r!0002U00KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R r!00Z !Gq!00Q2'00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R q!00, Fq!00#300KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R q!00 Fq!00200KR2"cX 0QD0 @ 0 K0S DKP{q"00wq"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R Sq!00 sFJq!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R &q!00 FFq"00v0L00KP0 cX 0QD0 @ 0 K@0S DKPY0 R p!00QL Fp!00HD000K| , DL?G?m"00@ ^BL ZB1m"00`AD1@!cX QB0@ 0 KD0  DKPw0S m"00p@ 7B 3B m"00c0 0cX 0QD0 @ @00K0@0S DK|PLl"00Hl"00DD00 K`d DLG?$P80< cX 0QD0 @ DO0 K`0S DKBP0 R l!00  Al!0000K000 0cX qQ00KD0 @  O 0@K DKPl!00p-`P@0!@`Pp -P@E:::LCLM/\p, J\!h1S   00 \ 8AS, 0110 p0 0 10 46@ d,0 "&`'@0@p 0y0 `P@0,!O3\ \0 eL03  1S@Rp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \2lPnR0l@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@L h -\ *p`T<  0 p`@A -0P@0@PPUL  t  0   x P@Xp`X 0 P@.p`@A? 0-L LP@\4 00A -LMO@k0S -L M. p\G/ `P+P`0 `P8@0  KR70 V p0SP` PU` K?@0 = 0-H LP@0S0hp0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&x@(8!8HT*@@*TI2@0@bP8@8#8XU*P@*U@2 ȀP 0&@-O@d4xB 02d @-M0Ѝ@4=> 0o {9 -L MQ@0K00#  0 V0T0P00S00#0 -LM K K!|P -LM K K!pP -L 0KM#N( -@@L0MP0  0 L0  00S00 K( KP(c00ꨔ -LM`Rp @t%  P`F @pT`P0AS3 Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á?P R-LP`@p0V  :00@@@@@@ 0@-@TP Ž0P000 -LMp0 S P%0`0! @! V@2CP0@KPUN 0 S  均0S 00Q -0S 0  0\\00 P8- @- H- P- X- `- h- p- x- - - - - (- plhd`\XTPLHD@<8 8Xp0\ 0- LM@P K0  0p0*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J,0 0 0 0 0 0 0 X0 h0 x0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s  p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  @`  -@TL P`p T0g0 0l 0 e@DT ** -AMLM#0,0 3 &P@U 寲PPYBnK`F`F sP 0#S | l P2 T|P D vP4343 0mP BKH H 0 弴4TU WP@ 0  謴44S O$`2 ,0S t,B^KPEPE\ 74rP 0#S 0 ,  '  "P ``` P BKH H 0 @i4dV P 0 @Z44SBNK@D@D +8 P@ a0S  P@0S0T 0S㤐 0S  0S  0SP P<  `į`zX@x -40L R4P P00į 0-LP$P P$@ |P00į 0-LPP P$@ gP00į -LtM@0SK 0RP H K 0S x0L: S< T_O00Q_0귯P0T -LM@0S00 -h0L,M80 \0 00 T0@4 , (0 $@ ڽ (00 8K 0  (  P0@-@P  0S ^ 0S^0 @0S SS00@00P0= * -QLM@,0 pR P4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4N @,0PP`@,0PP`O^0 0 * * --L]M qPM?KC/`KK \1 4Q 0Q  =K0K00S cK|1 1  x }p@ 1P|fP 0S L 庂|1S00^ 000|1 B+L *yyG * -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ !  -p-LM`P@>KC/JK X1 0Q ,Q | _?K A xA D0 bKd1 t DQ c 0S Op@ QQ *vv * -LMP -LMl"  2 ,  " !H pe^0P2 0 PP 0S{ P WP 0S o]$481!`)!w\0`X0 `0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ 8  V12  P1, OK @DH1 P-?(K R!  ~0S 21?(K R2S "RK H K@ [基0 4u  MK0kPMK P+ 1KMKu P[y Qb [0S [k LC* 41`)[\LD 0 h[0#S [L $ R@]K 0@,Y"|@B"2@@eP 0S"2Pܦ$,<̣lUDTte -L,Mp`@ KD0K< 8 @ 4 0 , ( $ JPDP@  0`4PP @TDҦDΦ0 -LMp@P `p08K8 (P , 4` p7K0 8K (0S ( -MLM Z,   4 `c V $ 0P@S X3`1 / &Pp) B^KPEPE0,! P*@~&`~V INK@D@DP 4: S  R 0 Y0 ,0S ,KPt $R 0R\ 4 L ;8`T(@\h -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $ -LEM@pKK, 4! 埨K081 PP@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S PPUb ?? UP[|,0 S t,D~0S @S tP K?K,`0S @S K?K,0SP @S  4.P`8~ 81S  K?K~, 4t8 0SP @S 8~ 81S  K?Kf, 4\8  l -LM8KKPp <, PP `P@ ,0 S ,}P/K%>KH D LB @B KH L @B R@?00/Q,0 @  BR0/S  0-LMP@ 0030 4b14c021b!*9  0GϠ\*//X*""T*jjP*''L*++H*D*..@* -p-LMPU/ @0 㦾 0P0S0c 0b`PU 00 00p@ K$ K(0K ( P @ PRP$00P 0 w@  M77*88* * -LM^8K- 7<K@ K0 <0 >Rp` P" bP^DK@ U `@KQNvD@K  @K0 8K *** p-LM@ _PP! `@0  Q,00R0  0S 00S0 ^ @ 00p -QL0 M4 0 0Z000(K00) yTPP9 0 P0S pЀ`@ڹ0S@ ` ҹP p WW0S 4 R 4 000Z0 000S40S 040H** -LM`tEPPdq 0SL0HH!plP0P00@(K 㤢P(0 R 0SMR- $GR R $@Qʑ T#ppx#KRdpKXpAkR gRmR,pFte L\tpZd**uu* -LM<`p@P0$ P@ Pp -LM@` q00  R@P pK ! P00\0SP:Q UqD0  00S0SPU@   -L0S  -ML M0CKJp`@P J! ,p P`@ P呼 ` &PE~KpG`pGf ǟP\ \ 0 S RL\  \*B^KPEPE B\4  BNK\4@D@D<堟PS~KpG`pGe AP[ @ 0 S RL@  \*B^KPEPE @5  BNK@5@D@D44!\P-RK@ @PPSKLSKLN4 0ɩPR.K B8 B1P@ 88x0 ,0S |,sRNK@D@D P P@N00T 0 p-LM`PP  Q Qp r0@0 @TQ <NP spN00p  -LM(a0Sp=QQ 00 !1Q耟@P"0 !11j?0P  / 01!0P0S00<@  P  P,0(  10BS0)00 00 0 -LMp @GWT`P W6Y4UP00h00C0@` @@0P00 R0pp Ph 00@` P 0h1 0C 0 -LMP @EUTp` U,Z(V`00hG00C0@` @?@`P `h 00 @` ` 0h1 0C 0 0-0L)SP'010CS#\ 00 \:0@S0 0P*KP0000@P000 -0L)S`p%010CS!\ 00 \:0PS00@T *0S P@ T:00@P000S  \00 0S00 Q-0L AS  00 P  1Q0C 0 -0LMS,0 p`@2Y00DTST* T( 0PiP` PU00XQW Z@@ Z@0 J0  0@C,00 0@ -R0B0LM@@^ T lR0 0 R B0 0 o 0-L@ P<@0 -QLp RP@@T*`0S@ S CP@ T:00 6P `0g0 @  -LMQp` RP@@T *P 0S @T:00 0g0 @  0-@L P@0*bb**|*x* -L0S H "00V:`>P@ `8%0==0` 0 @ a0AS"  0 @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖 ԗ ԗ ԗ ԗ ԗ ԗ ԗ ԗ ԗ ԗ ԗ ԗ ԗ ԗ X ԗ ԗ ԗ ԗ ԗ ԗ ԗ X ԗ ԗ  0 X ԗ   IPI< @\  @ R  @0<@0 X V:H   ₑ H P@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H P@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 fP@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H @P@  j 0`@C80@ =`< R V:H0 0qH0 $P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 G 0@'͌@ G @-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!!n* --LM p-P0LM@`P8 4句T  Y yk@ M - 0p@L` GPP0S @TP@ -L 0S$ 0-0@SPL((% 00 00UTX 0-0PS@LPP PP0TP -LM0`Sp (KᣖPP (QC 0#S@ S> 0 S RA(  #TP0e(0 (P@} ( (0PPhP@ P0 S S0 S S YP0P0,K e,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @P@ bPP 000  bF0@NE0@ P0YP 0VXT괔0괔 -L>0S鴔0\\**;;&* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ iXZ  CK@@0A"$1Q  H BK@44!@?P@ BK@Ƞ@ 0zP p?W 00Z00S  "$00R00S &8BK@<@44@ BK8Ȕ -p`LFPP P @P ṐP 0S0S Ȕ 0-@P@0LS00$ 0000ߓT Ȕ -LM(@0S0 00Ȕ -LM0St (K /Q@`Tg ( 0 S RL0L(  S *(0#` @Rq ̫PU`@0S0T`ÅPP `0 S S0 S S P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\帔PP 00PP@Ņ,,P| T@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L *AϠ* -PLM@` +B00P,K0K 0, ( PPp VT000Pp  0 PPp  ӪA0@A@H* 0-! L0TT!P@AT @@ T 0A0 0 -LMp`P@匀T ;0S0d0 @ȥX00U@ <:N("A -LM@(@T0 @   B00! RA R0000000000000000Z* * --LM -L@`pEA`0 XXPϟT  8噮8 $0  徟e@ Mܣ 0-LMP@ 00"0 ?0-1pQ LR@` 0S HP @@ ԩZ0@< ŭ0000S@ ?0-1pQ LR@` 0S P @@ ᠩZ0@< 呭0 000S@ 0-LM 0xr.0l@hPTX0 RP 0 PP@ 0 p-LM@hP`\ 0 @4Tp`0@ R 0-@LP 00,@r.0  0h -rSLM"0@P` :@@p 0P 5@0p0@ p-LM@hP`UM \0 @4KTp`0@ Rm 0-@LP 004,@r.0 . 0h -rSLM"0@P` :?p 0P ?0p? p-LM\@0PSP`PP j@0PPPp(PpT 0-LP(P0@P @0 p-LMDP0@S8`pJ$0P@@@q -@LMh -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KB\d QR d5PPBDBPP XK X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,cUT@PPh@T P@K0h LK@峙Ph Uh  LpLP PLyh00fs`V tCDK0\HK P@KLK @PULD0LP 0H3LK2 P@K@P`P: h0S@- zh@ )R P  T SP@ 00CS0 0Ӥ0 P p m0+S:P P P 㓌P TKA\ d0@RSA00匒h >PzP \QP!00 DQ0SG d0S7 ?,0d LKP@K@PPP LLP0T@KPT AAAPP d@T XKX 0SpR`@@K` `0ΪH0 =P(0 @]]>*9$7*IϠ$2* -LMğ !  \ ,  Ḕ ' !0R0`p 0P1 4@K K 0  K K,K  K K K K KU0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 0SH 0SE \  !@0`C⅀K O`Pp.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00.=L0`X XKK, 4PGK 6K 2K .K *K &K "K K K U0S ==0S. 0CS*V w@1 ,0S @,a<` KOp<0S  WK<P1KXKL00L0 60[S0X K60K#4<00HPP < 0 lL L 0$0 -L0Mp0P 0 `@ LKL@KD00D0 Q Q i<00 0 S 8 a, dQt,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0dd/*KK+*'*%#*%oo* *R0S 0S0S0  R00 -MLM00  0PP `^@T T 0T,S 0S UP kg  0PU  0PP  0PPPp p-LMP0 S0 `@0 P P0S.0X S0L@0Sp00    -L M̀0`Sp(` +P@# P\  0ǯP x$ K10wP(KO{=P (80  $ xL@-0S@ @ 0 0 0  -LMha ^( @Pp$ < 0wPD ( K10'P= (P8U00T00S*0U0T00SW ـP` P 0 $@A$ 02P $ 03c$Kz x --L 0-<0@ PL,,T 忙 0h@ M 0-0L@P 0SP0 CR 0P0 00R P1, 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``yp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' +p"00@40S\00pgS \,00E0XSxS@`P  -PL4MPL p` 0 S@P X 0 S @P L0@KjP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  1/ `+0U# >E0CS <0pCaH0S  M H 1 D 0H0 L0U 0R*0 0\) {} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 x  -LP0SPp:tP` P\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S ;0SS 0 0@SJ0  t0d2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP u hp hHP  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h rP & P0S.*8  zrP( 000  -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi qP0S PP PP  000   PP0S 30PS  -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , qP0 R 0Spx0   0 R PX 00p , 00  RP l p-LM0K KP` 0 ]0@K0K KeP`p -0L `@8pP Put00  00S P h =0S04  4   p-LM0K KP` 0 ^00K K]0 @0K K!P`p -LMP`@p0SGT1 T00W0 W00Si++++H-H-H-H-H-,,-H-H-H-H-H-H-X-p-` f 00   f  f"  A   i f0   f  f"  A   @`pG f 0  f  w@D q@D`q0 S  - L @P0 00T`%^  R ?>1&,1D #@0 000J0@@ D0@ 001P 0 P 0^ ?>1  ^0 f p@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LMP@p0 000`V@  ` g ic 0S  `ik- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 0S @ 00h 0-0P0@L 0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0%P< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheE -LuMp0 (, 1 P`_ PPQ 0@p1 0$P}K@{K 0oK. ̡ ȑ q TuKm#P! 1@p@nP oK ]0 ,0S ,aD 0'10SD0 <{ 0 `P0 -LbMȠ0JK(0 4kp! @)@Kp|Z_K`vPl0 \ TjKjK11 P 0L(0 S (C( -$0L!00  -LMp 0:S "0 R00 02"00 R2 0:S 00 S0!d2 l2d"X2Q  ,0:S D<",@0:S:?0 "0 0 R00 S0101! Q , 0:S !,@0 ,0 0@|-TT0 R, H1 R , 0:S 4$1?@0 R0000Sg0S4@0 0q0  0 0 a0b0000d@h d0qTP0 @P0s0`@PؔԔte  -LM 0c -L M@@Y -L M@@O *tt*PP***33 * P-L h/00 -PL`0\p \=|# 0 0  R3 @ Th P1@rT%0\ \|h3  00SWpG3 /\00\0S@.\ \|3  00SW0 0/\@- \ V t0j T ڊ>j1!W pG T 8(00 0S @S@S@@@0j!T@QQ10  00S V؁P@ ؃h P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ ႃdP`a\ h000X0 WpGk 0002XpGH dp<lP -LM0  y -L M@ 0@ yRR*ZZ* -QLM  0K  0   0-LP@kp P_p U T 0\ ္pP UnTC{{** -0LM@`(BPP0 0$@ $0 P tP@5 ]P, 03pP1XY(ʐ LP p 03$0 Y   < P$00$0U   p0S $ @TD0 003$  u3S03Xpp 0SW,0p@,@ ,@ 00l0 0teX -LM( Dp$ ` /PP P Pz@ (@00 00 0S -PpPL 3@S0S0@:3S5$0``PP)'v zp:@6@ -@LT` $0* 0QP3 Q# R 0PU@G 3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` P3ա 03š0 #0$0@P$0 :>$0P3s7 0$ @Q$0@ 0 S003P $0 :P3 $0p P A 0@;@$0 @2 up @@_Q $@ 0 0R 3 P0 3L00 P  *PP$0   30P0K0 8PJ3 03 PU 0  PU:$000# 0B8S 3S  $0H ZP3ԡ 03ġ0 #0 X R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h Pp P]600X -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z ;PP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DT0{ 40$0:$0?00puP  W $0 P T 0phTP0S 4 03$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 03`00 <0 |@X400420#4 0 BH  L ,0S V4 #A400ꀕ -LpM$0@0PK@P0J 9P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`&Pp` p 0 0pP 00 -0LRP@` V P  0X @T` 0@T000(00PpPppꌿ -LM$0HPPp`CP@ 0 W$ 0I00D @0(`"0 -PLM@ @\T 0-00L@ :0S00b?0 00C0媿PP 0S P3 R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0"0UP1S -LpM$`@P R K(Pp 0 0R, 0R p00V@@&p  PP -P@0$pSL$0  0` 峾 屾0S᫾hd0S  -LpMpp`  KPP0: S B0 0 p# 8=P@ (0 0P (PP 0 PϫD0@000*P `p$PPP7 V -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T4 , d/  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPHFTPP\< `@L  0%0DPc`H0S[`@0\ 8PP'p -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|  -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g  -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0h G-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@PpP$ 0 0( 0 0, 00 000  4  0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP${xvTPPYl$j *d@L  0'0DP^dH0SVJH$Fd@0\ dPPSp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  9P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|  -LMp, 00 Q,(P4 0 8 0 Y0000AϠ0 P0P 4N < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 80 40 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X  -LMp, 00 Q4(P4 0 8 0 Y00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< {P ,Y 0 80 40 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0Y G-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE11* -4L|MHK0 @K0PԤ1e/ @ \ \ R *0S0\  \ 0|S :S 00hh$@``$@X: @PX0D0L K@X0pL0<P K @(0P0T K @00T0X K@,0X0@\ K40P\d K@p00, d0h K@80}p408 h0l K@<0sp6[>dp K@4kp7[0Ht K@4cp7[0,x K@4[p7[0| K@4Sp|00 K@P0Kp00 K@T0Cp0: K@0;p0,K: 0Ln 0KHn 4KDnT 8<@d|DLHLPTX\`dhxWEV  p-L M@PQ`qp0  0PpH0 XpRP 0S0fC  0  p-PLMP`@ 004PX0P D0 P p0S0@@W@-0@P :P00P  P@^ :T ^0@S ^:^ P 0^^ -0ML K0 -!ML M@ ^@ , < D8 h( J0SX tV P 㻭P' HH 0 ST( k D8SP   0ѱX(P L B^KPEPEX( `X ``8 U+D* R$  0hK Vph:0P`XL8S  00X5 ,0S H,x(DfV0V\S`F P0\00#SS iPh^ P T( T8SH0SH T^~X(R0\8 d= PPv @0S :S@00DK@KA @H(D8 @FpEPPg pNP\( p:0\( 0d0 4HdH 0S :S@d8(0l c8( 4H @0T:S:008( 0f Pa8( U 0h0KᓭP0hh h 8(` p@  iD48(@d`DX L^dKDL^EDL(Rh@0AZ0\<(^\2RPX' D%P@@`H PL\ T D P( )ˬD^KHPEPE0!o P@*|1 R H PD %X(L  P 0pPp KAA CXPX ᓬ0寱`@RPP  0AP@( @<8PFPy`` 2P  00`HH L ltx -LM@p$ l$`K ,PK 0 p P , 0S0$ 0C0 00 R0S   \ 0 S @0:SS |S0:S|S S  0-L@P0h -LM<@0S00( (0Õ00 -ML$M0cßS0 S, 8 < rP "0S0@05 KAAQP@R 08 0 C0\  ||20  00S X0 S\R000:S #S $Ÿ ^0 S\R00KHHpP0 :R0h;cp0 \ B*;K08AWAP=QP08@0pC0@.= 81 p p@qBNK@D@D0 08 0KA8<(0 A@;0S@ 0 ,0S , &:80@ @00P dQPP!0<QPC T -Lp= P@ d̪P`$ d0:SS ^S \S $ @^ 0:SS00f^@A`PP`VߪPfdDP `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?xx00:00 0 0 00T 00S:S00ov -Lp= P@/ dPP! 0d:SS 0`e\d@ 0:SS00e\@APᦪPPU5靪Pd P  0-LP# P 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@00 :S0-LP 0:S0@0h@0- 0 Sn@Sܔ -LM K"vtOOI*E*$$A* -LM0`=S`pP߮,K6P@; UӮ P:0P00@S=S 0S=Sg! P,@bP 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC QةP@ 0 0S 0 @0@, 0ꘓ p-L@`M@PKɬP 0! 0S0 p阓 0-L M@\H0P (0 $ 00K K(0@  0  ,P ߓP 0 | BB*A``*##* 0-LR@@-@0S  S 0Sd@(n*(g*Q0 L 0L$hhW*$%%P* -LM< 08 rSwS@T 0 0 ㌨, ,0S| 4KmPv1 Rop@\ P/ 1 R(< 0rS <0庖P4c,0aP, @0S h, 00,0Q0 @44囖P0ܭ1@T 0:@T< 0rS 014P 80p 4!0@4T P0 R40,P (墭垭,F x p-LM`0PS4 @T 0S  @T0SpxT R00000S`K pP%0S upW S -0-LMP0 S@   R1 00 cQ  R!,0  0S "0 -0-LMP0 S@   R1 00 cQ  R!  0S ^"0 -0-LMP0 S@   R1 00 cQ  R! 0S +"0 -0L 堷阓 -BMLMh#0P,0 0L4  0S [00,3 ,0S ,"/fPL$H$ K2P@@E00 cBK J JH fMK@DPpP 0Sr+`0CK0A S A P2D4 H2@ K0C0C0  A  '00C=S񟗗ttttt ttttdtttttttttttttttttttttttttttttttttttttttttttttt0 S  1S!00 c0 pζC0L4 dꞫPnL$R 060S3/|̳X@-@^  0 S SS00N0Q --L i| 0-LM@Pf0S 0g0S e0S  e\ 0 @@P] -LM@`PeP pW奧W0S `U @YT :0S 000@0PTP:@T TWᗥPP  㫪 0\ -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`%ZT < h000 K0C0C/  +*Y Pp* +9cp`?00^ 0@C/Z0@hR>0N0SZ IF, D\+c>00S8 B>K0C0C+< c!X p-Q00P00LMSP@`P 0s pp[ᲣP@`00p 0S SJ* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0ǍP %T 0S 0S0 0C` 8,0 S |,BᩍP 8P@pzT|@44 (444<Tdp|iz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 P MTD|@Z  @ T *000ߌP d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `ꢌP T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 xP XZ @&43@4 0qL9  00S 0Z0C0   0SQP 8#0d` 08# 0\0q8  0 0S0Z0C @0 S0P x8JZ!3Kg @+0DMSaTTTTTTTTTTTTTTTTTTTTTTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTT <3S<  @00CS0000TZ I@XXTxT@ ;6 3K<# -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#Hv3.KXXohP  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SFdddddddddd@00CS0000?Z  /@xeTET& 3NK0d@3Kxs =K43@ 4C  43 43 K83083 43@~4# 4# @x3KXx3.KXᭊP    9 S9ᛊP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@o  @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ J000P`dp@V : 0 f0 0  f -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K 0KP@@K 覊<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I  -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 ʌ@K @@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S Bp"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `  -LM0 @0pP `冀WPP @ ឡ00@P0  㞝PP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0P0000i% 0-P@LT a DA0DSR0D@TP0 \(.\P.T.Q04 -EML M@H$ 0r/, y'H4 YL h Pl4 Y 7 ,0S ,!4 $pǟ8(<,"(S\$ D ` 0 l 8PpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:6 D 0 l 8PpDDPLd$ d$ \4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0 h CKA APh%H奡D4@ cTHn[D4 0D$ `V*9` VX *9`V H*9`V x*X4.SS`TYYX^ X$ YR X$ R @@ @x X}@x0%(H$G Y\ YY d^`` jD?PD3 WX^/ `P" D4 0b3 RD :dd Mt3TP:hQh DT4  T4 呅`D40D4 D40D400D4 <K 㣟<0S80S40s2 D4%sGYDlF?P%D4H$D 0 l 7PpD^Pdd ``QD4!0 2P^D45p#04P 5wy DƠpC>K0C0C t4 z7Ppt5P t屠D4@ cT`dd tuZD0l D4 L1PP*CKAAp 0 p4P7Ppp Pd40d4 D4P0P }D4 00pD4 vD4@ cT`p>ZD$T0D4 D4< 0b,00H4 D400D4 OY8̘8Ę dD 0-0L@r/tlP80s 0  0S 008̘ -L Mr/0PC8p X X0c. 0YP  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn K,0[S6 `S@ 0fS+ "bS @TV0S bP Ƞ 05/P 0L` ቚySX`{ gY,0[q0@T t1  0 D0S:R .R 0P.S  <P,AYh!hh1H @0 p@@81  :"YPz0P.Sl  <Pp,Y < 00 @p@0 0x@v+h0K ^/PP'\0 "/00c0[8̘ d Ę -BMLM3@0r/, .8 x7p XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn =2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,RIP< Ƞ@ <4-PP&@$< 02Pp Q<l  !0X0P 1 8$0  0 0 <NySX p  b0 +X@tP. K`g0 , !\P@p PPUZ.0K gXp900 0  0 @ [\%/00L00SS (  h8̘dĘ 0-8P@0LS((e?0@0?T 0-,PLP 0@T 0陂@ -L M0r/븢4 0S ,K >P@ ,0 S R@0@,  S*h \,0`` @#R #WP`,@PP r` ;P], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`~@PP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4M@PP @, :Pn4 0 ,  P H0 DD>P W8̘d ĘT -pL` 3P@ 0Sc;P PP [;P 0S t0 -pL `P P@ 0S 0S 0P -鬁L0M 0嘡0 0` px1Z>*p?P@P7 P 90 S S0 S S ?P`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4w?P@ P\VP $0W`4d \ -L(Mp젟0 S( P;P 0@`8PK P@ZP00AXΞ    t@@0p!lL0\S@0 !$ 0^A($ $$( $$X$dG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ$d$I$i$9$$$ -LM`0(K\p@P.  t($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ Ms -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ PĖ@a 01S @-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P: p-@L$MaP2 ` 0( 6TX%X@ ph -LMp0@P 0 0`K 08#HT UPUP#08  0 S   |   -BMLMr0D`K@P ,0 Ô02S0$S aS@ l,0 S \, @0$S2P 0KY @ P TKDAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 iSTK ᗕ tK @TK  T:mH8, (0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000@E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` v@H0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !ZL -LM@t@ğ0 8`, 啐 .P 00 0S$S 00R5:0PK c x r K e  [P@    @0"xM 6@p    8"_0e0Tw "0C1e1cTiW   @  T60[< [48!A0[  950[;[/ [48  -40[:[. [48  !30[9[- [48  20[8[7 [48  01[0 0 000 ,00 S< 8 4 l t,Mᝏ ' "呏000H L  VUUU$ID 00@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ o @Jy?Z@p ݍ n fpP -L 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h , 0-PL@U !", 1#80!"$ 11PX 0h钎0 -LDM@@ hKc p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆj*#f*# -L P @ 0T `  p0S# @T 0R 000 00 @0p2P 0p 0 0R @ p-LMD`0@S$ 0PS$p Q-L@ 0Q`Q p 0R /0t0 0 0R P  0R0Q 0-L P@ T @ T0  R 00d0R0S 000 嫋P@ 0 p-LMD`0@S$ 0PS$p郋ꀋ -LM`0PSp"P@   Ή0ST000$_ 0S 0S$R$Ng*Π0c* -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'HHHHIHHHIIIIH0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 n0 SP:00P  -LM@rx 0-LtPM@KT 0K 0 %  @@厊p 0 S 00 0@0@ p-0LTMP`XK <@KhK0 0h0 偈0XK< K0@0 dK`0 \0 d0 :4']x0 S0 R0 S0 R -LMP LL1R00 ^m@` 0@T1@0pT^ mP` 0@11 T!@ 0T p`PCP_00 0@T0@Tlpk0@Pᾉ0SHp0TCP00  +P " -)MLP|M0pU K,0 $! P 0:S /S .TCP PU 0:S0/S phV }@z@@ T*BNK@D@D+@C(+&9+"9.,CPP APyp@ )K(JdJ' 7 *KP :K4S! K *K $(P2U ,`^ ^\K\P2P :KPP K0P0P@@T00<"  %# K *K0 K$ja0Q T PX @ T`@ T 0 0@Qe T@TdP` 0^- S@P0R00 SMT@ T 0@ T0 l5Q@]PX5 `0@T`P@T"^- KQ  0S 0@T @T^- KP 0S0@T 0@0CT 1 R@@@T44(K R K0j c@ KT$00 :K4@TXʈX KQPڸ3(K R: 0@2S00S00#0@S@ @D,0 S T,Dß2>@0  P 0!1lv@P@2> P h@P@0\ S0 S3K0(AA 0L;P2(K Rp" 0 02Sn-K( B B@0@T00Z,2( K0@T{KNPN 1@ T 1(K@T3K0(NN1 R @T1Sڄ1( K0T p \3KmK(N(`FN`F Q :K 0 K@$ T0P Q0nK0(A^ A0 %0nK^ 00(A 4BX TtPU/6APT P0TCHq+[[ p-?P0LMS`?QPPU1!1!^^M\@ 0`R p 0R 0R 0R AP``0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDM P\ ` N\0<S< \0@0cd0 0S TKP@ P00 `R <R `@ ~` @ bh 0S,S ;S XKP@ 0V0R00SD ;Q,Qv Qr@Q`PP001 R44 `b \\(0011 R\\̃ṣ01 3  RT0 0f   0R`c\Th3d Xa\3`T#L3,#<3  h0 Sh00 0 0 SM@ \>d h0^@ `>@<K^P@ 0,SPKUP@ @Td0X0T8"0,2`$"$2nK}"2`p@@@0< K {X0@P K uT00@0000@01 2` 1 !3`1X1XT! 102c2c3 S}00KSTwT0>CX0 @>`@ 0@>S`@nh  T0h 0c0h 0d U>\ f0@>S\ @ bd  dh\@P0` ^!@d T QH -@LM $0S h{ -L@08S 00Ph!i  -@LMJhGi 0- L⪂P@< P0S=P2 PP%^@00 , =0hl CP 0:S H P 0 ,=00hih  -@LMhi -L MR0S@(  \ 0S` 1 \[\0$ 1 l bH2A<a!/0C,b `11231113c\$0$000a$0 $Q01 Q$K P  (0S10&O@#/ 2!Nc10&O@#/ 2!NQ (0^& 0S@  RA 0@ 0S@A^M@0t (Kt 00=01(0\0!0^\ 0  A Q" p-T# 0ST Š ŖP@@TPZ@တK?0/0S0 P S@ ňK 0P0SÈ0S S UP@P0CS0 @0S0 Pʶ TKP4^C`0S@ @<<"\0@S1PQJ0 R @TJ4UZ0`S1PQQJ0pS KPE`V4UZ10 00n0  0S TK P` 40R00 ?\0#S a0 K P00:TKpPT;0 T0 _ JnPEDP0\  “2a1H`3a1R1R@0!^H PPKTK< RP lnQHd9  -LMp@P`\ 0 u -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 ^8 8 8(0QBKL !80Q80@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <K@1$188 P 0S <@(Q< @XH KN18(1aH\ठ04(D8@X P @dUPP P_,8S 0 0`cR   d9  0-4PL@~h  W@~0id0 0 Ilh 0 0Clh@0  R J1 0Q R@Z  -LM@K$0c -L M@K$w0@K 0 `RA 0 `RS  0 `RS A -L,M0P,0 P0p А R0<@K0 ᨠj&}0` PP   0@T P`;00P@@T 00 ,0S 8,W003(d -LM0H @0$}PH  hjLj -P`LV@}p0S  SP@D -``LM9xPp !0@ `0`VQ0@JDX |0P00SC/7}`VX@E_ZPj 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/|0!, -LM:L@0cP0S @0cP0SP,e  -PLM\\`p@P0SpC/0p|PUX`EOZd0 pj -L0M0 @00 R/Ā4<HTāЁ܁,8DP\htȂȂ0 (0 $ (K, K00KYzp, 0 0K|Pd 0 K0 (0 $ (K, K00K4zp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z M-L@M@ 0p`vP{ 0 p`dvPPk 0`0`KX0V0S   00 R 4 40  1@ 0 (@\`$@TpPCx`8@ X0pX L H T` Pp r/XK.P* <0 0PS` 00".0 @d@ P 0 0d Kg@@ 0000UvXv0 D0D/a ,0$@((a 00008~fp M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0mP0S0S 3`0K KP L ] 32a/@#b! P pj `@? B7c011N0 d 0!T 0 L0L " P/uEنR0d0hP 0-0PLr/8m4@0, ,mB@0S08̘ИhȘH -0PL4r/l0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S lPp 0@W0 0 R@ 0TP 0P8̘ -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $, P  -AMLM,$p(. , "h  V, 4  P 0 ,0S ,P`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S  -LMH L p r/0, kH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢  |)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 pPM00D"pPOK?K@DH2L42  p70 ni,8@7 P%8̘dT\`4hX -LM4@0S x$ 000 T`X\G-@ 0SPPRp 0 SZ0h0? 4@ 3 #T #R p0`W RZh0 0 ^ ^*.000S*0 RpJ\`0.\0 \\ T* RZS*` -SL M, p`   Z 0 S 0S@TP) Z 0E  0 pP020S 0CX03`505 `.T$ \T V*@@T0bST 0@>S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ l -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑl -OMLM@ 0r/ , g05 - 0gUT U U U 0O`= K AAH !Dp7 To!4oS* I>K0C 0C000S000@S0005\ =000@Q eY/0`00n0`A ` P@ \ `Ppa  H D< (K OKAPPF $ R*EnK`F`Fe4@@ ;P@(K R  ;P&+(K0 S S %R0P S S \ \ \00\``V`@, 4 P`e  P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS}D PW *(PK0 S SQ\n0P S S \ \ \00\@@T\`, < 0 P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  xPx((@K0 S SrUUo 0 P S S \ \ PP P 0T r0 0  R  0SMKL LL@K '50  #N.K B0 B0C P0S  R4Epd4 R2% % P kXdT ,we P&(@K0 S S U UP 1115  \ \ \ \ 0 SS} ;S`z 0 SL QP ;Q Qq6  0P NKJ J  FPE %4!@% h1 +P`3  Q;Q Qq00  RP 00  PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώhO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  APt P`#(K0 S SHY?P  E " kI`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@DaPPV:00|P0:0 000,0 S <,.0cPP ENK@D@D+P.5P ,`8bP@ `p,.`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0Sy1S8̘ИhȘpHT\C`hp |D,* -0LMP0r/d0pSD Y@ S S@0TP S S  P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S P  P0:0t P0; X P0; < P018̘ y0{<4<("4 <1QS0 g 0-L@PP@-^T0)^ 0-LM@ P K 0K  P @@`p0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S \ <^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP  P-L \hBꄳ/00h -LMP@`T,`K,pK :P 010jP VX`@TX ,K `0V0.T00S` X  -$"L$M0P@ <K ,0 a0:QK 0C`cV RN K0 A .P@+t U~ @@y 0  HPpK> @y>K 0C1Kc@@2AlA H D< L @L Khl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1AL\ĂlT*`$IhQnml tlU< -LMTp,@KP` 0    0S Q *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Q -L M@KƉPT `0 -L"ɠ2l3c13@"c1MP 1K0  G C -L^M⸠p`OKPC/MK@( h < 8 TVat0V$KOK`?cKpG 0@FfKq q A A 1 (0S ( -PLKtP(K@0CP@ 0CT d H P@o 43( K!$(,"( R`*R^ 2Kp3 0 IF>K0C"P pt0,^0S 0t t h wh$0 K@P@ @PD"(0K!48<#8 S*S 0H T H0L P J I@P  LPh@hA Hp\ L0p4Smp PB^KPEhPEl!l1 P/*Bp@' QpP͢0#SEKEKALK 0 LAIP4 \ X T QX4P$0P VahPRaOah@p$RLV0[\P`l -LM` @0 0\ `0P -pp`@LTP U P `@T` 0V0000h:L -LM$@0 S K04 -LM@`PP|B ,K0,np!0p   P),0|bPS)//////0,0/0////////( 0pP,P  $(0p p  P(PpbhP04 (00   8k8 -Lh\P0|@ -L  hBܣ -LM`VPpP 0 S S 0d f 0 0 @0$ U@5p\ -LhP0 --LM  -LM@$ cP0$0KQ \  0  K 1S015 -@LM z8 0-LBP|@ 0S L| 0SPeT 0S \00LS `000P0 -LDM@ d JP dJP`} 0Sh 0S0J0@ @@`K+7LLpP dP00 H XP L T@ fXKP0SVJXJ r_P0P0H0STTA 0@81H  uP wTP0@ 00垠00p0d  N X%4 40qJoJ  `0X@\4 00}00 00(@,4 00q00`:<p< -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 P@ 8` -80L0S ( < 0 8 0-L@P4  P@>00h_  ) 0-LP@P0  P 0S S1P 0h+0 0-L@P P 0S S 00h0S 0h  0-LM@P0S0P  \0G 0 0-0 0 0LS@P 00S 0S 0S  0S 0hP@@@@@@000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ @-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 J<4(<"4!<0  -LM0@SK C < 4 00WZr>P 0;) x# ; -LM@pP`~P  R 0S  RV  -LM0@S`pP7 S3 KP RpW :W V>00<PU 00 >PP 0 ,0(U QC #  P gg$g,g$g4gT0 " 01@\A G   DT:0XS gfff ON -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a Ad0K?aK@D 0KQ |A Q A g1` 0S  寷# -LM0@S 0'000 -WMLM0@P=KC/NK, h5 @A ( K @  0IZS pddpddddddprdqrdHtXtXtXtXtXtXtXtXtXtddddddddddtddddd ddddddd؅ddddddddddddTt t<dLdp(`dȎHddXd.(K0S 0(K0  00A SP cX˟1  UPb #U0PB 00@ S $P7 2S"12 202 2 02 PP ` " " ]ꍑ 0 0" 2S P ?KP f02 Pʟ,0 S D ,#b\ R \ 202 b  K).K?K h+ >(K *Y 00I SP 1UPi U0PB00I S$Y@2R SjK).K?K <b 00A SP =ɟ0! UPc0U0PC00@ S $P 2S"12 2P202 0U@@B\ R \ 2PB  K).K?K P1UPi IU0PBF00I S$YR   p 2S"12 2`202 VZTB   00\0S㬀K Q. :Q  ?`>(K VR  "202 @"PaUUژ&0 "2 0RPEK2 " pUT6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTc PfUU[E00@ "2 0RPEK2 " pFU0 "2 0R2 " p3ʬ" `` "2 0R2 " pNʬ" "2PcUUğ00 "2 0RPEK2 " p/Uʤ! "2 0R2 " ʴ"1Q0lQ g2S 0K 2 KP 0@ XKP PK KPKeYV K/ nPQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCU}UC00@ "2 0RPEK2 " pU0 "2 0^PK BKPKKPK"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 t1 0 2Q02  K4PCK/PK <AK&P5K20 "2 0R2 " p!ʸ0 0 20Q2  p K 0C0K@ "2 0KPKKPK  #T X0d  0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q^KPKPK \AKPKKPK2Sgڤ1. (K K0 "2 0R2 " pN Kz/O 7P 20C0 2"00CQ2  p ʆ?K0 "2 R0KEPTK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " PK ,$CKP%K00 " 2R0KPKPK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pxڠKPKqPK lDKPKa^ K00$0(0K0 "2 0R2 " LKPK4PK# % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 '0h0 %`PV P00 U- >(K Pu`  2"S 12 2`0" 2  2S12 2  Po " y2 "  2S 12 2 Po  d"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 6" ^   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2SK 12 2`  "  >(K t@ GYgYT@ 2S"1 -K2 2202 -KP K/ =넃P- >(K ` -KPX2̌S QKL -KK K2 IGYgY |\ggYEeeY"fY \  ``y?(K R- >(K \0l``\`T ` 0`L K l2 S``2 2 KS12 2  hQ2; @ 2  lQ" L 20 W 2S12 2  2 a@ 2 KS P12 2 202 M  2 KS"P12 2 202 9   2S"12 2 202 ###  2S"12 22 /202 2S 12 2 2  02S1x2 2  P`" 0" 2 k X2S12 2"01X T "  "P`h`-9P` \ Y K >(K`2S0 2 %KP "+sKPK0S"y 00t -LMj @PK  4pK, 0 p 4K3K2K1K0K/K.K-K8 0K 0KrP@ڸ0@%SP@D0p7 @ 0BZS/ꄔ\ܔ`llp (pTxpp000C S`KT1Q,0!cQ00C& 00B S$R 0X0  0Z|KK0̀ Q0  @Z0̀jKK& 00^ 4 K^ 0<^00 @g,0 S 8,  *R 00B SF 00B SA000C S`"1Q0!cQ00C 00B S$R0Ѐ Q0  @Z0ЀKK 0<Ɵ1 Pb0P0C 00B S$R0p  0X 0Z KKo D  0X KKb  0X KKW 0X KKL@ 0X0  ZKK<  0X KK10X KK(0X KK0pp  0X KK   0X KK  0X KK 0X wKK@ 0X lKK  0X aKK0X XKK 0X MKK0X DKK0hS0{@p20lS0p- p+  0X ,KK 0X !KK@ 0X KK  0X KK  0X KKv  0X KKk0X KKb0X KKY00X KKN0|RZ  p`0 j6pp^  PN0Q0S괚P P&P0{  # -LM0@p`PW10S 0 6pP  34@\P  b5pD0 5p ~Jp -LM @`PfT40 p ETeTpG/  P090 ,K0K0RgTGTp400  fT@ o P0@ 0 R*00SC 00 0:0 g 00S 0@8  P0h0-0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  gfff$ p-LMP5 0Ae10T0d1 P50 00p <00c1S1@0`/@LTt  -@LMT( a5  10AhZ5LT -PLM @ 0S@@ 0-@LP0 S0 0S0U 0 0@2 -`Lp@P8#8S"!"81 ("((^ XU 0V1`P`n !@ p3p -Lp B/ bR@P`0ڃ0RN V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@00@ -LMp`PW, `pP 00 R0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp3EQ ܀`V@" P @T `3@T 3Z@S0ph@3<?`@$3 0 1pꔑPqx  -LM0b 0PUp@ڂ U R0  R00@ d 040 Q2 :RP 0E0 0Q0: P!0 <01R\3# -L@PP`9 @P``p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@3 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@94Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :C -LDM< |0P|C00KHP L L  q0 0  RLL 0-S +SL0L0 0 SY 0S L`/RP T` p9RTW1000CT0 10W0`CLp /RL 9RRDp C @EReR@@ 30 0. L +RL @0 -R- 00B SL #0R! 10BSࠃ@ L0B0 /RL0 9R L@10 0C/RL@ 9RL@!0aPS^@ `@ W D @R lT@ D  T@WT0K ZD0KHL " VP@0 0 K0W`0 @@0jPU6 0K 0KPd MU4{"000`0@KP X5\3d1`/h-<@TLH^ 0 K00K N $ $||@??ER+ U@LT`@P 0K 0KU`,056C,0 0@K 0K, `0`V0V,00 56,0 ,0 0 PD T0H` l `0@K`0\  l! /4 K80KUX @d \ P48@ 0p!`n`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQdXd @XX@ VX>X X\\ U\2\ Wd,d \Xv0h 0d1 hdE/O P@sP/O ZP@p`p`AP/O p`,  3PT _ T0 S3.O 5P /O  Zp`p`0Kr0 0K0 0 K,0c`T0S X\dh< 0 ZP@00S,046S / P/ Pڷ/ P00K,00K56C,0 #0 0K0 h0 K,2"0S,056,0 2Y ,0 000 x~Z %N0p`h00S,046S 00S !N0!nX,0S"0 K܀`0S"00cr/ P m/ KP@7N0Z1 ,0!46S! 00D Z0 K0@K0 0K0K- KP10@K0K0 0K%00s, 006,0 0 ,046S00S, 00C **0, 00 Z00S,046Shdh P5?55?5???|$ $A8Pe ,0 K 00KP+ ERU`U@lt`@P 0K 0KU`ʄ10K0 K0 0 00K0K O P`0 o0K0 K 0 00K0@KM/O P0,` 00 !Pp@@T #Tg@0PeʔA0 K @ n@ l0K@A 0@Kd0Kx0K [0Ko@~E0 KL g00Kc/O !P@+/O  PWL UL 0RL L L L0W L0 60R- 10BSL0BPP QP U ETW! pT 1W`^WT p1Ѓ0T0 W1Ѓ`PL0 L0 00B SL@P 0RL@ 0B Q{L@0 0SL@ SQL H L E -LM, 0 0 S0 J 1P,  4 p*P8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LdM@K4 \ 80 ̳00 0 1#:@":SZ @K/ gP  @K00K, Kp ,:ც᪪Z K0K J$6E0ƄJ l KY/  .  W/ P@ R/ 0  p` P RPP 0RX0 P@K 5PP 0 BP X0 0j@SP`@ U@dB@SC<@ U<@ E` EQ`0 0@ d `0 40 S0S40 0C40 4@\ @Q#,,?aCoc?`(?yPD?0$ $ PR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `D%hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh %` 0 Q 2RhF0P13P1 <2 0%-(0(   &  P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp    p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD    -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p  -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S "; Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0    -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 !-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00     ! !#M0( 1S Ѝ0SM0D #2::S Ѝ046S0S Q0 R0 P0000S00 0-0LS@6 00S  R011( 0PS00 P @0P 0 00DP0000 00D0PPl 0 0 -LM00@S  R 1S01P 00 0 0 St 0-p1L @RU 0 P0#<2 %000S 0 $0P:0000 0@0 00 0i9P0P00Pk 0@0000 P @0P v0 P<0S0 8000q4 p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000aP P*0P` 0PU:$P 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^P], P +0 0e 0  !000P E  MP0g0,0 lj 0 03 0-0L @R5 P-  0P @0P 60P $00 0 00 QB< S  0  0 0c0 00000 p-L M0K K@C 00p!`PUhC  0 SP P000peP` 0 0 p p-LtM@PP`K ,P0@: S  Q  SL  p( 40R p; 0p0+ 0 pX -LM, 0 PPPapPH0SJ@T 0 0S;1 p@& ER    000010 0@S000 !00 0  ,0 0PpH0S P   -L Mp01 R 0`0V0 @@TJ0Q 0 S@T PEZ`VW 00CS0`V `P>V00W4K 0W [P0  W 044 0J ȑ -L M`KPP"0S=p@T 0S @S 0ST  'P0 `00 0Sop0 p@ H0 Eⓡ<0!0 0@S  0-LTPM@KT 0K  0  @@=p̑ -L4M4@0@K0 0 S :d* t,@ P-L 0 hvh 00h*  p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`,R @0S R Mp-LM0`0 @`}Ip p-0LM`KuPP $ #"P@  R 00RP P0 0<0@0@ $0, 808 `(0  pg0 0X -LM@ᰊPP/0:0 p-LMP `@0 : 0ph<x -LM@opP  0:0q0:0,& -0LrS aS g0 0 Ϡ0+S bS 00 0+S wS ̠  -pLpMW@` wyPPN 0X1A  ~p  i!K^)P`O\ K 0SJWH  P`P5 Z QX0a0 100410$1$P@ 1!01 ! 01 !01  P0 f0`f`f`U%f`Z 0S 11 !A/Ɖ@}t AT O` 0R00CS  @0P0(TP !D010CS1!N1 pf`f00$D##0'! al* P0-PL @q0 -PLM0 0At 0yf00 -X1LtM@0 00 8p̠ 40$18p` DP @ V K?P H hU P0S400S 10SQ l `0QQP(f00B00S 0  p-LMP@4P+@0 H$0D @0`D 6R@D0C ,0P0320<00@(@0 03S0php -L4!`yPpGP/eP W& 1PU@8PP@UPP pW$W0e0p1ep10Cs1 1!0C1y10Cs1rep -QLMP @4P  P P0 ke0 0 -LBM`4P0 0  NKQ@pS0A/pbp AP@18!0R@T,P .eO00+e0,1al* -LM@S0 h;e00,1 -LMSS@0  \h!d00,1d0 -LMR@ 0 hd00,1d0 -LM4  4< 0 @ 80  0 \PpZ 0@00P`V R0b<0lP @`V0P%H%H%% 4 80P00000@ < P 0Q[%@&%x&@ 0S 800 0 c 000  80P  P 4 80P  R   R< @07P`p(Kp! w  ,  0Pp @ P`~,p~@ -LMSS`p@ S$!S00/ 0(1 !$! \Z (0 RP0 0P > (Q0S R$1 !0$1^ 0S J?P0S) 1S$ 0P000Q 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1Ś 0:P 0S( P0U(1( c0 0,1 -LM(0 p7b00VP(pVAv %P! @AP 1!0 1!( 0P1D!D, W00  ,0i -L`p@ PP  U d# P -0LM@ ,0( P00 0-@LPIP UQ0<P Q0!311Qc0@"b@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0P 00 ` P@ 9 PP  N 1 P@ E1S0C1^ 00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0 AT  0P @-0@0 @0!00 Q'  0R!7<808$88 887 2 2 2 2 2 2 2 2Q 0S !0S: 0-PU@L S P :s PP  0_ 0 0 -LM@PU 0 0 000 0\0 p`p  0P 0鄒 -LM@PU 0 0 0000000000 0\0 p`Tp  0TP 00递 00ᄒ 00ဒ -1LM@ p R 0#P' X R 0#P R8 Q5 0#P: 0#P  0#P* R 0#P*  R 0#P:R  0#5S  R 0#P:  R 0#P*P P0 0 S0 0#P:  R 0#P*$,  p-0L,M P@ 0< @8 040 0@ 0,0 (P \0`@K $ 0 ` 880 00AR`p @| l D 0-0L(M @RP#0 R0 < |08 4 000 ,P 0(0 $@ @0 <K 0  0 x*H@|  -L$MSF`2 p< `L P0 0(6,& 0Q4 80 P8@  x"4@0Th2@P,K8 PhP@P P@P @pWm,P X`pBU 0#V < F* 1Š P,P @,0p, ,0 R,00,00,P V0#03V00St 0 0 V( 4T!L  l 000 0V,P @` Vp,@ P@0Y:0 <@i 20,P UP0  V p8@C 0@`040@ 0 d"6h0< P@`0 p< 0p4Pg2] 00<  \]<  $t(  -#LTM0,0 ]3 p R`V V @TQ 0SN 匣p<0C>S񟗹DDBDD(DDDDD0D@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  Z&fQ *6 p,K(2,  R 2P@0T1 *P,0@ 0, PT1:0S P,0 0, P11 0F0 Q 000S P!0S0 0  P  , R0000@ 0f00  x R,  0#P R,  0#PR 0#P L[0 0 0 ,0 `0 P$pThx* -LMp 6P`J 1PPW WK0p0@0@0001300` P1@P" @0d!ST 21 @!T &6 ` K?0 @ T@0 0@xQ 10 Q *02'70 p `$,0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0 TP`VP@@`@P3P, h -81LM @RpC 1`VA Q0S8 !T00Q00SJ t&* T!wP0 RU 0  00U00SU00S  { T%ZP 00DxX d+ -3L M0 P4 d3@T\m X3 R :H##:S )f @ T0b,3 T,K03,P UP3 2p\P \L000C@B *"*2`21 2!40"00  RSR00Z0S 40S00 b D2 R 00 c409P@ 0 ZR Z 10 %  Wxu :#:S `P PU,P  @$ET P, UU` !@i1ScpWPU,P  h @$ETP,p U0 00 SR0 :JR40S00 b0 R04P@  [ D+X4+($X+Lht++++ -0LMR@0 0 80 t R h:#:ST,K0F,@(< <00010 pPP,`,0`V,`   @$ET @`,` 00PVP" '1 S01p7@Pp,`,0`V,`   @$ET `,p 7 F RǟW0 0d aQ0  0 6 01 @0D0 6 R6 RvP 0<& 0Q@0 \600LP0D 0 ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@tShfT -LM@\Pp` h^\QU0SD R 0S=W00  00CS\k4k\k\khktkkkkkkkkkkkkkk0 0#S00 1 0 0 ;00 0 0 R 0;S< W  4 R 00R 0, |@- 0-LMPK 00%0 @+ 0ST 0S @S 0ST 0S 0SRS  RS00  100*2 ܔP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10蘓 -LMK@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR -LM`@ 0pP`o20S  0Sb RCA 0\R! B Mp-LM0`0 @`H2p22**"*xx*JJ* * -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  by Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , @0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ 2P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0PX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0/P@  0Y008 8(40Po P0 00S"P@ 0S 0 00S 0P  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \MO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@ k P@0Php  P FMO0 0_@0@0< J PpBJ@ O@00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 !XL001 w!OLd@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S, -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h` -LAMq0P 0 LAnK `F0@S `F@D3 \0 0ᙸAK0 A SA *0$4 ᨷ0s1 P  1s 0S 8 TpK?005HCh -0- -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap 0 Rp8! ,,P8q8#p -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < X0` 0n0C 00,`0 0X00 00C8#Ƞ Pp@00 0E8X#X4  R 0("X0e8#h 80`0l0C0 , ` d8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h< `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00U@9PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 UU800C800 R -LMP`  a("H T p 0 ʲ0S T0 P  `Q0 pPpd`P 0 0b8#H Tʲ0S  0- LP@0S 0\HP 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0 P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,P   04p  0 S N1 06I0 00 0S0P 张@`0 0S0P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0  H0 0  pP!P Y 0(10S$1 0 ! 0S 0XP  0P$1 0$1 0-LMP @p 1 00 -L M`@ A nQP, p'P"5P 0 P 0, S 0  nH0 0 N0 0S0P  0Pp -LMP<0 80K0 Kp `P@Q0, 0 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<PP< 0}P -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6lessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknoddisknamesreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shsleepmvexprdmesghostnametxP<h@@p|̉ @@0cbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of input@LxX\dpx|userquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rs:cd9660%s: Filesystem not supported by kernelsession number is %s: %srealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] [-s offset] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-h and -i are incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %smsdos%s%s=%u, %s=%u%s%s=0%oshortnowin95direxecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-ousage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node ufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix please@LxX\dpx|o:mount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/trackwarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype]   p $ ,4 <D L (P̾DT\:\`dhlt|  #3#ļ3̼2Լ3ܼ3#@@W@@ (08@HPX`hpx  @@Ƚнؽة (4 < HPX`lxȾԾܾ@@@@ $ 0 < HPX`hpx@@  C$CC$C̿ؿ (0 8 @HPX`@h@pxdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.16 2007/09/16 18:13:57 sobrado Exp $Ffhnslinkit%s: disappeared%s and %s are identical (nothing done).%s/%susage: %s [-fhns] source [target] %s [-fs] source ... [directory] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.122 2008/01/24 12:23:35 krw Exp $  @D\sF[w(M*-rtG^Nv/ @S_PVʡH`=_w_˫joߨFulݨh_d/do^g2+Mflfo:UVJgyUwt^{wkUvo0ev6{ ^d4;-"{oB~g=g.7]x5יƯ6,MЌ0uκL?uV7pI'D͟OSUV)}mi?W'wn ,a:ki6]>i|&Zx f~zHO~8-1:fc=:Aj^e`I;?~8 PMhumn;^^mMy۶4>`Zy䊡͝K#dv2/fP04 _V o] KU16_X+?;W 2S`hZaen%n~3X]W!7⭴a%:L`m7-LK7hO.i޺-x2{,8 kJ gG pvz+Wm];G#MĢWm;ءW"LqUָj[!pQ.#]Zta*,~@&aՠ0 /3vݫ-i Lo/OR/Q"3?ݤbFBfl'v)$ >^ZǨw(Hm%r JYE%klӠp(o>o`vLZcS^̰!E֯ y~~ n`?VL-#2Y c%[Rh5?0&*,FӮoAc'Ǜ-߆J]N*i%0nz`cAzuuL8Sx}u~قc/K 'Z@tGKhe0v K8%kFS Yi0hnm-0L*yĝ/_usg"ܩޠIn*YcN:ݏ,݆V/OrtGg;Q{~1 vtcYiD[TN 1A!ݛ nU ]"T$ D!*|J$*qa.@+R u <usp^75mwƚ^ո^醻Zm|#m0:iKVbmr;M-Y:tv#(b?yצ)u.LݮB1q1 pa^D!~lA01AM<0|/(iyMkIMU6WE!V3NSTb,>TEh5B No՝\/^]\P͋hSGr@)qշ[XηON䥼nv\o>EO}䪶+غTTba!DE{꾁ءb㑂"P*[ꉪ$3򮜳&*[):6tU3nW ج' f،!lsެ7{|78ޥñp0(hDŽOv:QL:%_Uˢ vhD`655lcI  -OY٦'tgNb,SeI Aʱ'_Xb:cĄ^/~L8r P3$c(7BbN;Jvpkr~$`H!]'~ Fm)SЭz}gA-뉪xRZ@.4~ߠ(j'n62D @N"x0jgdJ:(:{;z>yzїtojYcCmHfrʓNS (` #^@= * C}^e|Ԩn%'8։'`pF"i X-% 5AA>m 4F$rׂf4>`MfE53f{4!f7Yx9D1";$4Max,~7Џu2$g tQ"3 67@L.&FWb 5Ne-XPMbZ#ܭa$htGnRbo`r^I} >ͺ8J"JWJSR#e>w6U m^Z/hel)P X\ժuE-ZJ2piy0pP .1$;p\g8ı42Ε|Ih ފ @خlUDx୹*spth0pul\E "'3'M V^aI*2̅"!q T|,6sr e%y(?޴GG1$ޣ$0HqbYXa|T@5cT`寝VN WK{ hMtBz9Q/*v ]x R0Ҕ@1b+1w۱P0- ;`[H庶@ţj^5-R@:^`H$ )S1he~ScS@:b>[G05{׎[2@8ʃϼ #7?pt~AWqfneB)!s s~ + Ϛbϛ=?>=^w%-7q,mX꣄pNq[**Ϳr\54jDbRĽshWÅ?e*aASDzf !aF,ZKKS;;8lhr8DZ`%=FT`Hļ^;$ `Nn,-ed6R#o^cve擃&| Y30 cJ1/뫱4~Uĸpd?IEIrݑv. iABDO\tiB;*Gym9 \:[S߯gph;pȐ6 LdHh&L 7Oa&!2H/TH|c۪RS*9do!e[n ,roJpTqlh|ǶaBÒhwTaL`9)u{GH`yN'aݠ*#kW቗R^4ZSˋz;x\pc ÜE~Ĉ4$p=9YW EiD3u?C&R:,PfcPz+Lh?!ᦹkocPƤ ~Jۛ]a{S 51H轃CܢIY84rlY//a,P.jeA@<$'R-XgIm@ܽ/sCAꂢBigD00zsqB,9dj<7 l~$)߱ޅ;3Vx9^SZ*XJd;c6Fel)huٞfq|6/P:=wc ەƂjr('f?3} v9)"v=77ì/.&g9Nσ B\YQ"}v)!H0;(2zI"__X{b>·8dkC;Ƅ8T570:ŝd+S9T } E*2ѷq`Xh եK\KWIQF,ǂAqWֵ d:?}%O]˴WFQw&x8d^v Ut*T{L(S3T^eQx;.i%\sm] FQ Ȯrkܳ,e%-q:a 7ڴp Tw~o/>Aa ڦy%(=rϏE c Svs[J0&=hYՆ]o(S-PIu&K@߻,횪.**(jjMu ^ vv) $:diAM.8r._(zzu-.qhQM+jܬsf8pB  $)BG^Iz,]/ZܗLĐrA¦6>D.5);7Dijłz"|Sh?4\H;q(ӟ IKiTh1nP?ib`$6Fm5yP߸EHA`ңÖ/eq߬PI%.cPjXVʚqKKhU@bKMSP%=HDdHP P"l$qg?ODiJU*:32oށjpӆD^1Ĺ(6/;ӌ1W ̆gAk)RX1.G=UwXYkACN,ګ=ZPp|j J)a}hH䰑vgO22ix$u OУezan$Ne;.˾Ky'z(x+uNM08*nN&c=:g|q'lK]fѓ3>rL7mv"!I/u2O4vHա.a]i_䁱WiD˛[>񱠓i"nYqA I8} lՐǸ9A>[+S+F3sN>(]os&X޸ƍ1=n?X%o)(I>ړ }Gn#cʧqASAp+'̮`3ƛkhyfW[ oNf]sl^L@gd3*a|?"ܗBM[V&I&4 =ڴj2u6CiH`y8N_4~٣2ʄA? pٟ'['^e<ĨQd%yڕ1N&K-`TZw)h;,J݁e7ck,`TVOM`?>n7ź37J(ɰ-f׷_Z=tI?͇"8rhqy/}By(G3vZ`Cvӛ2hXQK2 sh+OW n4TngAnO"Ǹe/y7(樂WmCgTWʐܸFs@s<Ƿ]ZG7X]<]se S!9?\>gst_lTYL/GuYh3'DU۠™.B7t"#P kȸˏdK,Q"3c>_HPP ˓eD-s uE::{~Q =,͆wkESYu h@`uݏG)j>rTvQnXeɇBVI)rZܱ8Ƭ$UVLZ}v1ϲUf;R-ٗSEed1:]¢2z'&Gځ=;n[΁4d>!#-z6FnO#у{0Llaw?t1eѡB/N>Lkpy_K4CBoP?F1Ȯ*} w)u<G ??<36{|/r\ QeG C:Ѓ&QsadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgtioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)warning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:%srm#%hu:%sil#%hu:d%d#%up%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %15.*f%c %15.*f%c %7.7s%7d%19.19s# %s %5u %5u %4hu %5u %5u %4.4s %c: %16llu %16llu device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %16.16s %16.16s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %llu total sectors: %llu flags: vendor badsect # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cVISUALEDITOR/usr/bin/vi/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: warning, unknown filesystem type: %sline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: too few fieldsline %d: bad partition name: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lldwarning, partition %c: size 0, but offset %lldwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabelusage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) %sdisklabel -B [-nv]%s disk [disktype] (boot) %sdisklabel -Bw [-nv]%s disk disktype [packid] (write) %sdisklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk.Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?editorunable to write labelNo label changes.In no change mode, not writing label.Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.partition to modifyThe letter of the partition to modify, a - p.partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%llu] Rounding to cylinder: %llu getuint%lldhas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.Invalid entry The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).The total number of cylinders on the disk.number of cylindersThe total number of sectors on the disk.Not enough free space to shrink by %llu sectors (only %llu sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk or a user geometry. It takes as an optional argument ``d'' or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate and display details about the available free space. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [d|u] - use [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate & display free space details. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Size of the partition. You may also say +/- amount for a relative change.The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left The size must be > 0 Size of fs block fragments. Usually 2048 or 512.fragment sizeZero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS type (decimal)FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceYou must enter either 'd' or 'u'. BIOS geometry not defined. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.[d]isk or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.31 2006/11/17 08:38:04 otto Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.18 2008/01/01 16:22:44 tobias Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.27 2006/12/26 20:58:25 otto Exp $$OpenBSD: gen_subs.c,v 1.19 2007/04/04 21:55:10 millert Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.67 2007/02/24 09:50:55 jmc Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.25 2007/09/02 15:19:08 deraadt Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %snext_fileIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == -> %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdiknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sadd_dirUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.78 2007/02/06 15:25:18 jmc Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [file ...] %6d x|dq dq`yqlyqxydq|ydqydqydq\tpytpytpy%d: powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_status no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECTSIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SXSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types? media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%i%i: bad prefixlenin_getaddrprefix %s: %s%s=%o%s=%xin6_getaddrusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtux] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDfFm1failed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDFmemory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a usage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_RECVHOPLIMIT: %sIPV6_RECVPKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpected IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_RECVHOPLIMIT)setsockopt(IPV6_RECVPKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't allocate enough memorysetsockopt(IPV6_RECVRTHDR)setsockopt(IPV6_RECVPATHMTU)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Received Opt %u len %lu Jumbo Payload Opt: Length %u Router Alert Opt: Type %u nxt %u, len %u (%d bytes), type %u, %d segments, %d left pr_rthdr [%d] [%d]%s segments unknown, -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncatedpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPAH ICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off@LxX\dpx|8880<H @PXܦ  d@lT`tbgdumbtimernfsv3mntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value %s: %sillegal -R value %s: %sillegal -a value %s: %sillegal -g value %s: %sconflicting version optionsillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT ZYo9~-W .pƘg d]XeGC6G"Ͼoz4;J_.T"ne*W*?qg λ.o~F^==qȼ(KE"PL%6yerpp}>z(Oaʭ#̽܋^4ҹ=55yLKX kbef:{ ]2l젾 3a:8 ]}P=ϩ(JDD4r!`*(\RHȲB.b%2E'*)u!,-Z6M Px6 ;;JWb$tg`*R e@Z+Mdk(3{8^a=+Qdb.'a*p0I4{I@ӃB|q&Cb"xD%YgG'V"yjcVQ 9r,xl0BY>fbZ Hv}Ywi(L; Ъ d4h"x*+ɩ:FlND7<{Wsܻܻ{ׂ0z= (hoCBh^wH! R+b!yKdw,*pLI, %)P49W'wHHP"p3 !oxkMȣOP)hs1 4X$zS8، zi{çסfYM!\BH %qEFȔQ6FZ~>Fm`*%l*B\4^@Q*]OhH;Z*RAjݨt6(D5u'}woULq{4lѐ kRB}w-mXM5d\%Q,sԘW'z@Oz'P!^!`Z=ؙ.-T(YTq۵.1TZ8:/a Mx|U!p|]W9rc7F۶~ ގ-$YLkZ4UwEOV48xjRhjE(Q1D}$Eޯd6;zk3Ǝ܌wVZZ|T9!W6L X2#^Bߎ\-']r!l0&Cu:G#CϬ-wݞ=>?O.Ɩم[Ӆ¿X,NZO_<6 Ó䃴 F_ԟ8Ȋ9I\[Rڱ`PB2MC K-)vU8FImVT _ۍr4E*?65:Ch\qa_W@qM[GwJuaSٻ/R%l5"Odhfҏ9Iod͏0c?vH⴯H{)]xDž Vvl3Xbk Mΐx΁SGMpޕSe…r-5PWMi^p2 p+ (;rTnz*6HuTPi,bK|eUvCȠ9E36h:"7bcΔ?;&/rO#۲VXuIަqd?N@>П NUwft0 '鬆o: ?\"xIgx}EdN)S|I/op_5$x}%&ߨ*xO]G>X| ΘMxd{o60t0d-3>G$+´l;,{'@l$F )<_z:[ڠ5tg WHboi(ΊdgVY+_[%g[ 3 *>?CblV<38Cʃ+ֻһ=F-F9EQY͓נmgɦ:׭#F$cuv[T|ut,v]\ŎR}(6QzbNűf:779,[S-!ۆDZX[Zj {}J]!(㦜- %&Si `kO*ekkAV*~<3-sVEs'qTwy]\Q lvLH3U obzDba2dau䌬 V]kv^qrn䪚+j@Q+R֝V ģn *'CƪiYDDTV#MR"0يKaɢ ̬{%'=r5jz "P8V[вb1K]U atJ{;Pjӧn-:0KMWdsQ ӞMiV0 lucY5O ]?tT`v$vW8Fo~uv+hC}zTuB36;x^T4=: 5ީ dZ.+T(WRwn(4:g.[ȣT|WƵ 6 >G_KxoUWH ;e6'D _ʘN{((Yn=t98{L갾)GwFDOQVNUdDf6]dnxlIWGpo|@ > Zgs3W0۴q }:• ܘ;PaֈPtD=sV{JSwt7Z]'AX|yS:XK>wL2ƻ}2t (.)Pg"/d=eWSY<a9h|c.eNF40VjTlRMuMP2w"IR0Ï"# K)#$WICj < KPK; 75tQ#m+ՅN«z0dRJW>9`i;]`t:ӡ"/'? M/usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. ieuf:c:h:s:yCylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].error initializing MBRCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Writing current MBR to disk.error writing MBRUSER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s: [%u] Rounding to nearest cylinder: %u %s is not a character device or a regular fileDISK_getlabelmetricsDIOCGDINFODisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?Size of the partition.BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinarybyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]aFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]@LxX\dpx|sl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node $OpenBSD: fsck.c,v 1.26 2007/10/20 18:11:17 sobrado Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor %s [-m mode] name p  Љ܉`܉Љ܉UGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstencapgatewaygenmaskhopcountifaifpjumbolinkllinfolockrestmpathnetnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, table: %u, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s use hopcount mtu expire%8llu %8u%c %8d%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: sodump%s: inet %s; %s: inet6 %s; %s: link %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s p_rtentry%-6.6s %6u %8llu %6u %6s %.16sInternet Protocol Family %d: AppleTalkInternet6Encap%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %slink#%d@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword:PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroUser-Agent: OpenBSD ftpGET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s GET %s HTTP/1.0 %s%s HTTP/1.0GET /%s %s Host: Can't allocate memory.[%s]:%s %s%s Writing HTTP requestreceived '%s' Too many redirections requestedError retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_getExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s p@ . .. pppAfirmwareFgroup9Gspwd.dbH protocolsIservicesJ disktabK fstab,L resolv.confML hosts,A .@..B . ..C binDmdec-3sbin-3share3C .B .. ftpgrep]fgrepegrepgzip]gunzipgzcatless]more] sedP disknames9D .B..E ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: dialer:*:117: nogroup:*:32766: nobody:*:32767: ort %s dir %s file %s Can't connect or login to host `%s'*?[]{}Retrieving %s/%s auto_fetchCan't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command.---> %c ---> %s %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-k seconds] [-P port] [-r seconds] [host [port]] %s [-C] [-o output] ftp://[user:password@]host[:port]/file[/] %s [-C] [-c cookie] [-o output] http://host[:port]/file %s [-C] [-o output] host:[/path/]file[/] stringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@Name (%s): Name (%s:%s): Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] @LxX\dpx|@8!8reloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node \`)">>8? ? ?%U ?0?ˠ7G*Wx|9iq4)7l.*âtaq:7&vF=C.ZLP3O/+Iu.aFP0OcreTzQHuK^]g|_*5#gx3w2=j`nN^ mY Y"mzV`dASm]sMFltbx.V N2+}uY=lՍ:IaŒMiϾ0u\vCF4>9@.r({"XGyRd>S(I$Pq& #PmtbtGyGt+~yosE persistent database - sleeping.EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.lease file not openlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll error/sbin/dhclient-scriptCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpNo live interface to poll onpoll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneCan't create socketinterface_link_forceupinterface_link_forcedownioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!interface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfsocket(SOCK_RAW): %msetsockopt(IP_HDRINCL): %mCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetDHCPACKDHCPNACK%s from %s rejected.do_packetoption %s (%d) larger than buffer.rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.cScpretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.eof in string constantstring constant larger than internal buffernumeric token larger than internal bufferbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareinitial-intervalleaselink-timeoutprependrebindrenewrequireretryscriptselect-timeoutserver-namesupersedetimeouttoken-ringexiting.exiting. %s line %d: %s%*c^ subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read (connection closed)buf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input filenewline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)%s is a directory (not copied).cannot overwrite directory %s with non-directory %s%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory eeecj l|e `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@|iitei$i4i@iTidite%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.22 2007/09/16 17:42:40 otto Exp $$OpenBSD: inode.c,v 1.30 2007/06/25 19:59:55 otto Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.32 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass1.c,v 1.26 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass1b.c,v 1.15 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass2.c,v 1.27 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass3.c,v 1.12 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass4.c,v 1.17 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass5.c,v 1.36 2007/07/17 18:54:40 otto Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: setup.c,v 1.37 2007/06/01 23:42:35 pedro Exp $ $OpenBSD: utilities.c,v 1.34 2007/06/25 19:59:55 otto Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddirbad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory list%lld %s I=%uCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld,%lld blocks missing %lld files missing phase 1, inode %d/%dcheckinodeINCORRECT BLOCK COUNT I=%u (%ld should be %d)bad indirect addr: %ld bad direct addr: %ld convert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS FREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE SUMMARY INFORMATION BADCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %u bytes for cginosused cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d NCG OUT OF RANGECPG OUT OF RANGESBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld NCYL LESS THAN NCG*CPG%s: NOT LABELED AS A BSD FILE SYSTEM (%s) WRITING %sZERO'ED BLOCK %lld TO DISK CANNOT %s: BLK %lldUPDATE STANDARD SUPERBLOCK %lld (%lld),catchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size is %s: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size is %s: %snewfs_%s%s/newfs_%s%s not found%sr%s%s: getmntinfo: %s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %lld%s: no default sector sizewarning: changing optimization to space because minfree is less than %d%% ioctl (WDINFO)%s: can't rewrite disk labelusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-t fstype] special %s: initializing cg %ld/%d siginfopreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %dreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %d bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each super-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failedmkfsinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0fsinit: inode value %d out of rangerdfs: read error on block %lldwtfs: write error on block %lldisblock bad fs_frag %dclrblock bad fs_frag %dsetblock bad fs_frag %dilog2: %d is not a power of 2 dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] directory ... $OpenBSD: compile.c,v 1.24 2007/03/20 03:50:39 tedu Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.12 2007/10/16 20:19:27 sobrado Exp $$OpenBSD: misc.c,v 1.7 2006/10/09 00:23:57 tedu Exp $$OpenBSD: process.c,v 1.13 2006/10/09 00:23:57 tedu Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'ae:f:nuusage: sed [-anu] command [file ...] sed [-anu] [-e command] [-f command_file] [file ...] stdout: %s ..."sed: %lu: %s: \%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be empty3  X+ ! \+ ħ ȧ8B ԧd; ܧ= : ! $ \+ \+ l9 8' @< @< OD <ܩJ E a 4U  a 4U ,R ^  T E ( T 4V <E DdY LR T8L \L da lE tp |F W _ -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$0H,Lt`fpcdslmȫn( p    Ȭ@ ج   d (` <T H P ` :T `h 8g p D | @   ĭ4 L Эd ܭ, @ 0   ( 44 D Tt \ l @   ̛  ܮ      $  < L$ X h x H hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD5Բ-++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():@ȶIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }Բ@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $нaܽc\ e(iSkl4Xm@CnLfT\bdulxpرrUsh vx̾xlet   8   (P{}T ||&&!()]]<>@ HC\    ̺@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}[]?*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. inet6_rth_reverseno errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: sscanfrcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s |Resolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_afABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop60<@8DHPX\`hltxpTSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2$4<nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.dbttyname_r/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problem0hp| ,8Pdp|(<Ph0hp| ,8Pdp|(<PhHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" b0b1ncdtscilcshssbpxbxfxoxtxdxgetenttc%s.db:\|:cgetnextexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Padstack overflow in function %sGMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3clntudp_create: out of memory clntudp_callئܦئܦئܦgethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~p t |   *              0 4  @ H  P T  t x             (8@HXx LdTpt  !@D"X`|de f8<#T\ tINCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/l"4"too smallsyslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log  $(,048<DPX`hpx,04JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding`p$@`|(l ; errno = %s; s1 = %u, s2 = %u; why = (unknown authentication error - %d); low version = %u, high version = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATHx,@Thħ ,@`t(<`|(@\t $Hl 4 H l        !,!@!T!h!!!!!!""8"L"d"t"""""Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired type0hp| ,8Pdp|(<Phxdr_bytes: out of memory xdr_string: out of memory snprintf__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)TT(a d0Tb @ptB ,ܰc $4Td AT|e ̱f DF  4`g <вh  HA4DXi tj ԳJ !(lHL 0@`m 8xn " дp HhP q $Pr "Xds !S !P$4u "lDpV w "Hȶx (`4@X A`Lty (z \з" x~ !8? `# hXl. A@| (press RETURN)... (interrupt to abort)X382@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxULv xl8s4m0poLdvlv,t`n0u@tu <DvD$(vx0v|dpZ@(8@PA`B(GC@DpEFGUVabceTfhiLlnqqr$s0v@wLxXu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.19 2007/09/02 15:19:25 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.22 2007/03/20 03:45:54 tedu Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.16 2007/12/30 13:52:40 sobrado Exp $?Xdlytx T    4 0({0{yy !p"#$%& '()*(+0,<-D.teh|,Tt8X pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABELTCXL`Lhp1te?^ K`)X T0 J N6 XWP4I $KNy85y9I< $K 0<J X< d # $3 4 0t ?@[\\,]D^P^d_p_|`{{|}}~:::;<?te (08@DHPX`htH}0@Ptetetetetetete,$tetetetete0tete$  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789abcdef  j$X|X X$DċH@ 869H9`9:9$>=(>0>8>> ? B|BC DlD|DDBBTCC DlD|DDB<I\JJtK LLDMM[ 0000000000000000}0)4*X*7J$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$tt$%@@\+  5؉ >؉ C  J Q Z  $_ f q44~ mi a  {n}of!NI u p + & P  P _relayd*YYRelay Daemon/var/empty/sbin/nologin2&_afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLDoj 9 4 S N  _ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin2'_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_relayd*YYRelay Daemon/var/empty/sbin/nologin1_relayd_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp&fa#A< r j %  G B o j ) $ J _snmpd*[[SNMP Daemon/var/empty/sbin/nologin2(_ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_snmpd*[[SNMP Daemon/var/empty/sbin/nologin1_snmpd_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin1_ospf6d_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID y t 5 0 @ ; nobody*Unprivileged user/nonexistent/sbin/nologin2)_ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_ripd*XXRIP Daemon/var/empty/sbin/nologin3X_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 c ^  M _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_relayd*YYRelay Daemon/var/empty/sbin/nologin3Y_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin&vm,%KB f a   p k ( # N I n  n _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin3Z_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root \Vpk-( Z U   } x 7 2 Q Q _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_snmpd*[[SNMP Daemon/var/empty/sbin/nologin3[_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplf% >9 J E   p k * * _ripd*XXRIP Daemon/var/empty/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_ripd*XXRIP Daemon/var/empty/sbin/nologin1_ripd_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerdip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs . ..chowndhclientT9 disklabel9dmesgfdiskfsck] fsck_ext2fsfsck_ffsT9ifconfigT9init]mknodmount mount_cd9660- mount_ext2fs- mount_ffs9 mount_msdos mount_nfs9newfs newfs_msdosping]ping6reboothalt]routertsol$umountdhclient-script#!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 sk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b  ... ... .B.. .B ..misc-3keymaps . ..mtermcap . ..MAKEDEVconsole tty memkmem}null}zero}stdinstdoutstderrksymsdrum}klog}bpf0}wd0a}rwd0awd0b}rwd0bwd0c}rwd0cwd0d}rwd0dwd0e}rwd0ewd0f}rwd0fwd0g}rwd0gwd0h}rwd0hwd0i}rwd0iwd0j}rwd0jwd0k} rwd0k wd0l} rwd0l wd0m} rwd0mwd0n}rwd0nwd0o}rwd0owd0p}rwd0pwd1a}rwd1awd1b}rwd1bwd1c}rwd1cwd1d}rwd1dwd1e}rwd1ewd1f}rwd1f wd1g}!rwd1g"wd1h}#rwd1h$wd1i}#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 random wskbd0 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; hotplug) M hotplug c 37 $U 400 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 hotplug ptm R local wscons pci0 pci1 pci2 pci3 iop0 iop1 uall tuner0 R radio0 audio0 uk0 random lkm tty00 tty01 tty02 tty03 apm R crypto pf systrace wd0 wd1 wd2 wd3 raid0 raid1 raid2 raid3 R std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi 08`.G<  .G`[~ [~.G`@@<@TU .Gxb.G?A .G .G:.G:`[A.G'!.G'!.G'! eKC.G ".G ".G " E g=A.G}".G}".G}" ʷ6A.G}".G1O#.G1O# eA.G1O#.Gl+.Gl+ ˼43.G45-.G%.G%!.G.G.GO!.G.G.Gia!.G.G.G#<!.G.G.G8$!.G.G.GBnl!.G.G.G c!.G.G.G.!.G.G.GڢG!.G.G.G !.G.G.GR$nY!.G.G.Gד&0uy!.G.G.G&b^!.G.G.G.ha.G=o.G=o.Ge,|!.G=o.G=o.Ge,Wa.G=o.G=o.Ge,!.G=o.G=o.Ge,gCa.G=o.G=o.Ge,EcO!.G=o.G=o.Ge,y|,a.G=o.G=o.Ge,$!.G=o.G=o.Ge,'a.G=o.G=o.Ge,~!.G=o.G=o.Ge,Na.G=o.G=o.Ge,;!.G=o.G=o.Ge,"Ga.G=o.G=o.Ge,KE!.Gj .Gj .Ge,=Ba.Gj .Gj .Ge,CwK!.Gj .Gj .Ge,ja.Gj .Gj .Ge,!.Gj .Gj .Ge,ja.Gj .Gj .Ge, I!.Gj .Gj .Ge, :-a.Gj .Gj .Ge, Ny,&!.Gj .Gj .Ge, Whza.Gj .Gj .Ge, Ht!.Gj .Gj .Ge, Ja.Gj .Gj .Ge, f]!.Gj .Gj .Ge, 2a.Gj .Gj .Ge, >S!.G¢.G¢.Ge, 5)e9a.G¢.G¢.Ge,Ow!.G¢.G¢.Ge,a.G¢.G¢.Ge,o%5>!.G¢.G¢.Ge,3=a.G¢.G¢.Ge,t)#!.G¢.G¢.Ge,wla.G¢.G¢.Ge, )!.G¢.G¢.Ge,jga.G¢.G¢.Ge,a !.G¢.G¢.Ge,Q:a.G¢.G¢.Ge,n!.G¢.G¢.Ge,O4a.G¢.G¢.Ge,:!.G<.G<.Ge,F~a.G<.G<.Ge,ʊ!.G<.G<.Ge,W a.G<.G<.Ge,K!.G<.G<.Ge,ha.G<.G<.Ge,[j!.G<.G<.Ge,SMa.G<.G<.Ge, !.G<.G<.Ge,%&a.G<.G<.Ge,^e!.G<.G<.Ge,d!a.G<.G<.Ge,ȿ!.G<.G<.Ge,Na.Gy.Gy.Ge,N+!.Gy.Gy.Ge,~a.Gy.Gy.Ge,+!.Gy.Gy.Ge,O2_a.Gy.Gy.Ge,Ј!.Gy.Gy.Ge,'a.Gy.Gy.Ge,J!.Gy.Gy.Ge,zva.Gy.Gy.Ge,8!.Gy.Gy.Ge,Y,a.Gy.Gy.Ge,(!.Gy.Gy.Ge,=a.Gy.Gy.Ge,Yai!.Gy.Gy.Ge,0a.Gn.Gn.Ge,t!.Gn.Gn.Ge,)a.Gn.Gn.Ge,lh!.Gn.Gn.Ge,a.Gn.Gn.Ge,p!.Gn.Gn.Ge,?Zϥa.Gn.Gn.Ge,%L!.Gn.Gn.Ge,4a.Gn.Gn.Ge,/!.Gn.Gn.Ge,9[a.Gn.Gn.Ge,DM!.Gn.Gn.Ge,4a.Gn.Gn.Ge,FjJ!.Gn.Gn.Ge,VTa.G1.G1.Ge, ~m!.G1.G1.Ge, ya.G1.G1.Ge,  k!.G1.G1.Ge, ;;a.G1.G1.Ge, y!.G1.G1.G, 1a.G1.G1.G, 6U?!.G1.G1.G, Y4͈a.G1.G1.G, <5!.G1.G1.G, Lc a.G1.G1.G,<`!.G1.G1.G,3la.G1.G1.G,<!.G .G .G,(DM6!.G .G .G/' pBu!.G .G .Gl) inBua.G .G .G,G!.G .G .G,8a.G .G .G,ӎ1?!.G .G .G,!.G .G .G ?c!.G .G .G ?spa.G .G .G,!.G .G .G,,:a.G .G .G,ҧ!.G .G .G,a.G .G .G,9!.G:.G:.G,N~a.G:.G:.G, !.G:.G:.G,֟!.G:.G:.G:<*ys!.G:.G:.G:(dh!.G:.G:.G:(a^B!.G:.G:.G:(C^!.G:.G:.G:(g=!.G:.G:.G:(JvKr!.G:.G:.G:=ge!.Gs.Gs.Gs"!.Gs.Gs.Gs" h .Gl+.G} .G} hF ;"1Afh-i\W~# il c >A\{9!^ . ..MAKEDEVconsole tty memkmem}null}zero}stdinstdoutstderrksymsdrum}klog}bpf0}wd0a}rwd0awd0b}rwd0bwd0c}rwd0cwd0d}rwd0dwd0e}rwd0ewd0f}rwd0fwd0g}rwd0gwd0h}rwd0hwd0i}rwd0iwd0j}rwd0jwd0k} rwd0k wd0l} rwd0l wd0m} rwd0mwd0n}rwd0nwd0o}rwd0owd0p}rwd0pwd1a}rwd1awd1b}rwd1bwd1c}rwd1cwd1d}rwd1dwd1e}rwd1ewd1f}rwd1f wd1g}!rwd1g"wd1h}#rwd1h$wd1i}%rwd1i&wd1j}'rwd1j(wd1k})rwd1k*wd1l}+rwd1l,wd1m}-rwd1m.wd1n}/rwd1n0wd1o}1rwd1o2wd1p}3rwd1p4sd0a}5rsd0a6sd0b}7rsd0b8sd0c}9rsd0c:sd0d};rsd0d<sd0e}=rsd0e>sd0f}?rsd0f@sd0g}Arsd0gBsd0h}Crsd0hDsd0i}Ersd0iFsd0j}Grsd0jHsd0k}Irsd0kJsd0l}Krsd0lLsd0m}Mrsd0mNsd0n}Orsd0nPsd0o}Qrsd0oRsd0p}Srsd0pTtty00Ucua00Vrd0a}Wrrd0aXrd0c}Yrrd0cZwsmouse[wskbd\ st0]rst0}^nst0}_nrst0`est0}aerst0benst0cenrst0dttyC0erandomfsrandomgurandomhprandomiarandomjwskbd0k apmlapmctl dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: onf resolv.conf.tail dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done /tmp/ttys mv /tmp/ttys /mnt/etc/ttys questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname >myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.c . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD. At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C, but exiting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_ifdevs() { ifconfig \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev" ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" "$_parts" [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { get_drive "CD-ROM" "$CDDEVS" || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _d ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask "NTP server? (host, 'none' or 'default')" none if [[ $resp != none ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $resp != default ]]; then set -- $resp sed -e "s/^servers /#&/;/#server /a\\ server $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf fi fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -n $CDEV ]] || return _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" [[ $resp == n ]] && return ask_which "speed" "should $_d use" "9600 19200 38400 57600 115200" \ $CSPEED [[ $resp == done ]] && return sed -e "/^$CTTY/s/std.9600/std.${resp}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /mnt/etc/ttys >/tmp/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $resp\nset tty $CPROM" >>/mnt/etc/boot.conf } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=43 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the di0123456789abcdefZf)г0g0h0X0Zf4$,x.,04,9,Zf,0+8,l,,,@",Zf111ܟ1X11Zf:|o011ܟ1X1i0؞00Zf<8Z0Zf+1Zf,\0Zf)9,1ܟ1X1tF,Zf9,1ܟ1X1Zf11ܟ1X110;XfZf0)@:0X;0@ X Xd$``[fd[f]f]f]f]f]ft[fp[f]f[f[f]f ʚ;5ym8@ E8(@AAA==(A*[f[f[f$[f [fL[f,[f0[f4[f8[f[f<[f@[f([f [f[fD[fQ ]f]f <l<l<l<l<l<l<l<l<l<l<l<l<l<l<l<l< l<l<l <$8jX1<$8j1<$8j1_f<1D_f011<<$141P1181d11i9i9i9m9m9$j9m9 n9\n9ln9|n9n9j9 j9j9m94j9Xj93>3v<D3pE3w<I3I3w<0Z3Z3x<e3y<l3l3x<q3q3Dz<4}<|fiD}>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyą<3343$3(fX;< <<<<3@34<<8484p@4?4,h4|h4h4HD4|4i4h40i4i4n4tm4e4j4q4Xp4USB audiouaudio`<44$4L4l4D<fĊfffff,f4ff\fdfLfff  |ffċffff܋ff$f fLfTf5<A5B5|<<,<# # `<<$<0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ܥ<{{<0<(66H6 6H 6 6< 6(66@6T66l<-6'6)6*6l,6<d6626@4646p56p<A6D=6t=6>6(@6<I6xF6H6lH6$I6|<`N6<D<<Z6\$<l6n6p6t6u6$u6|66d666<6̭< < :5hv1! !vvvvvvv3 P q q2vqqqqCW 2D k"{"{"3" dAdAW 2]\ \ ;  $<4<D(.fDF4fDFn9DFDDF9DFKFF0  Ht  >ff  B>D H$4@0t&;%TFkS$`^p#uL8$t5$/ Hy6S>:><1'(%p99"*4-f9x/|F#$ax3&,i6L}H%Th1 I4)<+/66K>1>,"P8N9l'z91E5D*H^$%i8U>xc&<6dx64af\**l&;'> *\8 v1l"H>)"4M%\H|6$W5>cd5Ln[+w)pt>:&(D40dh%d,><);<kff H97T) 75K>C1P "^O6j$\td4L!`)<@+0Z-D,@%h*4 8#Dx2<#48<4(<=> MI'X̐9d/1q]D>6(34Xk\+#l1* X_5.~$P>$"!7 hGH>P <bx"|rl6xX;0D*;><x7@@#L 3(<~#<<$$\0#fh2*)|-98k9O)d1n("5d8Z07%<̞fA98H>"6`| d:K> `(Q8Q',,j53?j LjX$'jC" zTjXj%h4>d&$(f\$2L0&9!d3'/< ( 0+ f* {9; `>J \K-Y #Xr 2 Xj9 G> `W$d *p f (| T10 hj9 *p 6# |4T. dc1T< U4Q j_ "u A-< d# )X !2 * 5/ x  df  $ XC-8 @3`1 !? 8S ;`o x: | W>( 6> 4!0 k :(l [8 Tk , * z9 pW>* :1 lA *Ha #Dq 4 7  4- T, 3 0g'0 ؆&0 l  \&h 8 t6 S>x j' <%H4 af ; d6H jX X%`c "x H# x{#@ к6 \/  T$P 43\ 7> : Q1L(x#4! 2Rj:t&E,#N(XWT5khj /`$|.p$Xx2tz3\O3H%t9%60D A\:K>`T%H^t4#tr+%p7 2L*D80%P8fr7d4"C4Xx' e4X!$f6Lp+@4MĢ($\2pT>P4p=#̃:,#d%=)$TL7^24H>4"44-Xk0$9,)*8M)(DW<`6pLjzX%Q32Td& "/<!( %2 s+H1>*(56i9B-O\ 4Td 7v($@b+L=#H(5d';w2(lK/t8(\<$`f50)=> ;h#E6[P /,i' tDj{<>*Dl(P(lDE$d`#8*  $@ `jhf#5 XCxZ6QH/a3@v*!x &l #\:N $>p1::@|O>k 6':-'d&</l/81p?F4Td%Tbts9hx#tM \L.)('-xQ$0ĵj`#,fL!>Xt3$Q8}9.Ċ&h6(6,A()N܆6x`H61tjP#%{lc5l4K>(h+4b&x%d6`&+>I|a5Q6@`45md&4$K>e6L53*4p#<X${3j@!+ \L2D/"p>>/D"F$OP5T^01Xlhfv/!44)d($lP5( 6$>x7>8C%j g!H ?:+2\F0fSkat#+xm4%(@x67tS# lo9Ȭj#87448ȕ*">L+ s55̿3Ap@-8N,!`3Lkft-4 l81P5O3%t.*T!P%T-j9jB0%Nf\*8q0jxЏ%z'toj@f@b$p>>.%Pl2i9k|#T%h4P9f@LM>OLz*b %pL$841>lQ>x-T)832@4<> d6(Lj!jP/T_9>HjG:>Q6[6qK>K>4X3@2j*2T##,16Tl *2.T<-K,N>YF6g3$K+0T' 5P1L#1>?-4Pj( 0t7< l(04&'24?7B#N038[k c>w'6؉/djT68/@l3H+)T7\;6 C5 )<) f? k0H ȵjT ؎:] h6>h 5\r H>| 9 x#x T5  l <% % 3@ Z/ `j $# 6!5!-X,!=98;!6I!14Z!h*w!T0*t!X9\!`)5!Paf!$!xJ6!8f!4{3\!3"~%"f$"$L0"X$;"$D"t#P">i"`!w"%";$">"(x%`"4{%"h4 "P%x "]f"4"+"7,"1\#m9#4&L%#̵j-#l$6#&/G# +4U#%i#2Dx##p#j(##4# (#5#(#`#pM#@# "$#84#$ܥ!$5$H7lO$)b$G6p$5{$ a4$!$k$%<$g"D$J'$ ,H$"$6%($2 %K#%4p8%|F9$J%lX%ln9k%ks%P:6%@f%@Sj %k%Pl%T3%,%(7$%ܢ'%l5%$( &;9&,;.&<+8?&إ$(O&">XV&#,i&*8&]2&m9&+&"&l-l&I6D&L2&9&47'K> '<43'=> D' 4LX'̪%hl'A#}'6'Ht+@ '|('L4'%L'1>'О5'*'&P'D/ ((`( &\(l& %(i:.(|b%<(#J("[(Hn"i($2Xt(d54(*(b%|(/(j(XA>("(h"-(2>(#)"<)>&)m98). A)24PT)a2de)P(v)e2t)>-)*) 4L)j)d'x)x|')Haf)0s#`)&`)LX!*30*.$*d#/* );*5N*huj[*7 i*Z6hz*[f*f*5`*Tj*2* *6d*#8*4D>*H$ +LK8@+|)x%+| 4(?+(0lO+-+_+#hq+/0+@++h"4+$5+@j'+ f+>+p(74+ 5+\y1<+p$ ,",!-,`R h?,T9U,!%`,'k,t5x,L&,2>,` ","!,l,t5,L),`'L,6`,2-k-е),(-ԁf2- C-h6`Q-t!Hd-6v-P2d~-'(-H4t-&-G%-%-,#-."-I:-r$0-3.k..'.$>;.&%I.jQ.<7d`.E5m.2p~.hO-.(6d.T".03.}9.$.#l.,4.%8/p[/l/0O>L0(\Y0X#l0 #{0^5$0/0480 l 0ll02H0X>00 0l1>0i91h$L1 /1D$<1$@F1"Q1d*2b1fm1/|1$lx1U(`121Y*1<.# 1<>181u8L2H>!2j02 (:2.O2j4`2lr2.}2X-$2|32 l2|j2"2(>2 '2h-2);25p3,h4P3]f3W '3p)'23"DB33<"X3l43Dd-3Z6L36@343K(3'3%T4>4 7.D4?>14f;48$ N4t#`W49(b4$<i4T/t4df~4h744j4E-X46P4P)4K>4'%d47H5 5\44'51$=55S5Ԭ4Ha5$% o5<'v5p)!8~5 5Q>5(5xf5W8(5x #05t 5006' 6Q6T6i3*6 R$@:6"F6U&U6<6$a6ܫ4o6L[f}6B.6O>6п36h1|6_f6^!6_'x6$\6,67j4717P&L 7+l,7x2`G7<994V7X7i703w7f7N>7:7,7`j7ԥ'7#7ԇ5x7H37,o9 8PC$8X$8 O3.8t/X:8;8L8" a8 l\i8">o8fy8`l8E.8=#8 878PU#`8848$(88l$8t,  9*0)9.79ĉ:?9X+4HN9i"Y920g9$['Po9XO#y9X)\9885996`9 *9H* :Hr*| :0)+:f3:" E:,n9X:4f:\25p:1Lv:& :L%:LO6\:j: :ds':6:5#x:p#P: #0:6 ;X>;.#;><;4#,X;05b;C5q;(f|;U>;/.8;?5t;). ;\ (;D;<;t4`;6 ;Z+<w2$ < )<]& #<,(T,<&!5<DlB<c+PO<(|W<d)8`o<5}< `6<1D<`#<E6T<:<|!5l<P&'<\#\< l= j =83=j&=;>(0="p:=>D=,8L=%X=#<i=P h}=2\=4=d)=3(=Q$0=5>=0h=P'=|/$>.>(w"&>< $2>'d <>HK E>&N>>X>$*k>5\z>"0>]->4T>1>s)>!>Tf>&>3(>A*0?)?D(X$?8$P2?`>:?_#$H?E5@W?K>g?j0q?%|~?80?2(?& ?@3$?3?l*p?l(?4[68?3?&@' @8<@Ar'B7XBd;T&B f9BA.FB!UB9>\Bl2;BaBj#oBܝfxB"B5>BN2(B|#B$fBL>/XBxl9B8Bi7B)8Bl CjC̚$C#|)C,: 5C*/JCtk[C5dC7>kC83zCQD>CX%C0S"CX[fC*HC.,CX+C\&C4$( DLfDx>DXf*DX525Dp!FD: RDtflDt,|DD,XDr)Dd%D 4 Dlz6D5D6/D8D3HE`"- EW!EO>&E#$4E8!tEEx!4WED 3T^E(jE5xE$E(>> ED(6xE,EDK>Ed"HEfE4c:xE{#4E,2`E(HFO> F,%F5&F,D>2F( 8CF03LRF>HZF$aF(fkFx64tF1> F4#FLf F&|FU!FLafF: F l0F 5.FLP!<FRjG' G8G6*G5&8G!EGD5%`MGD5x^G"gGZ3yG'G "4G`3G̈.Gt3@G؃7PGf G*DG9H8H$6)H~9/HH%0;Hx &GHb6^H ,jH<5tH1HM9HfHpM9HH66`Hl5`H`2; H\$tH#Hl Ix8T(IH6D4Ix4FIy6ZI,$aI *|yI4, I%I.+4I'@Ih5`ItH5XI4V-dIP*hI)%Ix2#PJ Z'J*!J(P6J'TAJhjJJPf SJ<+^JЙ: jJ1oJ+*dJ/DJd_%Jh]&JK"'KDA4t4Kc:KKl4lUKdj\Kp"pK0&7@}K4K &KT`#0K7>KRj@K"K82K3xK`A#KЍ7$L%LmjLDl'LlP>$=L)xSLlD>_L@&dL&oLP#zL0^jL6Ll9 L3L`"2LjLN'Lp9.DL+'xL0'Md/#M #-M8%l6Md"DM8&hKM#,cM,1qMp@4}M#Ml/<MXp!HMP-lMpE3pM#MJ>4M#M9M $ N$\NXo5%N0x4 ;N5FN(2XMN(%<\N'gNL>pN +{N"HN3pNPA(NȺ#NE NfNK>N1>N89#LO$+O&-O`$88OlCOh4MO3UOMj]Oh$XcO,J5mOȥ5|O7O 1 O.Op"0O*O"#O80OеjO<- Pl}7P4PH-l(PDR>4P5HP0$\P<>rPp&yPZ(P%lP8$P#XPd4pPȬ2PPQ% #QPl93Q1DJQ,(XQ"<bQ5nQd5.\{QX"Q5Q lQ%(Q )HQlujQ46Q;lQXa6 R}.PR71RH'P?Rj7MR4M6WRjdR!8vR|1>R|(PRp% R(>Rx.$R@?-8RL7>RXy2<Rh2pRpM2Sd.7 S(#hSл%1SdW'D=S5MS0 XS$ $jSi:rSL5t}S!S0X>S@.lS*Sd8PS5<ShfS 'S">Tt#LT\E- (T!=T*5PT30eT 0( qT9zT0~%TH2%`T:$T|P9T7`T #T1-Tt8%U1U0<> Uxe25Uȳ)BUn#xUU3cUlpU ,TxU$\UH%UL%U^'U U,U`6hUv3lU6UO>Vf"V)0Vf9V]fIV *]VT3&$bVdp5xsV"HVl8V #PVkV#<VlfV (V~9VD7VHlV%V{9 W5W"'WL!7W48HGW*^WW3PnWXjuWX" WRjWfW5Wl1WD&W$tW2WnjW&HW# X4lX 0h"X .\-X#19XH$EX$1YXp(iXY$}X6XX,X),X~"4XlXD#XZp1Z3Zd"ZP9&Zc/0ZTN:(ZjZ@U$ [T,,[7,[M>*[)5[njD[P)S[( \`[kq[ 1 [w&[hA>['[8[̃f[E1([';<[;H[D(\j"\("\5t4\.?\{9O\$V\(.e\7Du\1+\ !t\$`\" \l6\L9\0M> \l$L\,5d\X4 ])$<]0"8/]H7x:]H-#hI]D45XS]8?:^]4(i]mjxw]T1x]D7']&]A-<](]7 ]h)(@]:4]@A+]/@]f]'^dX>^X>"^P.0$/^4j6^$P>$F^5>R^tm4h^ %s^ 6 ^н3P^(3^l^48^%(^1>^8|"<^3_`[f_hV>/_La(7_F#LL_q9T_d$LZ_Rjf_8+4s_|4_h3l_P>$_=7d_,*@_~#<_-X_J$_t'`Q7 `"h`X9"`2$+``f:`H PV`(,<e`l[6Pv` 44`h+` a%aH>a#aH>aK>a,;+Xa@(8 bjb[f*bv/5b7HJbfVb(' dbX &\nbL*xbpN/db~$bs(bHf b T2b9)TbLj3,bW8 c3t%c8/4c( 't?c7&DQc4fZcxG&hc%,vc*$\c>c`+tcLjcl c*cLlcto5pclc k1 dT9"ḋ7X4d&0e8&ePjeDt'eV>fxL'!f|/0f3XDf)PVfB5xef jqf|9fP&6Tfܷ2Xf9f\58fp30fH'fDT#fx3Pflf)Pgj(x gfg̎#<6g )>g& Cg$Pg`2Yg&(DegL>|gD*g( <gkg( hgx*gxe6\gX$xg, h!hH^jhf&h`f/h4?h#Oh&`Yh;"mhD6h*h*8hL2hL>h$1,hXfh$/h+iԵji#(iP>>i/Ji0i4P]i2fiH<&vi25hip +i3%i(fi87HiN>iP77iH'tiQ>i<,j  jTA--jk7jjJjl[jĜfdja7nj`4\wj)|j`b/Dj]9Lj~#<jhfj3j^fjh#j&jmjjPl38k<: kjkn4d,k'6kjBk?4Pk{%0ak?0xk-(<kb"k>@ke3 kL4kH %k(k&|kll& lxy5l|[f)l/$5la6HGl|4%PlL;&`l2>jlRjulHV2lw9lJ8pl)l<%lXp#l"9tl8Xl,(5 mP8h&mT>-m8 789m?,Em&tOm#XhmV>~m()(@mp7hm$|64m2mI7mz.m0/m`% m-n%8n7nP),nPk9n2>HnlRn l `nT)wnJ"LnL>nfnM+nH>nT$n8nO>$nJ7nC&`nLj:| o@. otnj"o-6.o\5>o4h-pJoO>]odfoo(lzoj9o?:o,%Loxfpo;0ot%Do>o4/op*0 p5p7(p$;7$?p*hRp'^p<60ipN6Tvpf}pt_fp0">p06p00dp'4p-;<p&lp,7p6p:6qr#qR#&qx |3q=2?q(XKqM4bq>"hxq؞0q.q@l3q,)q#hq$ xq\jqT( q8jqtfq/r3#$r8j rDl*r.P7rXL2Dr,Zrt"jr4pvr> r70rk9r\1rjrt$Hr2#\r@l4rTP+s#Xs>7p$sTQ5p5sW*Ms2>\s7hsP=> vs2}sN#Ds1s(,|s<\/sv"hs h6s q/sx>sP2sfhs-1Pt`,tj#tصj,t>5t* Et7 Zth7\lt&9xt5t(e3|tV.`tkTtltP>$td"t'%8t.\td(4t$Tu!xu~%(u0 7 6u|68BuE- UuH&hbu %lu2>~uK>u9>ut*<u8\& uju"6\uf uܾ.XuHR>ux'  vd7"vD>2v &@9v8Qv%(D[vTk_vp!1lvdlwvG>v: v04Dvضjv^.v( !\v2 v2pv~$v$[fw?#8w@> #wL2:w/Hwz8|Qw,"awd>xwԵ2Pw1w&\w$wH>w>w&\wjw#w7x 2|x6h$xHY66x @3Ix#Zx$>cx6ox :>yx!x~" xjx$/@x*Xxdfx$ xs4\yH> yb" y )# *yx 54ylJyp(Ry0t#\y "ky,xy#8y 6y4\y@jy(Y(Hy"py=> yH y܁.zp'|z(l9(z>3ztN tAz5IzPj+UzI4fz4xpz [fzpd*zlz %z4@z5\z4(z'\z( {""{F60+{C-9{&0A{Hp"U{3k{6(u{ 6P{6{ ,{T>{#@{tT#,{#{7D{41{]f|0+`|c9|'4(|"X8|+@|8}'L|h5 [|(de|T,r|>~|Q>|$|`f| _f|#|̻'4|l5$|.(0|.|'X|j }&t}@j}`1(}"H<}K.LK}p2,V}Ԇ$d}$ > {}!}$'}84}x1}-}|!|}t5\}j}l2(}l}̻4H}!H~,[f"~PA-/~ D>~/P~z#4^~+Dn~>*~9>~(6X~,2~0 ~ * ~$5t~>> ~@y!) %#<" 38. :fAO.R j_F9mD6tl{" |z3\$j9x'2D- *(W>"x (|f034=Q$Il9@d4\q#d>w4H'd̀$8܀#X l#4 |kh1%1>3" C6PLw!g"~j \M98+`jp"1W(āDj́,-Ձd&܁<> tF7*2!`j, 793pLt&\/+i&@|&`H$ 3u9de9{9̂ .ւ$ނ>@"L;H2+0,t)L7 => Hd6#$`p3dp>uT/0L2 @-P&44f<3fă|E*<كjة4\&Hl >:(# 48'@p.O&V#$ckXr4 ̅f^:*˄4.lք,(@߄e,|30"* 8jp5D=$4#$K~!bt=#t8 |<$'d|"#@4H*\=7Dž 3ӅX(0݅8v(1p j9%0& ">="Od>` fgܟ1|v9|d7`V5+40d]14.†<"5Ն.0 ]84`1!, \/'E&OfXh+7eX4nh&|j84@T[f-,x+h^&LJ.ԇ̬%߇2/P't=%l` D9 4h1@W0,Ag*_T'f`!w /4r"4a3t+w) ˆ$h͈H%TՈ$"0x96<h('9)nj7 PC7Z1f((r#De14XH>H/,">O3$Ӊ*<LR2t*'!Xp4)4)1$@?n9R0,*j0i!~46,X28n9,K>ӊl/ފl$xA>(.4-\y(:X8'A(j%M8: ZTfah'n/xz#x|'T4Tj%8|;:|6>ɋTl׋x!|9P*j)!|S963Bh%,OhjVpL(c@I"u@fB6|;3x>6,5$"4Œ14ٌ%(#\4|l0lP"(f54@,LK lS&DaP!p#8n6f 3,d%TԒ!ύ/܍\# +;x.|F7X |#-,(W$@7+$?6,J/TX>`2\g,u[54w3,D f/ ̖f,$8Ǝx}9܎ 4t(Dk\-:)l23$?%+J|9^0#58ndfx.,dv"4X"t ) 0%!Ώ|-(8&b5Аkې,I$T$#@uj tA*0(&3$D6R3$_Xf2|s.$\9D(xd9x),j$"Hӑ9!ݑP$T2 @x#T"p'5<$20>95 F3X[9.i%p%<| fXȹ1@L7<"Q3͒M>ܒX6> )40=# T H@14* \&1$9T)TI(V:>^"Hr%(D{B!$/5X,Xj~"Lb"֓i T44P2ȝf4((ؗ.:HjL-]*vRj/7,x7Tx6t4.##Ŕ(Ҕf(ٔ#Xt6U68("1H/X&07H5(#?7RZ.a<1x j(d<$xj>|38ȕ%ӕ$G",N&B.( 1*#d#41k>I9dOxj9^>s2x-*H8D؇3ƖL6֖\1p/0,h`L%dc9h/,88>,*XH#<m 8D}4XH 4G8H5d)h>ė<> ӗ:ݗG&xK>498-<#$(`,DB.@: -N$&t\D9tDZ64j91k\,$y%Ø1%Ә:#pޘ!t90l&h P1!'+$|4 h#>n!S4|/\3i42z.!#4;:$(0@04ř@1,͙\'֙&ޙp7418y1,.X.*@(T7T%4=,.LL&-Z$<dM#do@>w3@x\&ll 2$8&$4Lɚ(6 Қ5> !>-)<> fkH"t-<- )T4ĥ'? l H g'P&|Y$8<nX3t{_2#-TL&D-P"8Û- ϛ(pڛx!78̑f P5X9#0,2("'l-|6:U6L 2_${( j4)v|o0 P&l\d9>`>0ÜT(,̜(@6ٜ'(0>(ж*pHj"dj8.45;#HP!-]5h9u<)0e(X7 7&Hb3̝*/0.)@(';5|/,d8L=tlL3 SD7(`X04kT%@q؏2z`6(6'3Ӟj9Hj1>ؒ7xm((!&*\BxfJܭ#]#t`k&#0(W80288b2Ɵ3hI9q2 K>t)2", (v6 O& @8Ϡ,"4ߠ!*/) 9ȉ7%d.2[&d>(#8^,j9#y + 60 2R3$3p\.ɡd,ء8Z54?5Du3-t\'))(9@*(@C%tOx5#d\fm *44L*(X&ȧ$¢(\&͢H6ڢZ-#j c580#4H1D/*M6>bh&o%,}<; f:(|'L"2ģI28֣M>X*dM>%$# L& f9'187>K )<Q7c:k! {D">"XW7,54D6\ä$.(<Τ)3(47< X5h!x#<'D,: 9.5\DZf4P6e 2}X$p!@/3 &Υl>P٥hc3*L40l) 6`-@#>MjI~"ScD>jljt,.}=> x)<484E(\˦,֦*8$D6Hk!#.l/7f8Eg#WL)$d`>mj'tH9j~92>d3çD[fҧ&ܧl6;>$1`hf" )H-y2<7p#J4LVh,` M>o|)\y"(8`2<:>G>5$|9Ѩx)ۨ$X["L5x%p 1D:>-hy95X&0@ܥ#L<$P\X-j(x /(Hx> 1H8684ȩ.X֩08\f2(14`E#p$&4/xj3X8,T@t)xHȯ'tMldU2xTM>5>B$$3#p4Pê\lΪ.ݪHI- \1>H<7d *4(|9(#d4|9I 8ZB5ix"-u*T06I6 $jL:hD(ū<& ѫd(j\&L3j!t"x-/ -+p> @J7,U6,`Ж6ix^#"+)TK*ì\4ڬ6>uj*"x7e($3I Mj\je #pT8D5-5\2.@:>ȭj0ѭ3Lح3d>ܶjo99LH!"p2 846>5<H$Wi4<n"0"L) o9kǮ-Ԯ,-(j<kP%t(f9 'i:: *& 2H>;&lCjJ>ah&j,<>tL68p4-lpV>xu4¯p[fѯE- tu9$ 440f̌#0("L6D%W+> aT}9x7,n9:0lf(H,7ð|3ϰ<l(6"&H'x#9)"L>x"lHG>RT-(d|5q;>|&\6#("\!d±Pjͱ4!f h.(H;. j0A#""\/&6`l:H7Ft%(DQ0f^H5h=> z/I(%,A6 ]fҲ$ l8+ 7("0(7%47+6k84S !<ed1$u6L4D!>`+(<0"#ֳt_8lu" ;6 %*"7,3+'h>kV aE9y\$3,$M>R*HC*Ӵ4ߴ)%4($!\3( :@Q `J\3 [;lq2>X7,.+,)<7\1PƵ*(Lҵ`m'lڵ!4L8 2 -)x(@2q"C6S6.D`%tp$!`lM3#p#t5h-C09l2<RQ>ajhS,xxkL>> `<5=> 2@U>Ҹ7>ظ%\H `24/k)p;xCL-Mv9[4V5iDfv{94^j: t: 4(f9J7,̹K> 7@c6(j[f56\N'C 4dTx)`L &p8-;(TЀ/T _8Tt/0{/\.#8˺\.ֺ0>|_&tF,o9($D+*pC PR&\16p=4}@5|kLjp!(x|1&ĻXkһ'ܻ $l*8X"4"@+H$6 5C&xLb2h[\fj0(,y2># :aflr,(<: ɼho-ڼ96Th#L /*;<Ѕ9#-(09,;n9N=: W(3`dP6{6>08#4HE"Ľ "ٽ1>=> j: l387$a7t-5\8lD1>Q %aTjj2h|D&3$`/hXM>>ƾ݅=̾),ھ1,d/T"67l3(R>Az%tPD2(efoP,}*5tj'6<Q54j94$,$ǿHa&ѿ!@pk3#x6Lk9'$:>.\$4C2@S, 5\1Pq`l}#4%<dk*H|$h8oj8_#T:P+ P;|3#L`'1'>!SZ.H_x{9sLx2D}lm9d"P|9l28[f$8t:f<' )D -(<>4D&|99M>G}9`T4dm4.v ,pX)"X! 7D$2tp#HHp!7F @+5+H2@2!\@!W,A($eX#|,XȘf05<3'dK>4;>d$(6<5P0hLjXW8\d6+P0(:jB0!S3Z=+Thp$4yj2Rj4.l 2>Xv2xa3j\7>P7(L2{#4]f,H[f3,/Fe- Uj`=(ji9~fW'LB7-N+R2X7>$3D4<> 9#\.+8(6Я2DH)HR #`2Li{#0uf42Tk4%|2(6L2X 5p965)lT6: 8B-td'4,-%$57C*DZ!h!vD_'}0+8k\*M3d2$h0(`, +l) 18$8>'  $ .t=> =x40 lf$L$#|.\)<'MRjX.iD>q/6<>x{. 20<($lt7@5tK>'H1(`f!5\+dC2:ԯjEK5\Oh4a,k )2$~&$t|9LA- - jl#T(&x9N9f62,'k48,X>E@*]l3gH%0s,,%4n!|| tN4&5H5@fT( q"}0>6H't|5>8A.L'L&T8DL3Ċ74H3|D<3D/p((56(4?+8MtR>V)b@E*<vZ8p6&$fb8p$(\[ft.,ld'L4v*+f5'Dt9%L* k%2% 3.hL64.h-hTf64P`fx )(T2$+,*I49S74g*d}`(%"\H]78,7 < %`"44P#Hfd3L)%l1hr"<X7R=8cpw9i̧ q|'l}O2H) ;"ljT:7lHr-439,t d>84y2$L>T)=x%pK#dW!k\&t8"L6jI30%H%LD1h+`Ll@0h$X8E5H30#|<14M\2tZm1hga-t>:t&>:6,*1d1HH{#0* m3 >360>14LV.PeD$s#l)0<7>lH6I0V!7L1Dd1*Pj>-<'p4>l$/l2H$k,H26$D#/|k91?H!xP8\3fojulإ)343D>m&xx);\Ј&\6H50^f j2>%\"4?@fG@3W3a "v0!LG87>5pK>|%2p &> b4|93X .(T+g%L6X5?,3I \)Lj'drH7;$D>t>"`* $x'| l8,ld"%0B#$$4l1P7.?p1R,.Tdd dnt4x$+jO>'|7P38 6@M>8j8pk4$7(H@*=<'(L@!]&n"|434 :>1L#-<H>@1\3@h[fDu&#,0k(H#05p+(36d'TAU5K-Z?% d4'Ht8>j 4\(|2>\20j 4> *l9pi:%(f9+/<<4TJ0 0W+ehN(r`,%h^(I> wj 4|2(0l4t"|7l&/Lx& Q$7<,6>:ȳ6D64Q%`\(<eԹ%s"D5D-7 %hc%4,O3d'fX>t|"4t4`*L,9 -(@F(5xW\%dojpQ>Q T{9'h<'4!x#!l@464kxnjx8*0.x-8'8h{9H58U +(@b: t>|6L/"4@(j (kC$&|x&H @ #l""(,6<;4V'G/T2ad .ml,)'l,60/k-|+'*t$"@#(3,><6dF>*\(kjxg7|>-HP>$jmjp{9lQ6Tf &{9,"@h9 ,]7,6(7L5$AX(No& V;`j(vp*`-1(4jO',,*8p $%. `k9$p73@>jF@$QX>]fg`+plj: IJ4H>>7T!>`LD!<q4>%73X(P>`(Ji9Vt. bO3ulp"-$7t5x -}'A%\'xh5+D%< n91"5=("PMP5XX2\f|f5wl3\+(DX=#eH6s̅5~32\$lX0+'.)`G>hX!$  (h 4P#H\5-K>P5468q)l18p3܊3)4262*F8(U:$bL>q$L!z8H#D>g#4 >&@$lDL 0kH'`(#@1@H'0'(87A6\B%O>Xt*Dm4,} %Hoj6\3l@D(6P1H`%,%0,"i2T > P'(D000`.~-j%%$383x2}$?/ RfZ 4\rl.7!L4'(8,01~'|>75p/h #H+XĨ4Y0+A- <@6HJV5$S؂fa1u>z)8\9>ĂfO#(22ܼ*<j`C$<h-04j"c,`% .f7N>E+ Xh:bq3Lw1+6>d%( lP(xft0( 5l$8<."260+%`<K74KP*],&c(Hr4{&}=> !-d9+'@&@/K>8(t,p#X !##D0p15>H:>FL% R _lsfM>\j(85t4 68>m#ojx"\ *)0!4H+w) 7,# |I@5_4+%dkd-v,>!4Q((xI(HxfPR>$G>4:(=60\&!/3tHN!> %P(3d0z#4<`: I`N6DSZ3$d@-p"LT+%d|@9<9t5X3x?-82>!X64-j9< .K9#Z<0j2z#\7\&f+U# |"0p4@>p9 1$!Q+)(<0 ";м6G(*$[.Pl,x^%t8T2+L|6^6jC8d66 ܒ( '(D@%%#!`51Oj_̜6jt)y T$4Ȅ "44#p)<-6 '0l"0(\x2@8,7;j@ElU</xiP>$x\>#h$$5tT9D!@@6)(TL2,A-8,'l) jD*1hj;,fA5J&Z!m`jw4l2$(>Xf<H>4B>@`_f ># 5!,HD4'*)n/5,8hL*8eT4{jjc7Hk4(<3<< P6$t5 47e:P 3#+R>0?l90J ?7,Ukh5|zP$l!X1`/@#f5b+A"# HI4Y M,m4^"|8F60<0\)W'|ff@fX(;ȟ54R B- l((< : %u/ /=> >E- O3Yd'h%0wf}f98\d-%#3(%;|L6 %he9"p%-0&x?-K"T$4[lW04j@5sH3| w#6  4$-TL+!&p06>|`3("p56-p%;s$P@ D5P : ` fpP4x"03L7,*6xHy7x6$c+#H*D5D7!p#(p <+:/h<8%2J 8`[P3`oA+0z#4n9T5H/,-@1>#l"('7G6)|055(># Ax)`NX9fh:t!!Xl7J6\#&,#(1\2#(8`\c2%2|+1xC\jM!] .tg( lt'/(h"4 **h(O3l 'H'hz#,<5o2 D9t',@ 9|fC7P$x`|0(kT7},%'<:#L1T)x5HM>T2.4]% 5x$d'l;l/$D 1L0D>X_%dg\#(y#XLn945f|\3T%(; D-$e*&d2/6 =x3SL28[@4g,5 r&(jP5 . ،: u4lk54)&0-;8 .l''#206("Fa3\<&b`3tgH=9\w<)~7 'l $u6,5/r4P4PM>Xj(@G54;o#xW4%ld6r>-X~T'0%0[f %-dh &X~9[0@ dP'D>2X34!\F%R\$#@Y2(b_#h3{$ |X$ 84, XN*0* % = "PS _ @!Lt ,D"x N3| t/ hR9 6 2 |m9  w5l j  @> 4 ++* ظ949 l[5hI ,!#hU 2]  &j  !z u9 7 j0 x~#< d;6 (: ȇj (#H I28% )D3 3lI F0V w#g `ujn `U9 k+ p%  T$# ( j #@ `#0 ' 5  : Lo9 &% 9X0 5>  [fN  1b T-r lQ3 4/  0$ 7, , 4>>  m9 &  * c`lk;>xX6t|5P5<(/`-|<:q3hk4D-.65H TX3$d.<@jKHH%0Z /!cfn?3D((Dx-H>H>G8. G(XC$ v8L;'x\#8"$"76̐%LAȋjL&Uh8c4 qp%d\fh&S 79>3,c%p9ffx3af,P%5pv3pJ!XlG7g"'xw48 d d+;f@-X14t1T+&8#(6>-@K9@|4 ]fgK>t`#p{l"H *t3#Pj+THj;> ع#3$=.20\F,9.DS#4c4(nt&{%|Dy"|T!Ht'@#\&#i"p"0Tm7P,@#%(5&\n99d.5dM 2*H4d ,\I1O6Yx0hjo 6t+@l&7#p;&B*$OX*8b'wt " PQ>4|4Tafl&\7^20-.0-p 7X*$@5<0lD{9X1\ D" X3P,Xt4X(N>%\q&.#LC-/T,-pe&4Pu8<jj5@xq"8>.H'>3<9#)T6/0<%f.8: 3TA1F'$Rh#@l8fx#@h32h$_f A- lL*4h?3dj /TX!P09;kLh(@W 4PlX/x,&XH>;$M6.@ $/<!1(B$$ e:6 ^/d)'@$d5 #(@: NN>WM>e45pu>|-ȵ*@d,$ LH;>4hh30X`!$/2=d%I(3\3f 1w">}@^j*D64 8+`:!*4j8=> |5m9 `6h1T0( <7TJ6 X:xhT#<w,3`C"|&4X3~9E#7:,(*x D# E!! Ll2 `g'> `%,M >e |9y 4\  & / <.h D6> >>  lu2@ ģ!P !T,!.#4(!+ 2!6xD!$<O!ln!`d,Hv!4p8`!K3!k!42`!|=:4!$!!! lh!L*p"4f"g0L""6/@/"l<"lafX"l%l"̾(z"`$"(|""0{* "4h"Rj"2"'1"X!" l4#<> #6l#,# #6 .#b:<:#x20C#kP#3a#)Ll##Lx#W2$#6#l#@1###@#H#n9#j#"P$<`7 $H>$4`5$h+?$T$M$!p_$,9dh$*#$w$9$6`$(7<$l68$~5$<'|$l X$"$8<$]8p%LR>%{$'%.h1%:0hA%d9S%44f%/@m%f{%}1t% %%8!P%|>%20%'%H(@%j%#4&pk. &x(&Y>(&&p.2&l'HE&h"@W&D8(<b&3 r&*L&@;*&xH%L&!#$&. &j&6&o"(&D3T&4&8'@+$'5"'df.'܅f K'fU'L$\'=> l'LE!u'!5T't-')|'%d'(6D'2d'4[f'd88'6(\26(/'(L';(<60F((%](<#0s(&(>(D1(2 (PE2(@"8(b1T(03X(.(D6x)@l)LS$ )|"@-))|;)jB)lS$R)#,a)W6ln) jv)908)T"4)p!)*)p5)6)N5)H-)*l)t&p *38*\.4)*e2\=*4\Q*xi5X[*B>s*8f* #4*Ђ$*#*$&*Pl*f*!-l*l*j+I"+%$+4,+8!>+#4O+_"\+ 0i+_',o+M8w+̑*,+.8+L>+`7+dv4<+432+d)+X3$+L4h,K3," /, |@,6J,(*],>5Di,A%y,T*<,tf,\2,L-,,P,Xuj, *, 3,4,-|5)(-=:4!-4*/|1-[.(A-0(PK-\ujV-)4i-0&{-l'-S4-8(X-1-1-.-L#4-ԇ"H.9(`!.4>#1.- ;.8?7G.9(DU.!$g.($p.Pjv.1~. $.l 8.(.&.1#.Ф..ԅ$. (."t/0D1\/<0/6T&/853/ 4,H/0!\T/ tr//d/R6/4#,/Y1-h1D*@|1<,D1&`1]/1pk1k1x#-1Pf7P1PS21#D262\8%2{952H'*8H2,(8R2$Z2;0n2[fT}2D3,222P'(2B&`2|f 2'2+2(32,j2"@ 3G#3x"0/3d"6`=3d6U3x4xe3fo37#3<#3H>3tG%3>3ܯj3@lf3|93(6 3]4L4{/X43h4h/*4`j94fE41K4 2$]4%(f4'Hs4Tj~4\)4d'4Ă"44d64lM%44-4%4#X 575p/0%5"<5:D5(/S5 +Da5 "x5*5O2\525af52>58D>5*576'6R5<)6f/6ԟ4;6x.,I6%(U61g6$%tu6`2P6<36Pf62,6~-6|E- 6"46t7T6@77p4 7p)7L5l7* 97TjC70) Q70 [7%o7fy7~6T7j97G>7P'70>7 +471)H7p"H7P3l8D>d&8p6>-8&T68j:>8|4L8(U>]8W>i8(/@z8tH&8p"08l7p84P8HU> 8%848%8 9G,92< 9?999,-,E9T 1pV9: b9#s9l*9܍*|95<9&$9J2<9"79t)9j99::@ :xB':7T':'<;:1tC:\5M:df]:&\d: r$s:_#L:ȉ':`>5t:<::H6X:<#:nj:30:DM>:L>:<:(`: :6 ;hj;j;&!;#-;t6A;3<R;/\b;L>l;X.(z;f0;K>;&;l*;h:;@+D;0k;*;)P; x/;|{" <9%<8$l8<558B<e!(W<:^<(<>n<1>w<}$<><[/D<$4<18<H'\<%\<82%<1) =8=l0=W/>=K>P=%_=D#@w=,&=3P=4=t[f=R>=:>=%=<`f=0, =P?#=8j=Ċ3>@7D>6.>f38=>H5F>34Q>6DZ>)h>|g'o>. ~>Xj>3>>>6L>T#>7>>%`>./># ?1?j?$j(?w65?@5<@?2J?(jX?\j`?fj?X`8\?Z3?1?!\?h'/0?M>?t6>?,P?T;<@<2)@$5d@ C-8/@'t@@D1HM@Xfe@D> m@%8@2@T12@/@.2P@-p@*@x&@A#@/ A4}9 A*7A86FA66\SARj\Ah-nApj9A|&A2A10A%A.'Ap'HAPx4hA(1@A>B<: BmjB"40B\f=B1JBm9\B1oB,=> }B2B0'pB#hB_7tBfBx3Bx[fB'xB/BjB`#DC,M>+CG#=ClNCX&,YC#HuCt7C$Ct*C$0$HCx6>CA8C5C1>CԆ D+8DL7,!DP`61DxL3,@D>HDpkSDH3bDp rD`6DL)1DQ#0DkD`( D&D49#D 8D2@D>DHfDR6 E5hE4Q>1Es*GE:PEtc8aEl9qE0'<yET'E&E"8E EfE(|EG>EL* E%PFl FfF>#0F9EF(OFN8<_F #LtFa2LF1>FF50F5hF,GX$, GfGDl/Ghk5G()LAGk3pKGI3$YG$1.PeG}$wG<$GLjG G>xGv6GI(GL(0G\o9G>H$K> Hlj$H##HL-1H'LGHJ"`UH|9dH;$tHJ+~HjHo"Hly H7H5PH= H3H|lPH5>H5PI4 IxkI<'&IX;:$-Im9?IHT#,LI09aI+%8pIܟ%I!#IfI5IB-IT&IZ3Ip&TI$$IT'%\J~+lJL$JL4-Jk 8JP'CJ\,HMJ%%aJ%xqJA4JlJF2XJh#8J &J%J5`JTI-JhK!tK%30Kh/ K$<K/K|#pKH&KG6$K`lK7KN>L'L L4L#X+LPf7L#ALh#$TLdj`Lp&iL&DtLx7L'L5>Ll7hLpl L4\L43<L4L(' M$z/M.#h)M]48M*tMM ,#VM2@fM1M'tM  QTv2Q@00#Q4%0Q/8Q($IQI'TQ("(kQ`M>Q (QPj QtfQkQP[fQ/;,Q7\Q68Q)<Q7Q|9Rz4X)R10R -L>RjHRt/ [R1$iR&'@qR$#4RK>R fR<>RfR5Rx%$RHt5R$(Rd'@R$TR8fR{9 S8 lS W2.S X> :S/`HST"]SleS< #zS SH8S`A-S1xS$!StL3S9S@jS%8 T(LTpE6(TO+<7T*UT0j_To" mT/~TjT*T !TXR7lT8 4DTP&tT %XT) TL*LU87U%@)U0)04U 4`EU,J WU`Y6gU6sUE*U |ULs,UЂ#U!`U4UT1LU$s(U@fV06P&Vd#2V@)W&2W\M>WjWl-WD!@W15W1W/W#X4"XC.5X(-LAX>xSX/|_X$fX*|XC%X$$XfX,$X x&XT#X"0X4 )X,(`X>X84,YD1Y+Y`&&Y3h2Y$#4BYlSYHJ%ZY6@lYW5vY`.YB-dYlH>Y&YlYT>YXA-Y$$Y=:YX 4Y75\Z*@Z&"Z<<-/Zd-=Z05HZ$a5UZe!cZx tZ(>Z Z4l Z2Z%Zi5<ZP+ZF(HZtJ-Z&Z|b7Z`q7,[#[t89[t=7dH[@jP[̟4[[]fi["[*7[V4$[Z3[]f[i9[Ď:[@R>[8#0 \#4!\j.\';xB\`{9M\$4^\5Tn\,@|\>\D_f\-\\2;\hF6\L3d\+(<\$2\p"\tf\b6l ]N X"],9+]k6]j<]1DJ]$6W]<5tc] Pq](?&`]'0]d6>]f]|h4D]HE&0]<.`]=+8]7]/p]8$-]'`]*^>0^l)A^F9P^87 i^)\q^M%~^>^/)<^h+T^0'^4>^18^0)h^t=6^$` _ܔ%|_K>-_( l=_ *R_Ȳ'Y_D"ho_6 }_2_l6>_N9_8 %_'_P(_8~3_ܴ2p_`j`#$`Pf(` /A`.xQ`Tw1`` ' k`X>> }`p:`6`<=/`<> `M*`\"4`5`K&`|'PaX6a a#+aj7a4Da: RaL'\ai&|ga4u9va8'a\"-aja1a>:a<%dalfa)a/(\aH*Pbpkb$l,bDj=bИ%Kb.$Vbh5ab]fkbk{b'b6b|o&b264bL-(bԂ#bl8Lbm4tc#,ch#lct!H+ch'5Ac1$Vc=#,hc$#X~cC'chV1c >c'c $xc#Pc$3c2dO8PdX1d>:'dXaf,d\#AdLV'Jd 'WdP"Lbd D>qd$dT5.d84d,-Td6($d(djd 8d [/Pdl*d\2de,K%x e&,e5)e,*#X9e[7|Fe(3@NeK>aep7ze.eu7<et26leB*eX!e2le̛+He\6e+e#D f>(f>:#fy2,fj7f"> BfX2Rf`I2Ldf`.(nf5Xzf́#fI9@f4=&f) Lf"f<+7,f<08f j f؜ffԎ(g7Tg ,dgx99gfBg2Ng"2]g+jg-xgH'g]$8g?'\g8"gT|!<g84DgO3g#Hh#h*4,h"6hh>Dhs#`NhD2PZh ,`jh(0shL:>~h0%\h8h$1hI5Dh"-h]fh4!h>h&h-i4Hi6i:)i̪&03i7HCiXfTi&`ii X~it 0i9ip"Hi3$i%|i(diT6|i85i4i*0|jT>jđ#8$j34j<->j,X'Gj'Vj 1_j([flj%(tj4i#tjlx"jH" jI,j@!jD-8j/jLjj"j6)j0)2(kK>kP>&/kX|6 kfk>ki:k6kK>kD'xl# l>:*lf3l]';l w9@l$I6Kl(l Vl_:Hjl6>yll4Tl:)4ljlW7,lt><lL(lD^jl?5Hl@llȡ.l;>$m8#$m'|mj#mT4p1mj~mh2m $mD5m4m!m,: m3mX-m%$m: nG60nl9 n2 5n(1$qn9(n4#nA*n 5n&n3|nԐ3nDz9n ln5>n >'o!ot6/o4`?olPo*^o *pojzog2oԎ.Hog$o o$,o]*o09o (oC8 ph1D#p941p9Aps)Mp4'\p$4eph=> up3dplpD p2p/4p%)Dp$$p`3`p.p$*p\kp'x q#"q#<:qD )FqT"[qLa"oq\3{qkq ojqd dq q#Hq6.q9qn(q q0u q@4Tr' rL!r"+'r0#H3r7> :r(0Jr' Vr0cr&jr%|zr*9r#Prfr3(r$rs/dt20Hthl%t2:t|-Ht>Nt)6 [tS/pta&(|t`}%t#tjt:t,(Pt%\tdH8xth6Htz"t"l ut *t!u)H-u\F(h;ufBu4/@QuD#[u3cuD5 nu~.zu,&Xu3\u(5u%udju1(uf u40u$2u fur7@u1v$!t#vЗf-vT#7v1$Kv14cvxO>rvT;>@}vt]%hvhM>4v jv j9v'v6> v+ Hvfv*w\6w"(wH" 7w"Ewd[fXwO>$fwH'uw;`w=> wxW>(wux>x-*x,9)x<$x >xP:x8/x4DxL8y(/Hy54yB7,?ykIyn# Xyj9gy\r)ryh1yԻ3hykyD*y3&yo$yY7y48+0yl(zT,(@ z8 #!z'/@.z+=z*Sz >ez,/|szWD>z"z/zfzd7Hz)+zo8,z78{,((@ {'(T{l{j&{#T6{ $@{PfI{ pf{H.xs{0*{\af{@ 0{@&(D{ .<{h++|{#{@/{6D{8I-{%{l |K>|O'T|#@8|L/G| ,S|h%Dc|5\m|D3\}|)0|28|*t|G#|6|$1T|t#X|`4x|4>|2|4l }%}0.}$k8dN}/8^}#Xx}8}"%h}\6}&@}m X}p6}M>}lg/|}L6}h4` ~H>~l-~(M>@~> J~7\~#<w~#X~*1 ~hH>~k~5 ~i:~%~6p~*(T\jJ-`0N%|#t. 2Hf9Rt%$iX6lwXf#p!4jc6<4E0\kf|n9(/P"&|f=[fK3f|$Pr$)5<@3@TK-K>dj8">L3(π8j݀"`5(!BK%QM>a'lk `#{|.6>,f> f \L.Ӂp}#\f4 @[fj%?8<;,$'F03L] 2,e%2r@1X}|c,<X\& jؖ%D"ӂ3`ۂ4.I(3!-Dj"61a3XAh/@Qp)X] 4Xk'~[/)pf7 *ÃD)Ѓc( ك8d,V* %0p,jl$f5 N>Au*hY&c@>> t|S$X4+(!!*D #4Ƅ\ .фW0p (($j\T(L|%7' *> 5F B+hR9Y4Lc4'8r;(,D=> |q#D*lho9…h1(ՅPA>2*pp(T%n98jB4,)hQ6 b*4ufH4T$L>> 6,3H̆l܆k#s4,2-'j:&2; J`:,dT+#^)Xo%0w]f*P5`f(K++`Ň$>؇ Px!1 dd5X3P>&d61h 4PNx1,[ 5m&|L;$xa+0> TĈ0 7ш$N>݈l00(:>d$XJ1@)p%)h#@hX>(N4-dW G/f#nd!{t<.<" f0d &$jRjЁfˉA'\ډTK"8)H$HF O5m')0!7u6H2Zh$Pi@jwk8j(̖6`r4xE- Ŋ8&LЊ"ۊy7p74s#@"P#@(239DP4DQ)[(k5#h~&,2|(|l(8(Ƌ$Ջ"tT6,59 %+$ 46E(Ut0(`/7n`4fܐ3P +/0&O+d͌pj ֌9F5(Y3 Dr**7 9DA-Ek6|T +`>:jmjxȿ"N6T%D#l!*(Ӎ%ۍ 3<@1`-H>+8>@-JfQH% [c"te|#Xx',.#h-Lj!`3@" Վafdaf f%$`%t#C4X1/dADn$lQ:Y%; n<[f"6\7&d%H'Tˏ. ڏn$@"4 h. '+p0$h6l'A&8N7Z($_3r@3|_6Ȱ 4Dc-x/Ő@8&pӐ"ߐ2>%%6 6l)H44>Bt3L4T6lY0'c1p-L}!LH54l9đ&Бfܑ5k<X $f 1d(f%.; 4,j"?87P87a$fj8>spec_vnodeop_opv_descwi_set_nwkeyucom_unlockpfslowtimonanouptimeuvm_map_callrandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickuvm_page_lookup_freelistlongjmpwi_usb_rx_list_initffs_vnodeop_opv_descvfs_opv_descskdb_trapvfs_allocate_syncvnodetc_setclockuhci_pci_attacharpresolvechrtoblktblsys_minheritlinear16_to_linear8_le_stmputcharural_update_promiscbufq_default_allocchild_returnuaudio_add_outputrtlabel_unrefuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donewdc_atapi_drive_selectedcopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidext2fs_vnodeopv_descsdofilewritevwi_inquire_usbuftdi_matchdumpmagieee80211_derive_ptkttyflushsys_setsockoptcomdefaultrateieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswohci_powerpowerhook_establishwi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logpciide_triones_productsuvm_maxkaddrehci_pci_cansphy_cdral_pci_detachicsphy_resetrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachsys_closeusbd_do_request_flagsrt2560_set_rxantennartflushclone1in6_purgemkludgeffs_inode_allocdes_encrypt2sys_setsidieee80211_encapusbd_intr_transferaudio_attach_mi__ashldi3artisea_chip_mapvn_statvop_getattr_descunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchtcp_secretrti_findchange_sign16_swap_bytes_be_mts__mainwdc_ioctl_getaue_stopufs_quota_deletehardclockenc_xform_aes_ctrrt2560_wakeup_expirewi_read_data_iomyip_ifpwdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachieee80211_get_authvtagssiop_pci_attachfilt_audioreadwskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventpcaled_caieee80211_inputcrypto_dispatchgeneric_armv4_bs_wm_2if_group_routechangefiq_claimohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caehci_pci_matchipport_firstautoehci_strmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartevcount_intrfc_lfcemptyvfs_export_lookuprt2860_set_ledsif_cloners_countifnetyieldohci_endpdm_freemuhid_seltrue_filtopsfilt_seltruesc_print_addrlogcomspeedusbkqfilteruvm_rb_subtree_spacevn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIpdevnames_sizemichael_updatealaw_to_slinear16_be_mtsscsi_mode_select_bigmainbus_bs_wm_2route_dstinit_execieee80211_send_4way_msg4wskbd_cdsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsuaudio_set_paramsnd6_dad_startuaudio_add_extensionexec_maxhdrszuhci_device_ctrl_doneblf_zerokeydb_force_whitespaceieee80211_ifattachmmmmapieee80211_clean_nodesuvm_map_spacefitssetjmpprefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitricohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopslogread_filtopsre_ifmedia_stsvndxfer_poolfilt_fifowriteem_set_multiffs_specop_ptcp6_mtudisc_callbackieee80211_add_wpa1copyoutstrext2fs_fifoop_opv_descatu_capte_l2_s_prot_uieee80211_countrycode2regdomainradio_attach_miusb_transfer_completelxtphy_serviceswcr_newsessiontcp_attachwskbd_cngetcbuf_dirtysoo_writesystempagem_zeropdc20262_dma_startural_alloc_tx_listffs_specop_entriesunp_gcingreaddoslabelbdevswumodem_matchbaddynamicportsworkq_initohci_root_ctrl_closeau_set_lr_valueX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpdlockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfilterre_ifmedia_updwi_headttyunblockbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetach__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnamesdisk_busydb_breakpoint_alloctcp_pulloutofbandevcount_sysctlsqphy_statussddetacharprequestsiginituipaq_cdpci_mapreg_mapuhci_device_isoc_abortuaudio_activatevn_default_erroruaudio_query_devinfousb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigffs_fifoop_opv_descusbd_clear_endpoint_stalldb_vnode_print_cmdums_cabio_registersetdisklabeldeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocroutedomainhid_locateicmp6_errorieee80211_hmac_sha1VOP_MKDIRusscanner_scsipi_minphysip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomulpt_detachfiq_setregsffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapbpf_filterchgproccntip_draindb_map_print_cmdumass_init_shuttlesoqremquepci_class__adddi3uvm_map_inheritfifo_printinfocd9660_syncem_display_debug_statsin6_ifawithscopevop_inactive_descaudioreadumodem_set_line_stateuvm_schedulersync_printnchashvnopsieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readdb_read_tokenieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuscannerioctluvm_map_protectusbd_get_xfer_statusre_encapprintfehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numip6_protoxsys_recvfromswcr_freesessionttrstrtsys_sbrkrandomuaudio_mixer_add_ctlsysctl_doprockcopyaudioattachsiop_modechangeext2fs_initrtfreecuio_getptrcd9660_linkhostnamelenlinear16_to_ulinear8_be_stmupl_cdcd9660_specop_entriesusb_needs_reattachem_flowstatusxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlocknd6_ioctlsched_chooseprocphyslockaxe_miibus_statchgpte_l1_s_protousbd_get_stringipsec_exp_allocationsbpfcloseusbd_probe_and_attachsys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintralaw_to_mulawkqueue_registerpciaddr_resource_managecred0in_delmultipmap_procwruvm_forkvfs_op_descsuhci_device_intr_abortuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromfifo_ioctlumodem_closeehci_devdttydefcharssigexithidirtypagesrt2560_reset_tx_ringin6mask128bus_space_read_raw_multi_4atapiscsi_cauvm_amap_poolin_pcballocVOP_LOOKUPbrgphy_loopdb_shift_exprphysical_startbs_notimpl_bs_c_8pcred_poolenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputdes3_zerokeyre_miibus_statchgobio_matchacphy_cdcrypto_getfeatusbd_pipe2device_handlecpu_do_powersavemainbus_bs_freeaue_rx_list_initi80321_bs_vaddrbufq_default_freeufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesocket_poolpgrphashsys_setpgidpciide_jmb_caieee80211_crc_updateprofhzntp_update_secondcache_enterdb_watch_tablei80321intc_attachedexec_elf32_makecmdsradio_cdradio_caext2fs_bufatoffsys_setlogininitarmmainbus_bs_r_1amap_listdb_trapuaudio_halt_out_dmathecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readsimple_lock_debuggerauth_hash_hmac_sha2_384_96crypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogatu_start_scanipsec_def_compfc_lmdistancewdc_atapi_ctrlnch_poolsomaxconnural_readatu_external_firmwareipsec_exp_timeoutip_directedbcasti80321_pci_decompose_tag_bus_dmamap_loaduihashtblieee80211_node_getrssiscsi_get_xsau_get_portaudiommapumct_activateticks_per_secondieee80211_get_rtsamap_initffs_flushfilesetherip_allowubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekulpt_resetmainbus_bs_subregionaudio_check_paramsnprocsdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_serviceau_set_mutewsevent_finiip6stathotplugread_filtopsuplcom_set_line_stateuvm_pageboot_allocconfig_pendingmii_phy_updateswwritei80321_i2c_matchether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1rn_searchugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consoleurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptbinuptimesys_seteuidwskbdpolluvm_map_checkprotmax_protohdrmixer_openatu_tx_list_initcdce_activatedes_is_weak_keyohci_pci_matchural_rf_writedb_access_irq_spieee80211_add_qos_capabilityieee80211_cipher_keylenwdc_atapi_intr_dataumass_scsi_attachbufpagesrandomkqfilteruipaq_attachusbrev_strpciaddr_resource_allocateiic_execsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinituhci_device_bulk_methodsrt2560_attachmi_switchcd9660_statfsrndwrite_filtopssysctl_sensorstsleepuaudio_drainkern_sysctlnd6_delayin_pcbinitsqphymatchcompat_43_sys_recvbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveuvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTscsi_user_doneehci_device_ctrl_startuserconf_cmdbuflinear8_to_linear16_lewi_get_pmumass_bbb_stateaudio_init_recorddb_print_loc_and_instohci_device_ctrl_abortsvwsata_dmacmd_readrt2560_updateslotpiix_setup_idetim_timingsrt_mpath_matchgateubsa_stopbitscdce_startuaudio_identify_asrt2661_reset_rx_ringuvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabeldb_print_cmdusbd_clear_endpoint_stall_asyncehci_pci_shutdownvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstatwddkdriverdb_break_tableuvm_anon_pooli80321_softcfillmapentrytcp_timer_persistsata_chip_maprelookupudav_newbufsys_umaskuhci_pci_attach_deferredpci_subclass_i2osyn_cache_reaperfilt_fileattachsysentlinear16_decimatorieee80211_find_rxnodepmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistrt2860_drain_stats_fifoufs_ihashlookupubsa_intrscsi_inquire_vpdmemmovesii3114_mapchanicmp_rediracceptugen_set_interfacevop_reclaim_descusbd_get_hub_statusworkq_create_threaddb_boot_halt_cmdural_attachip_outputbpf_mtapuaudio_add_selectorfindblknamenkmempages_maxkue_rx_list_initieee80211_aes_key_wrappool_inituvn_referencebpfreadpool_putm_copym2umidi_casysctl_structau_gain_matchohci_hash_rem_tduhci_poll_hubpmap_pinitaxe_ifmedia_stsieee80211_add_fh_paramssysctl_rdstringuvn_attachlasttimefiforead_filtopsehci_freexcryptoclosesysctl_disklockcnkqfilterrt2860_alloc_tx_pooldesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statusspec_vnodeop_plookupnchinitexec_mapdb_qualifysnprintfcomcngetciicbus_printext2fs_readlinkaudioprobeether_ioctlumass_bbb_transferrnd_attachedtqphy_serviceuscannerkqfilterip6_forwardingural_cdkue_resetarp_allocated_bus_dmamap_load_mbufwdc_print_capswi_watchdog_usbslinear8_to_mulawifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyallfilt_audiowdetachuvm_pglistallocsyn_cache_addohci_device_ctrl_transferulpt_do_writeincoreurlphy_cdhzdcphy_mii_phy_autoulpt_statusmsgdefrouter_resetcd9660_ihashinsrt2860_newassocrt2560_bbp_initsiop_script_writewdc_atapi_send_packetsched_exitcheckaliascue_activatettyretypestartuphook_listrt2860_detachre_tx_list_initpte_l1_s_cache_modekue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachuvm_km_pages_lowatrn_mpath_countsd_switchwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutsdclosevop_generic_kqfilteruaudio_set_speedpffasttimoinitsiginfosys_getuiddb_set_cmdrt2860_tx_datacpuidsexec_setup_stackobio_bs_vaddrpager_map_wanted_lockuao_createdb_free_watchpointssensor_detachbuf_mapbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctsrt2860_initwskbd_load_keymapxscale_cache_cleanD_rngcd9660_bufatoffaudiocloseugenintrgroupmemberuvmspace_inituhci_powerrt2661_ioctlukbd_hookup_bellether_sprintfatu_calculate_paddingfintek_refreshmsdosfs_unlockselwaitpmap_init_l1udsbr_get_infoicmp6_mtudisc_callbackssys_forkip_setmoptionsuvscom_reset__qdivrempiix_setup_sidetim_timingsumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapswcr_sessionsfilt_bpfreaddb_watchpoint_freeehci_alloc_sqhaue_shutdownuvm_fault_wireusbd_abort_pipekernelstackip6_forward_rtableidsi_freevm_nphyssegip6_randomidproc_filtopsfiq_nullhandlerelf32_os_pt_notewdc_print_current_modesfiledescopensys_vforkehci_freempmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamedvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctldb_history_prevem_read_pcie_cap_regem_setup_receive_structuresmyip_initializedsync_vnodeop_psys_mkdiruao_reference_lockeduaudio_get_propspmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbrttrashohci_root_ctrl_abortmblowatgetnewvnodeufs_inactivepciide_natsemi_productskue_load_fwuaudio_opennd6_mmaxtriessiop_intrsys_socketuhci_abort_xferuhci_detachuaudio_getdevugenopenSHA512_Lastdead_vnodeop_opv_descohci_shutdowni80321intc_imaskffs_cgreadfilt_uscannerdetachwi_init_usbugenioctlspec_close_clonevop_generic_bwritenanotimere_cdufsspec_writedead_vnodeop_entrieslxtphy_caiso_disklabelspoofmidireadfifo_badopfdfreeuvn_detachfintek_capci_set_powerstatetty_countdeflate_globaluftdi_detachraw_disconnectipsec_ipcomp_default_levelsensor_task_registersis_south_matchKERNEL_BASE_virtuaudio_identifyremove_coproc_handlerumass_polled_transferucom_to_tiocmsensor_attachbrelvpre_intrwdc_logauth_hash_hmac_sha2_512_96msdosfs_mountfspcibr_flagsem_82547_update_fifo_headehci_root_intr_startwi_stopip6_sprintfsync_fsyncumsm_activatesetstatclockratecd9660_strategyohci_allocmuserconf_parseural_tx_bcntiocm_to_ucomip6_keepfaithext2fs_allocusercryptowskbd_deliver_eventcompat_43_sys_getrlimitdb_eregscom_fifo_probebread_cluster_callbackfdcopyatu_send_mibuaudio_setemul_findb_to_qin_len2maskbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapobio_bs_allocusb_blk_freelistudp_sendspaceulpt_caSHA1Updateifg_headvfs_rootmountallocehci_device_isoc_transfercue_tx_list_initnetintrbs_notimpl_bs_sr_2cd9660_openrw_initi80321_bs_mmapuvmcnt_dumpixp_setup_channelohci_root_ctrl_startbsdi_sicmaskbrgphy_cd_bss_end__ext2fs_blkprefdb_pool_print_cmdwi_alloc_nicmem_ioicsphyattachdb_delete_lineuhidkqfilterVOP_ISLOCKEDsys_kqueueSHA512_Transformieee80211_tree_RB_REMOVE_COLORuao_referenceurio_causbd_kill_pipeuhci_freemin6_addrscopebuf_getdb_searchieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_node_leave_11gieee80211_free_nodeieee80211_recv_eapolraw_usrreqnblkdevuhci_find_prev_qhbs_notimpl_bs_wm_2uhidev_detachurioclosescancttyinput__stack_smash_handlerumsm_matchukbd_consopsbiodoneural_activatedb_set_breakpointmulaw_to_ulinear16_be_mtsehci_free_sqtdwi_usb_txfrmmaxslpext2fs_makeinodeehci_device_intr_methodsswap_bytes_change_sign16_lecue_startaue_csr_read_2usb_eventsufsread_filtopsufs_symlinkudsbr_attachufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassocin_iawithaddr__anddi3rt_missmsgdofilereadVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_taskusscanner_activaterip6_ctlinputchange_sign16_swap_bytes_le_stmubsa_activatecdce_caumass_cbi_adscsbdropmidi_out_stopmsgbufphystcp_debugusbd_transferinpcb_poolohci_hubdohci_pollnextralocblf_keysys_setegidnoswap_bytes_mtswdc_wait_for_statusbus_space_write_raw_multi_4ucom_status_changern_matchfifo_readcd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoreceivesiop_iwrpool_getuextralocdb_show_radix_nodeudav_csr_read1ohci_root_intr_startffs_dirprefucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollfilt_kqdetachmidi_cddb_flush_lineaue_unlock_miiipsec_exp_bytesbufqueuesconfig_deferem_check_for_link_bus_dmamem_allocm_tag_initfilt_usbreadusb_add_eventbsearchif_attachusscanner_matchpciaddr_ioaddrm_reclaimnameiem_read_pci_cfgbs_notimpl_bs_sr_4ext2fs_readdirip6_ctloutputdead_polltqphy_funcsversionwihap_init_bus_dmamap_synclzs_dummykqueue_initrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerruvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getciic_probe_sensorre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufwdc_atapi_the_poll_machinecomsoftwihap_mgmt_inputpdc203xx_read_regudav_initVOP_REVOKEconfig_deactivateclallocipsec_esp_trans_default_levelbiowaitpdc268_config_readpci_subclass_inputprobe_addrs_sensorfilt_ufsreadrt2560_rx_intrunixswsccsdb_stop_at_pctqphy_caehci_check_intrccpupmap_updateehci_device_setintrobio_cduvm_map_replacegeneric_bs_sr_1em_setup_linkpci_vpd_readacard_chip_mapnexttickeventboothowtofdinitarc4randomnsphy_funcsuvm_map_entry_unwiretcp_delack_ticksupl_stopttopenata_get_paramsether_ipmulticast_minconfig_rootsearchrt2860_bbp_initrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdusb_cdrnd_event_headin6_maxmtupmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressRMD160TransformSHA1InitinflateInit2sys_setreuidusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcryptoopencomcnattachuserasymcryptodb_var_rw_intrt2560_set_bssidusbd_devinfo_freesdsizesys_pwritevudav_lock_miikqueue_scanvop_print_descuplcom_breaktcp_closeicmpsrcohci_free_stdumidi_evlensd_patternsX_db_search_symbolscsi_initmsdosfs_advlockswcr_idwdog_registerkue_attachif_indexlimpdcsata_chip_mapusbd_free_xferdb_varsfalloclxtphy_cdatu_joindeadproc_mutexdb_breakpoint_freeumsm_methodspfctlinputcomcnprobephys_mapumass_bbb_methodssoft_intrqufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statususerconf_initrt2560_ioctlkillpg1url_tx_list_inituhci_stri80321intc_attachvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsieee80211_findrateregyearem_update_stats_countersurl_ioctlpage0setrunnablepool_do_putusscanner_sensedata_cbwi_set_ssidcue_ioctlnd6_prefix_onlinkatapi_to_scsi_senseugen_seltrue_filtopswdc_atapi_ioctlumct_intrcue_attachosversionelf32_read_fromau_get_lr_valueticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_inittvtohzieee80211_get_eapol_keyudp6_usrreqratecheckin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollbuf_stubieee80211_up_to_acmsdosfs_check_exportlf_setlocknbigpipecue_devsin_controlrlphy_funcslmaxieee80211_derive_gtkuvm_pagecopysysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapmidi_attachieee80211_tree_RB_FINDrddkdriverohci_freemuaudio_matchi80321_bs_tag_templateucomioctlmbstatuhci_remove_ls_ctrldcphy_statusuhidev_intrttyinfodb_flush_lexttyinramdisk_devsohci_root_ctrl_donegetnulldevusb_get_next_eventdb_dmesg_cmdpciide_dma_initextent_destroydb_lpip6_forward_srcrtenc_xform_rijndael128if_group_egress_buildloop_clonergetcttsetwatermididetachdb_last_addrural_update_slotem_clear_hw_cntrscom_obio_matchpmap_enter_pvmsgbufenabledunp_disconnectufsfifo_writesys_listensys_mounthotplug_put_eventehci_root_ctrl_donepgsignalehci_waitintrfirstclinear16_to_ulinear8_bedb_read_bytesuhub_detachaudio_silence_copyoutuvm_page_rehashrt2560_media_changeffs_fsyncfintek_attachau_portofinetdomainehci_abort_xfermemcpywdc_enable_intrkthread_exitaxe_activateuaudio_chan_set_paramcue_newbufsi_getdisk_constructvfs_unbusyip_nhopsrip_usrrequhci_setup_isocfilt_usbrdetachspec_writeaudiostartrsiop_wdtr_msgcom_obio_cdipsec_esp_network_default_levelkq_timeoutmaxdb_map_equalin_broadcastpool_page_free_oldnointrfd_getfilemsgbufaddrucomclosesdioctlutsnameexit2aue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlieee80211_send_4way_msg2rddumpem_enable_intrcpu_setperfufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createmulaw_to_slinear16_le_mtsugen_set_configsi_finddb_elf_sym_initwdc_default_read_raw_multi_2current_ipl_levelffs_fifoop_entrieslogclosegeneric_bs_wr_4install_coproc_handlerSHA256_Updateohci_rhscudav_detachufs_strategyohci_device_requestkue_watchdogphysical_freeendbounds_check_with_labelif_qflusharc4_timeoutumct_openpci_subclass_networkusscanner_data_cbext2fs_checkpathns_scx200_chip_mapsocantrcvmorepci_vpd_writeuipaq_rtsprocess_poolrt2560_update_ledfile_filtopsmsdosfs_renamesysctl_proc_argssiop_adapterext2fsfifo_reclaimdes1_zerokeypipe_wfiltops__lshldi3cd_load_unloadpmap_activatebmtphy_resetmidi_getinfoconfig_make_softcunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readswap_syscall_lockufs_kqfilterieee80211_newstateem_is_valid_ether_addrums_enablescsi_autoconfcheckdirsexecswmulaw_to_slinear16_beSHA256_Update_intrt2560_set_txantennaumass_atapi_attachin6_are_prefix_equalin6_controlleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountwdc_atapi_the_machinepciide_dma_startehci_device_bulk_abortswcr_authcomputetrapsignalmainbus_bs_allocrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecevcount_attachlimcopybio_doreadwi_do_hostencrypttcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachcrypto_pool_initializedsiop_pci_cart_timer_initudsbr_cdnd6_useloopbackieee80211_next_modeputsaxe_tx_list_initehci_pcd_ablerip6statmulaw_to_ulinear16_le_mtstcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTi80321_pci_initsrv_ipohci_add_edwdc_xfer_poolusscanner_cdcdce_newbufbus_space_copy_2soacceptkqueue_pollcdgetdisklabeldb_call_depthdb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_optionscd9660_seeknd6_llinfo_settimermsdosfs_unmountelf32_load_psectionuftdi_writeSHA512_Finalrn_mpath_nextuhci_device_bulk_transferarm_pcache_unifiedmidi_out_startdb_add_symbol_tableuhci_remove_intruplcom_setm_tag_nextohci_intr1uaudio_id_namemsdosfs_writebs_notimpl_bs_w_1cue_resetcompat_43_sys_getdirentriesexec_script_makecmdsiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootdb_unaryrgephy_statusiophyattachselrecordffs_validatert2860_intrcomstopatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputext2fs_accessrt2560_read_eeprommld6_fasttimeokthread_qimaxwsmouse_matchohci_free_seduserconf_pdevuvm_object_printitiq80321_devmapmbpoolclock_secs_to_ymdhmstcp_canceltimerstqphymatchrip_recvspaceroute_initdb_store_countlink_rtrequestwdc_get_xferuvm_vmspace_poolstackgap_initpipe_createfifowrite_filtopssysctl_vnodepdc202xx_setup_channeliodatand6_sysctlpciide_amd_productspci_subclass_multimediavn_openuhci_freexif_clone_createcdce_tx_list_inituao_detachcpufunc_controlmallocamap_pp_adjrefapollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeueuhci_root_ctrl_startwi_cmd_usb__udivsi3tcp_outflagskqueue_statcdce_ioctluaudio_io_terminaltypecd9660_rrip_analyzeohci_hash_find_tdexphymatchbio_unregisteruriowriteip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statskipjack_setkeyvn_writemtdphy_serviceVOP_LINKubsa_devsicmp_inputuvm_km_free_poolpage1umass_cdvcountrd_root_sizevm_page_zero_enablein6_delmultistathzenc_xform_cast5wdog_ctl_cbuaudio_mixer_get_portsched_idleuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginbuckstring_inituhci_free_std_chainiq80321_pci_init2icmp6_rediracceptext2fs_vnodeop_opv_descdetruncdb_elf_symbol_valuescopyoutpfindcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4brgphy_5704_a0_bugarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopohci_allocxcopyrightsdattachxscale_optionswdc_default_lba48_write_regtcp_timer_keepusscanner_attachusbd_devinfo_vptcp_mss_updateiopiic_cdpciide_lookup_productfree_pagesffsfifo_reclaimehci_root_ctrl_startdb_proc_print_cmdrt2560_initrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferip6_sourcecheck_intervalroute_outputrti_deletevop_kqfilter_descsys_geteuidhostzeroisbroadcastchange_sign16_swap_bytes_bedb_output_positionicmpmaskreplin6_pcblookup_listenmsdosfs_mknodcd9660_specop_pip6_defmcasthlimsys_munmapsii3114_dmactl_writeudsbr_hw_iffilt_solistenvsnprintfarplookupuvm_map_pageableproftimer_trampolinechainallocuplcom_methodspmap_copy_page_xscaleifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tableip_mloopbackbpf_iflistwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbuftodr_handlend6_rs_inputwdc_atapi_real_start_2pciide_mapreg_dmasoabortlinear16_to_linear8_beuaudio_trigger_outputem_get_bufem_82547_move_tail_lockedcast_encryptunp_inologkqfilteruvm_tree_RB_INSERTdb_extent_print_cmduprintfsensordev_installdb_clear_single_stepuvm_page_printitmainbus_cai80321_local_dma_initrt2560_intrsoftdep_flushworklistsys_issetugidinitclockscd9660_mmapsd_reassign_blocksif_detachaue_watchdogmidiprintwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolvfs_bufstatsext2fs_specop_opv_descunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startudsbr_set_infopool_serialxscale_cache_flushD_SEuplcom_activatescsi_probe_lunirq_entryaue_ioctlsdrestartvfs_mountedondb_expressionboard_powerdowncputypert_lookupfc_lookup__bss_start__linear8_to_linear16_be_mtsif_downndqbfilt_rndreadallocsysVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratesiop_add_reselswuvm_km_pages_headwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headertcp6_usrreqrt2661_bbp_initdb_historyeephy_cdinphy_cdukbd_parse_descmidi_unit_countttytstamprt2860_mcu_bbp_readural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrcompat_43_sys_getdtablesizeip6_auto_linklocaluvm_pageunwirerti_fillhw_serialehci_device_intr_abortauth_hash_hmac_md5_96uvm_unmap_puaudio_halt_in_dmacdattachuserconf_deviceurioreadin_localaddrsys_sigaltstacki80321_i2c_casii3114_dmatbl_writeDES_versionbrgphy_resetsoisdisconnectingauth_hash_key_sha1Blowfish_initstatewi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_capcidetachucom_dtrrtredirectuvm_map_printitwdc_atapi_pio_intrdb_read_variableulpt_cdsoftintr_initdb_regsdb_stack_dumpttymodemdb_lbuf_endmtx_enteraxe_devskqueue_pooluaudio_mixer_set_portvntblinitallcftablesuhub_activatesleep_queue_initin6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedtcr1_get_timecountugenwritesys_setresgidmsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctludp6_recvspaceuvm_km_freeusscanner_intr_cbsys_killuserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirinsw16em_watchdogrt_setmetricssys_getegiddb_set_single_stepem_check_mng_modeserverworks_setup_channelumass_init_insystemem_validate_eeprom_checksumdirchkexphy_resetipip_outputpipeclosealaw_to_slinear16_le_mtsext2fs_fifoop_entriesVOP_REMOVEpci_mapreg_typewi_usb_activateconsiniturlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsc_pld_shminidatacleanrt_timer_queue_destroyrt2860_maxrssi_chainwi_cdsd_cdicmp_mtudiscipport_hifirstautosys_fstatem_read_eepromenc_xform_3desrgephyattachuserconf_enableukbd_sunlayoutext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetffs_alloccgcryptodevallowsoftem_driver_versionobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodeieee80211_dump_pktsys_unmountuvscom_dtruipaq_detachbootdvmainbus_bs_tagelf32_probesumct_detachin6ifa_ifpwithaddrvgonelpciide_jmicron_productssofreeeephyattachinphyattachuvscom_shutdowndb_del_symbol_tabledb_add_exprsiop_timeoutpmap_removebpf_mtap_afuaudio_determine_classrt2860_set_basicratesicmp6_fasttimoext2fs_removemtx_initif_clone_destroyehci_close_pipewdccommandmyipbpf_setfuserconf_historypciide_pci_cauvm_page_unbusyfilt_hotplugreadtk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enabledb_symformat_elfpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_vnodeop_pcd9660_deftstamphotplugkqfilteri80321intc_smaskip_randomidaudio_rintbrgphy_eth_wirespeedaue_tx_list_initieee80211_recv_disassocnosuidcoredumpukphyattachvop_poll_desccddumpdb_search_cmdasttcp_disconnectuvmspace_execuhci_timeoutwi_usb_detachsys_mmapehci_bus_methodsbootuaudio_hw_ifnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnameaudio_cddb_print_llinfocmd680_setup_channelpci_enumerate_busem_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfehci_detachsensordev_getufs_diremptyreinsertfinishduprt2661_newassocsleep_setup_timeoutukphy_serviceqsphy_resetdeflate_decompresspool_destroylogwakeupshutdownhook_listip_dosourceroutesoread_filtopsieee80211_media2ratebdevsw_lookupdisk_changeuplcom_matchsc_devsamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinitem_get_speed_and_duplexVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protobrgphy_funcsfilt_ugenread_isochw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_sensevirttimer_trampolineip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadem_rxeofrt2860_rate2mcsuhci_root_intr_methodsscsi_probe_buslminm_leadingspacesys_fpathconfarpt_pruneohci_device_bulk_methodssoconnect2knote_poolcnopennatsemi_setup_channelscsi_test_unit_readyural_set_bssiduscanner_activatericohrtc_reg_writearc4random_bytesnmbclustural_get_rfsominconnrt2661_mcu_wakeupuhci_device_clear_togglenchashtbluvm_vnp_syncieee80211_get_disassociopxs_cdwihap_assoc_requaudio_chan_ptransferarpt_downrt2860_shutdownrdgetdisklabelulptclosearm_pdcache_line_sizebpf_tapdb_lookuprt2860_tx_intrSHA256_Finalchange_sign16_le_stmmii_phy_autoukbd_bellmax_datalenmsdosfs_initohci_device_ctrl_startvop_readdir_descwi_write_record_ioext2fs_writelf_clearlockgeneric_armv4_bs_wr_2db_lastsymsiop_resetbusurl_memip_srcrouteuaudio_add_mixeruhidioctlip6_accept_rtadvieee80211_recv_4way_msg4pte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1usbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishfifo_pollumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthradioattachdb_putncharsau_get_mutesii3114_dmactl_readmainbus_bs_unmapnd6_maxnudhinttcp6_inputwdc_atapi_donesosetoptehci_set_qh_qtdtcp_msscache_purgeudav_stop_taskbpf_mcopySHA384_Finalcomconsrateauth_hash_hmac_sha1_96fork1curpcbdb_activeaudio_set_blksizevfs_hang_addrlistcue_tickdead_writeufs_dirrewriteinsmntquenumbufpagesttreadtk_canccdb_write_bytesrt2860_media_changeext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriesrt2661_set_chansys_chmoducomreadprelist_removeffs_vgetrt2661_tx_intraxe_encapinitproc__umoddi3arm_dcache_alignugenclosert2661_media_changeip6_log_intervalnull_encryptwihap_auth_requvm_page_physdumpX_db_sym_initsyn_cache_timerieee80211_auth_opensolisten_filtopsatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorcdce_detachvop_bmap_descrt2560_tx_intrrt_msg2suser_ucredmulaw_to_alawsd_shutdownwi_shutdownmem_noext2fs_buf_allochicleanpagesral_pci_matchatu_xfer_list_freeuhci_free_stdwihap_sta_deletepciaddr_resource_reservemainbus_bs_rm_2pmap_free_l2_bucketRMD160Update_intrevarprequestkernel_mapuhci_device_isoc_enterwi_init_iodumpdevwsmouseioctlcd9660_lockieee80211_mgt_subtype_nameugen_do_readchange_sign16_swap_bytes_le_mtsdb_not_taken_bkptuaudio_chan_initvfs_mount_foreach_vnodekqueue_kqfiltermidiclosewi_mgmt_xmitaudio_openuhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsrt2661_shutdownatu_tx_startrt2560_encryption_introhci_device_bulk_start__guardwdc_atapi_minphystcp_mss_advin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freevop_default_descurlphy_attachieee80211_get_assoc_reqscsi_inqmatchfdesc_poolcmd_pci_intrusbd_add_drv_eventpool_page_allocin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencbadaddr_read_4bzeroarmv4_drain_writebufufs_closefixjobcdb_show_all_cmdsehci_shutdownpci_subclass_daspscsi_execute_xsin6_addmultirn_newpairvop_setattr_descdb_find_breakpoint_heresd_kill_buffersbiossys_obreak__udivdi3blf_setkeyusbd_set_config_norgephy_cdusbpollpciide_cdieee80211_parse_wpa1lastddateucom_do_ioctlm_inithdrpmap_curmaxkvaddrin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotmbinitchange_sign8tcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKMD5Finalwskbd_matchieee80211_aes_key_unwrapcp_timeaxe_rxeofcd9660_vget_internallinear16_to_linear8_lert2560_decryption_intrdb_page_print_cmdwi_intrrw_casvgetrd_attachugenpollieee80211_create_ibssbrgphy_jumbo_settingswsmouseopenwinChksumserverworks_chip_mapfreeclusterchainmld6_initmainbus_bs_w_4disk_initcd9660_fifoop_opv_descohci_hash_rem_itdohci_bus_methodsatu_cdrip6_ctloutputnetiopciide_pci_writeaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpumass_cbi_transferext2fs_createem_local_timerusbd_bulk_transfer_cbexec_aout_prep_oldomagicwi_sync_mediavfs_opv_init_explicitpipe_pollnsphy_cabmtphyattachucomopensysctl_dopoolcd9660_fifoop_puhub_matchpmtu_expirecrypto_getreqtcp_respondsys_readvamap_cow_nowroundrobinbadaddr_readuvm_map_createvfs_opv_initissignalwdprintnetclsfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvprt2560_bbp_writeuvm_pglistalloc_simpleuhci_intr_setsoftintrigmp_joingroupinflateIncomprandompolluiomoveohci_device_isoc_doneoutsw16wi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackpciide_dma_table_setupfiq_releasebpf_reset_dslinear16_to_mulaw_lend6_dad_stophid_start_parseuseloopbackuvm_waitnexecsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdoguaudio_trigger_inputloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt2560_free_tx_ringumct_initpmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptipsec_auth_default_levelsys_mqueryarm_picache_line_sizekmeminit_nkmempagesspec_vnodeop_entriesusbd_new_devicefillinusemaprecvitfill_kproc2bmtphy_funcsums_cdfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchlog_openevcount_initfragtbl124userconf_totdevi80321_bs_tagrt2661_tx_cmdxscale_cache_flushIDieee80211_plcp2ratert_tablesrt_ifmsgwdc_atapi_real_startobio_bs_maprealitexpireipstatunix2dostimert2860_delete_keyscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_mscompat_43_sys_truncatecrfreecnputcuhid_do_writepte_l2_s_prot_wip6_lasthdrohci_device_isoc_abortuhub_uhub_caugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimert2560_tx_datauvm_swap_getaudiosetinfopciide_serverworks_productsext2fs_reloadurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetskipjack_backwardsphysmemuvn_flushurl_cdinferiorxscale_cache_purgeD_Eukbd_attachclusterallocext2fs_fifoop_pcryptof_readuplcom_cart_if_remove_rtdeletewskbd_attachin_pcbbindxscale_cache_flushIumass_cbi_statemtdphy_caudp_notifyuhci_timeout_taskuhci_root_ctrl_closenetrndintrendtsleepwihap_check_txuvm_pageratopsigactssharedb_set_watchpointbpfattachuftdi_openif_detach_queuesitimerdecrusb_create_event_threadether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeauth_hash_md5crypto_kdonebpfilter_lookupm_copym0axe_miibus_readregvm_physmemSHA256_Transformiso_shipdirrdwriternd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootnetlckbpf_allocbufsset_stackptrrt_gettablemsgbufmappedohci_device_setintrcomprobe1getphysbufcdsizedb_symbol_valuesuhci_device_ctrl_startumass_lookupscsi_deinitdb_evarsupl_activateiic_smbus_write_byteufsfifo_closewakeupgetnanotimeatu_devscompat_43_sys_sethostidpciide_matchrt2860_rf_writei80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_iocompat_43_sys_createnosyslockmgrrtlabel_name2iduvm_vnodeopsvfsconfrt2860_free_tx_ringVOP_OPENcompwroffurio_attachSHA384_Initbuckstringuhci_device_bulk_startrt2860_enable_tsf_syncsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesmsdosfs_vnodeop_pdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedbrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopendoscheckpathpcbmapaudio_readatu_newstateuscannerclosend6_option_inituvm_km_alloc_poolpage1brgphy_serviceaudiopollpiix_setup_channelext2fs_setsizein6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgidrt2860_set_keyuserconf_common_attrfilt_ufswritert6_flushrd_ioctl_serverehci_timeout_taskuvm_mlk_callatapiscsi_attachgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffieee80211_add_ds_paramsem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespcompat_43_sys_getsocknameuvm_errno2vmerrorsubkey_table_gendohookswdc_atapi_tape_doneem_pci_set_mwiieee80211_rssadapt_chooseehci_free_sqtd_chainem_disable_intrukbd_activatesiop_sdpem_poweraue_setmultiif_detached_ioctllocnampvop_close_descwi_usb_causerconf_showip_mtudisc_timeout_qaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridpool_setlowatehci_pci_givecontrolleruscannerpollkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulsys_sigprocmaskdb_commandrt2661_select_bandin6_if_upfilt_pipereadcompat_43_sys_gethostidsoreservepidtakendb_formatrt2560_reset_rx_ringuvm_mmapusb_activatescsi_report_lunsufs_quotactlradioactivatearoundin6_pcbnotifyusbd_clear_endpoint_togglestrrchrgetdevvpm_clgetpci_mem_findcompat_43_sys_sigvecdefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinodb_strlcpycfrootswsmousepollchrtoblksiop_get_lunswscsiprintuserconf_pdevnamminphysukbd_matchurl_ticktimeout_mutexcd9660_specop_opv_descether_addmultivop_mknod_desccdce_cdip6qffs_vptofhifunitvfs_isbusyirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsums_activatedb_breakpoint_cmdcd_powerhookvwaitforiomii_phy_tickuscanner_do_closecd_read_subchannelextendfilelortrequesticmp6_inputuserconf_addwdc_atapi_resetohci_device_intr_methodswi_func_iocreatedeuvscom_closesbreleasedb_history_sizemsdosfs_islockedieee80211_getmbufmax_linkhdrem_dma_freeumass_attachalaw_to_ulinear16_lecryptof_statudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimsqphy_serviceuserconf_hist_eoci80321_intr_disestablishuvm_map_reference_amapext2fs_getattrrtlabel_id2namesbdroprecorduvisor_activateuvm_coredumpem_write_phy_regi80321_handlerwdsizeacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreert2560_beacon_expireieee80211_alloc_node_helperrootdevaudio_fill_silenceehci_device_isoc_startufs_ihash_slockm_tag_firstmixer_closeem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogatapiscsi_detachusbd_ar_pipecy693_setup_channelrip6_sysctlext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readre_pci_probeusbd_reset_portrt2661_set_macaddruvm_mapent_copyifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configswap_bytes_change_sign16_be_stmcast_setkeydb_map_currenttcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatetcp_timer_2mslaue_openpipesudsbr_detachi80321_gpio_initffs_reload_vnodebuf_putif_addgroupmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointciphy_cdieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppumodem_paramffs_reallocblksrandomcloserootvpaxe_miibus_writeregem_print_hw_statsugen_do_writeieee80211_eapol_key_decryptuserconf_maxlocnamespool_reclaiminitdisklabelpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_opencddetachpmap_clear_modifytcpctl_varsarptimertcp_reass_limitruaddrdstrategym_copymsystemsbcopy_pageip6_freepcboptsdb_free_breakpointsif_uppiixsata_chip_mapumsm_cart2560_shutdownehci_intr1rt2860_enable_mrrrgephy_resetupl_intrucomprintural_matchVOP_BWRITErt_timer_queue_createwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopsys_openrgephy_funcsurio_matchinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangepgdeletert2560_next_scanuvm_pageidlezerowskbd_do_ioctl_scphtree_SPLAY_MINMAXdb_symtabsi80321_irq_handlerieee80211_media_changeucom_detachraw_attachural_set_rxantennadb_boot_sync_cmdastpendinguhci_noopether_ip6multicast_maxpipe_pooluao_initvop_abortop_descifa_ifwithrouteumidi_get_quirk_data_from_typespec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolrandomattachsys_sstkem_smartspeeddb_print_positionrtflushclonedb_radixgetblkem_tbi_adjust_statsdead_vnodeop_pxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectural_initvtypescompat_43_sys_sethostnamedata_abort_handler_addressrtrequest1__lshrdi3db_find_watchpointusbd_errstrtcp_identtcp_rst_ppslimrtrequestuhci_openifinitcd_load_tocunpst_recvspacezlib_versionkue_initxscale_cache_purgeIDraw_inputcd9660_reclaimrt2860_stopkue_ioctlfilt_logrdetachnd6_ifattachunpdg_recvspaceoutswm8pipe_closeaudio_draincd9660_inactivesoftdep_mountmsdosfs_rmdiruvm_km_getpagemsdosfs_fsynccfdataffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdb_elf_lookupm_tag_findinittodrblf_encadler32vputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqcd9660_setattrfilt_hotplugrdetachusbd_get_configcyhc_slockufs_quota_initz_freekqread_filtopsbrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbaudio_closexscale_cache_cleanIDem_read_part_numaue_csr_read_1cryptowriteieee80211_beacon_allocatu_attachubsa_get_statusbioopscpu_classesbpf_setdltpool_setiplmsdosfs_statfslboltpipe_initusbd_open_pipe_intrsyncerprocrt2560_set_macaddrufs_ihashinsin_setpeeraddrwdcactivateeephymatchinphymatchatu_taskwindow_inflatedb_readlinert2661_enable_tsf_syncether_ifdetachieee80211_recv_probe_requhidev_get_report_descuserconf_histcurrndstatsrt2860_ack_ratecy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledcurrent_intr_depthpanicstraudioioctlpdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeunpdg_sendspacesession0viscpywsmouse_do_ioctlE_abs_lunsw_return_Usedhw_vercopyin__umodsi3comparamsiop_common_resetural_stopudav_sendcd9660_defattruaudio_round_blocksizeohci_device_bulk_closeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_paritysigacts0pager_mapfindblkmajorntohlsorflushugen_caiophy_funcsttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharssyncdelaywi_usb_infofrmugenreadffs_mountext2fs_specop_entriesuaudio_chan_rtransfericmp6errppslimSHA512_Update_intbadaddr_read_2usb_desc_iter_initusb_neventslinear8_to_linear16_beuhci_add_intrconfig_process_deferred_childrenohci_ifcdxscale_cache_purgeID_Eluphymatchbs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_roottqphyattachusbd_finishsoftnet_intrhandbpf_getdltlistrt2860_startm_tag_getsb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_pollrt_labelscrypto_unregisterupl_watchdogsuid_clearttwriteatu_initchange_sign16_leehci_activatert2661_set_basicratesswapdev_vpre_miibus_writereguipaq_methodsdead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutunputcendluphyattachVOP_CREATEprobe_switchcdce_stopvop_readlink_descuvm_map_referencespec_ebadfphtree_SPLAYuvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitfifo_closeohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupem_setup_transmit_structuresre_eeprom_putbytemainbus_bs_mmapural_writeucom_cleanupcd9660_vnodeop_opv_descVOP_ABORTOPehci_pcdchange_sign16_swap_bytes_leem_identify_hardwareuhci_idoneuvscom_set_line_codingieee80211_hmac_md5_vdefault_chip_mapsys_acceptuvm_map_entry_kmem_poolwi_inquireehci_pci_takecontrolleradm1032cloneprobetcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachif_clone_listtc_windupsys_futimesrt2661_update_promiscsdgetdisklabelwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessmalloc_errintvlciphyattachin_losingrtmsg_3to4sis_chip_mapcompat_43_sys_sigblockVOP_SYMLINKgeteblkrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchcrypto_kregistervn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readdb_show_calloutrt2661_set_txpreambleaxe_cdpipespacefiqvectorohci_alloc_stdcmd646_9_irqackip6_sendredirectscast_decryptddb_sysctlukphy_caitimerfixip_stripoptionsieee80211_node_join_11gaxe_setmultisyn_cache_countulptuseinieee80211_add_xratesnd6_timer_chcpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapmidi_ointrdb_watchpoint_allocudav_ifmedia_changein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1uihashrijndaelEncrypttcp_keepintvlvop_reallocblks_descuvisor_detachvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocwrite_multi_1aue_tick_taskatapiscsi_cdcpufunc_faultaddressdb_preveephy_funcsinphy_funcsucom_hwiflowbswap32rgephymatchipsec_exp_first_userlphy_serviceusscanner_sensecmd_cbplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productssys_chownuvm_pagewireem_stopin6_joingroupsys_munlockhotplugattachuvm_anfreeuhci_bus_methodsdofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlemclpoolvfs_getcwd_commonset_cpufuncscttyioctlffs_vnodeop_psys_lstatfilt_rndwriteieee80211_recv_wpa_group_msg1ohci_timeout_taskohci_hash_add_tdiso_uiodirurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapfifo_vnoperatedisknamesmidi_iintrumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocuvscom_activatenullcnpollcuvm_km_initpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolrt2860_updateedcart2860_alloc_tx_ringnkmempages_minvop_mkdir_descukbd_accessopsusbclosesis96x_setup_channelpcipowerudav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtbletextifa_ifwithnetmemchrrd_attach_hookohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzssysctl_cptime2scsi_mode_sense_pageboot_argsSHA384_Updateumass_scsi_setupproc_pooluplcom_dtraue_intrmainbus_bs_wm_1udp6_inputsys_writert2661_next_scanmap_forwmergedb_get_valueural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedulptopenemul_flags_translate__bss_end__cnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2em_phy_resetdb_inst_countdb_read_lineusscanner_cawdc_ioctl_findsiop_productswd_get_paramsbread_clustersys_readlinkrt2560_setup_tx_descext2fs_sizecpufunc_faultstatus__ashrdi3bs_notimpl_bs_mmapohci_intrxscale_cache_flushI_SEpmap_dump_ncpgip6_auto_flowlabelsvwsata_mapchanuipaq_cafintek_worklistlf_splitifafreeVOP_STRATEGYtzucom_rtsxscale_cache_syncIrip_sendspacexscale_cache_cleanID_rnguhidev_writeamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authswap_bytes_change_sign16_be_mtsrt2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_startSHA512_Initwi_func_usbulptioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcsoftclock_siem_82547_fifo_workaroundwi_usb_threadin6_pcbsetportalldevsrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnpmap_dumpcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufi80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlX_db_sym_numargsnd6_maxndoptip6_iduvm_map_clip_startffs_fragextendrawcbtablespec_readfiq_nullhandler_endumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutpmap_zero_page_xscalettyread_filtopsiic_printusbd_bulk_transfervop_lookup_descdb_map_addrgetinoquotafifo_ebadfscsi_do_ioctlrtable_existsehci_free_sqhcd_resetX_db_foralluhci_pci_cascsi_detach_busudpstatsetrootcd_read_tocural_amrr_updatecdioctlcue_stopuvscom_detachifmedia_addatu_usb_requestlxtphy_funcsskipjack_zerokeyusbd_set_config_indexlogopenluphy_serviceieee80211_add_rsn_bodyrt2560_txtimert2661_rxratebreadntcp_hdrsztcbtableieee80211_recv_4way_msg2i80321_mem_bs_init__xordi3frag6_draindosdiremptyigmp_slowtimoifpromiscip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupvop_fsync_descricohrtc_cawi_usb_intrusbd_alloc_buffermask_rnheadproc_isundersi_headpte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRusbreadpmap_kremovesigactsinitohci_pci_caarc4random_countusbd_set_reportcpu_kcore_hdrexec_elf32_fixupradioopenrt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttyuvm_pagealloc_stratural_bbp_readusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredmld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocoltcp_drainpmap_l2dtable_ctorm_pullupenterpgrpxscale_tlb_flushID_SEnull_zerokeycrypto_freesessionMPFailcnbellm_copydatainswm8wdc_atapi_timer_handlerumass_atapiscsi_devatu_stopcd_setchanuaudio_value2bsduvm_cnt_headieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4uaudio_feature_namettymallocupl_attachums_intrieee80211_recv_probe_respbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctldb_nextumass_matchsendsigohci_device_ctrl_methodsbpf_ifnameehci_allocmohci_cdural_ioctlvfs_busytimecounterfilt_ufsdetachlf_getlocksolistenpdc205xx_drv_probewskbd_compose_valuepciide_dmactl_readobio_bs_unmapiic_scanip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnem_set_promiscuserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectusb_all_tasksfs_sysctlukbd_cnattachieee80211_ibss_mergeboot_filefilt_sordetachpsignalieee80211_regdomain_compare_cnconfig_pending_incrsys_osigaltstackusb_task_threadamap_pp_establishatu_activateuvm_anon_initffs_reclaimbmtphy_causb_free_devicexscale_cpufuncsif_link_state_changepmap_virtual_spaceieee80211_eapol_key_check_micpage0_endusb_disconnect_portieee80211_add_capinfobpfpollupdatepriohci_activateciphy_fixupbmtphy_servicesched_kthreads_createuhci_device_bulk_closeumidi_search_quirkulinear8_to_linear16_be_mtsuhid_cdwskbd_cnbellbintimeuhci_intr1pciide_print_channelsjmicron_chip_mapoutswwi_seekfilt_soreadpmap_remove_allrtable_addrt2860_mcu_bbp_writezeropageipsec_def_encbrgphy_bcm5401_dspcodeffs_nodealloccgsoftintr_establiship4_input6pdevinit__iordi3inetctlerrmapffs_specop_opv_descresetpriorityau_set_portrt2560_set_slottimeenoioctlrt2860_watchdogwi_usb_start_threadsigacts_poolpcaled_matchexecsigsconfig_initcpufunc_null_fixupip_weadvertiseskip_fcicmp6_redirect_inputrw_enteraue_read_macpciaddr_print_devidmixer_ioctldb_access_abt_spscsistrategynd6_ra_inputffs1_blkprefin6addr_loopbackttypendin6addr_linklocal_allroutersqsphymatchin_revarpinputstrlcpycompat_43_sys_sigsetmaskX_db_symbol_valuesieee80211_wep_cryptiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descext2fs_advlockknote_fdcloseehci_device_intr_doneif_clone_detachpipe_rfiltopsubsa_openin6_cksumcomcninitpciide_print_modesstrncmpieee80211_map_gtkvfs_opv_numopsdes1_decryptvfs_shutdowngetsockieee80211_get_deauthbs_notimpl_bs_c_4upl_startin_interfacessyn_cache_respondif_creategroupllinfo_nd6sbcheckreserveuvm_iopreemptbioattachieee80211_begin_scanunixdomaindb_next_free_breakpointuvm_tree_RB_REMOVEscsibusattachetheripstatumct_rtsaudiowritesyn_hash1ulminwihap_data_inputi80321intc_do_pendingdb_last_symtabproc0paddrrn_addmaskpciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_pollumodem_activateulpt_attach_randseedrtafidx_maxsig_filtopsohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2860_reset_rx_ringrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapnet_sysctlcom_cduaudio_identify_acxscale_cache_cleanD_Ewskbd_do_ioctldead_ioctlfill_eprocaue_initusb_match__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonersrt2860_set_txpreamblewdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusageswcr_sesnumlf_getblockpciide_irqackusbd_add_dev_eventumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intruaudio_unsignextfifo_reclaimieee80211_parse_edca_params_bodysbappendstreamrt2661_bbp_writem_tag_copy_chainohci_handoverusbd_intr_transfer_cbusb_event_threadsowrite_filtopsstrncpycseaddrevarp_in_progressdb_disasmsdreadicmp6errratelimsys_opipelinear16_to_ulinear8_leupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodeproc_stopvfs_vnode_printdb_history_lastrrticks_initusbd_set_port_featurebpfilter_createsysctl_lockcdrestartlockfpoolwihap_disassoc_reqaudioread_filtopsieee80211_find_nodecpu_switchtoucom_cahtonluvm_km_kmemallocusb_find_descin6_mask2lentcp_dooptionsdos2unixtimesys_sigactiondeupdatehci_ifcdrndlock__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskuvm_tree_RB_FINDcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initbmtphy_statusdisk_unbusysysctl_fileugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememetherip_sysctlVOP_PATHCONFumass_fixup_sonydk_mountrootdb_run_modeauth_hash_key_md5siop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofumct_paramuhidev_attachfrag6_nfragpacketsdb_linein6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlite_chip_mapVOP_READLINKumass_cbi_methodsdb_ed_stylemii_submatchuvmexp_printohci_root_intr_transfermsdosfs_pathconftimeout_wheelbpf_m_xhalfaverunnablecd9660_getattrttyfreettysleepehci_root_intr_donert2860_rx_intratu_get_opmodeunp_disposerd_open_hookscsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closeuvm_km_pgremoveramdisk_ndevsex_region_plfscaleffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachsys_dupulinear8_to_alawmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_topci_find_deviceswcr_initenc_xform_skipjacktimeout_tododb_lccpu_read_cache_configumsm_detachwdc_sii3114_vtblpanicget_pc_str_offsetrt2860_next_scanL_cksumdataciphy_resetural_rxeofcue_rxeofmsdosfs_lockseltruepci_subclass_systembpf_m_xwordieee80211_recv_group_msg2softdep_initializestackgap_allocncvhashtblunp_shutdownieee80211_tkip_encryptwi_resetdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuewdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpte_l2_s_cache_mode_ptdeferred_config_queueciphy_funcsucomreadcbipport_lastautouhci_endpdsis_setup_channelcd9660_fifoop_entriescom_raisedtruaudio_chan_opendb_last_commandicsphy_statuswinSlotCntvn_kqfilterfiq_getregsext2fs_synci80321_io_bs_unmappte_l2_s_prot_maskcryptoreadpciide_intr_flagudav_ioctlcrypto_registercache_purgevfspostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readdb_object_print_cmdrt2860_select_chan_groupfintek_write_regohci_initcomopensata_setup_channelusbd_setup_xferieee80211_tree_RB_MINMAXpiix_chip_mapbcopyiic_attachwsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applygeneric_bs_rr_1axe_resetdefrouter_addreqin6_clearscopefifo_vnodeop_entriesusbd_set_addressaudio_free_ringudav_openpipesffs_setblockipsec_expire_acquirekue_stopatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionumct_dtrieee80211_rate2plcpmsdosfs_createcd9660_startdb_output_linecomstartdb_examinecfroots_sizedb_end_linetickadjpool_alloc_item_headeriq80321_irq_mapsiop_clearfifotcp_secret_initsbreserveslinear16_to_alaw_be_stmundefined_initvrecycleem_phy_hw_resetubsa_matchextent_printaudio_caieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listcompat_43_sys_lseeksysctl_stringsys_rebootrt2860_txtimepmap_dump_allbufpoolMCFailwdccommandext_bus_dmamap_load_buffercompat_43_sys_getpagesizecpu_forkumidi_activateaudioopenwi_write_data_iodb_print_ifattylistwdopenuvm_vslockre_initcast5_setkeydeflateResetpci_ndomainsttyoutputkue_cacd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdwdc_atapi_intr_completecryptodev_cbumodem_detachuhci_root_intr_abortrn_mkfreelistvop_bwrite_descVOP_READin6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimegetdisksys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureufs_quota_free_blocks2re_stopsenditudp_detachcompat_43_sys_waitcluster_writernd_event_tailuriopolluvm_setpagesizeehci_root_intr_closetcp_xmit_timerucomwritein6_recoverscopeskipjack_encryptnsphy_serviceaue_ticki80321intc_cdcompat_43_sys_fstatticksvwsata_write_regmclpool_warnmsgi80321intc_cadb_termscsi_preventmmcloseieee80211_get_assoc_respnumfreepagescd9660_accessffs_statfsuhci_shutdownrijndael_set_keywdcprobeiophy_cdudp_recvspacewdc_ioctl_strategyuaudio_cai80321_mainbus_matchbus_space_copy_1syn_cache_unreachuserconf_histszsys_getrlimiti80321_mainbus_foundbpf_attachdfintek_cdicmp6_ctloutputulpt_statussvwsata_dmactl_writeufs_dirremoveumct_setworkq_init_syswqrgephy_serviceieee80211_add_timcinitif_attachsetuppipe_writevop_symlink_desccryptof_pollin_pcblookup_listensbappendm_copybackuvm_swap_puticmpbmcastechofifo_advlockSHA512_Updatedb_continue_cmdrt2661_mcu_beacon_expireehci_timeouturio_activatebufheadconfig_scanwi_get_nwkeypmap_copy_page_funcscsi_runningripsrciso_nchstatsem_update_eeprom_checksumkue_txeofugenkqfilterural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachusbd_devinfo_allocinflateSync__wdccommand_doneumass_adjust_transfersignal_initffs_updatedb_print_formatrt2560_tx_bcnunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachip6_ecn_ingressusb_discovercomdiagextralocunsleepwdprobeX_db_lookupmtdphy_funcsuipaq_seti80321intc_matchblf_encryptohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachudav_activatei80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemmainbus_bs_w_1ext2fs_symlinkdb_skip_to_eolip6_savecontroldevice_registerau_check_portspciide_chan_candisableq_to_bmountrootsyn_cache_resetdb_inputcharuhci_device_intr_doneuhidev_opendb_boot_cmdsundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_sensein_mask2lenural_eeprom_readusscanner_detachlodirtypagesem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initcompat_43_sys_getkerninfostart_init_execatu_detachifa_ifwithaddrclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferdb_write_cmdif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategyem_config_collision_distnatsemi_irqackkmemstatsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthfilt_audiordetachmalloc_printitulptwritecpu_idle_entercomwriteuvscom_intrVOP_RENAMEcdclosecast5_zerokeysys_fchdirsysctl_ifqprocess0ieee80211_send_eapol_key_reqrandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdre_ioctluaudio_query_encodingieee80211_hmac_sha1_vsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVEuaudio_add_processinglastsecondswdog_timeoutpci_probe_deviceuaudio_signextwsmousedoopenwi_get_txpowerural_plcp_signaludav_stopbrgphy_statususbd_error_strsusbd_sync_transferaudioactivateffs_vnodeop_entrieslun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initsync_vnodeop_entriesproc_reparentrt2661_select_antennacompat_43_sys_senduvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildsvwsata_dmacmd_writebootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctlsys_xfspioctlif_free_sadldb_dotucomstopieee80211_node_joinfilt_bpfrdetachumodem_openicmp6_initdisassemblebs_notimpl_bs_rm_1filt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrpool_set_ctordtorcy82c693_readrandom_statebpf_moveiniq80321_hdlg_irq_mapostypevndbuf_poollastpiduplcom_resetuvm_page_physloadaudiogetinforeset_entryucomstartwdc_exec_xferwdcresetipintrqohci_noopudsbr_statusmaxprocusb_frag_freelistip_slowtimordsizeuaudio_add_inputrijndaelKeySetupEncrt2860_load_microcodeubsa_rtsip6_nexthdrrtdeletemsgsize2cqueueumidi_cd__bss_startdcphy_cdpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncvop_rmdir_descdeflate_compresswskbdreadsbappendrecordevcount_detachsd_causcanner_seltrue_filtopsixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachpciide_intel_productsuipaq_dtrconfig_activatememsetcuio_copydatapipe_free_kmemufs_getlbnsohci_strphysioin6_selecthlimupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asynccrypto_kdispatchicmp_mtudisc_clonert2661_rf_writesodisconnectpool_allocator_oldnointr_spllowerumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsthreads_pendingucomttyohci_device_bulk_doneusbd_initmtdphymatchuplcom_opensiop_lookup_productural_set_basicratesip_flushmidipollieee80211_crc_initkue_startre_watchdogaudio_pollsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errordb_hangmanukbd_delayed_decodebs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsaudio_pintrt2860_iter_funcvholdpciide_map_compat_intrubsa_parityurio_detachdb_help_cmdrt_if_removewdc_atapi_in_data_phaseusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchmidiopenm_adjalaw_to_ulinear8mld6_stop_listeninghotplugioctlsvwsata_read_regpmap_map_chunkppsratecheckscsi_free_xscompat_43_sys_setrlimitkmemlimitrt2560_rf_writeamap_copyphysical_enduvm_rb_spaceuhci_allocmuhidpollieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_maplf_findoverlaplf_wakelockdb_sym_numargskue_attachhookdumpconfwi_rxeofehci_pci_detachskipjack_forwardsbrgphy_cahpt_pci_intrfilt_rndwdetachdead_badoppciide_dma_finishblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgateulpt_activatetcp_ack_on_pushpmap_growkernelext2fs_rmdirsysctl_intupl_tx_list_initkqueue_closepte_l2_s_cache_modeuvn_initstrlcatifnet_addrssysctl_int_arrulinear8_to_mulawau_set_gainbs_notimpl_bs_wm_8cdce_matchumidi_quirklistsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremieee80211_recv_4way_msg2or4cttywrite_bus_dmamap_createurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_cauaudio_chan_pintrext2gennumberudav_attachusbd_get_hid_descriptorrt_ifannouncemsgsoo_readpciide_vendorsufs_opencopyout_statfspmap_modify_pvehci_pcd_enablei80321_intr_establishm_catsplxohci_pci_attachrtinittqphy_statuscluster_collectbufssiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inituaudio_chan_alloc_buffersuaudio_add_featuretcp_nowttystatsaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodemsdosfs_vnodeop_opv_desclba2msfiq80321_pci_intr_mapre_miibus_readregtimeout_setrdread__subdi3ntohsmsgbuf_putchar_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntermii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishdupfdopeni80321intc_calc_maskchange_sign16_beifmedia_list_addpidhashvfs_mountrootrt2661_updatestatsxscale_context_switchuvm_totalencdebugdb_unread_chariic_searchstart_initelf32_olf_check_headeruhub_attachieee80211_recv_assoc_reqsysctl_tc_hardwarert2661_prepare_beacontcp_mssdfltrt2661_alloc_rx_ringrt2860_updatesloti80321_bs_unmapuvm_swap_freewdc_atapi_update_statusatu_newbufdata_abort_handlerbs_notimpl_bs_r_1axe_initrnd_wseldb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updradiodetachcd_sizettycheckoutqrt2560_watchdogread_multi_1piix_timing_debugicmp6_mtudisc_callback_registerdb_set_variableuvscom_set_lineaue_carnd_event_spaceswap_bytes_change_sign16_le_mtspmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabwdc_atapi_intr_commandip_forwardextent_createrdclosebpf_freeddisklistslinear16_to_alaw_leswap_bytes_change_sign16_besys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setudav_setmultiip6_mforwardingnd6_setdefaultifaceffs_isfreeblocki80321_mem_bs_freeuvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatevop_pathconf_descbs_notimpl_bs_w_4m_pullup2ieee80211_get_probe_respdead_strategypciide_dmacmd_readswi_handlerspec_fsync__wdcwait_resetip6_optlenuvm_map_deallocateicmp_reflectmii_phy_activateext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupsurio_cdieee80211_node_attachuhub_cduvm_km_pages_freewi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startbrgphy_mii_phy_autoohci_devd__end__kinfo_vdebugnsphy_reseturl_sendcdce_encapuvm_rb_insertufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_lockaes_ctr_setkeyumct_attachurl_resetwdc_get_logusb_needs_exploreufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startwsmouse_cdricohrtc_settimeVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneem_shutdownuvm_anon_pageinspec_closecd9660_closeem_initialize_receive_unitsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinetc_adjfreqrnd_statesm_gethdrem_dma_mallocugen_activateconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namericohrtc_attachsysctl_rdstruct__divsi3uhidev_cdumass_scsi_devwsmousereadxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledswihap_sta_timeoutsiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesdb_access_und_spcompat_43_sys_quotaipv4_inputm_getclrpool_headwdc_atapi_send_cmdusbd_interface2device_handlepcaled_cdipforwardingdb_lexohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalaudio_calc_blksizebufhashtblsyn_cache_lookuparc4random_stateprtactiveaudio_mmapksym_upcaseufs_makeinodeip6_process_hopoptsufsfifo_readusbd_find_edescfifo_writefilt_ttyreadsys_getpgiduhci_runcom_common_putccache_lookupaudio_clearrdioctluhci_allocxin6_purgeifobsd_pci_mem_findrijndaelKeySetupDecdb_boot_crash_cmdsysctl_tcurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writein6_ifawithifpieee80211_recv_mgmtaxe_detachdumpsizepci_matchbyidukbd_keydesctabusscanner_devextent_freeuvm_aiodone_daemonusb_cookie_noi80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featuresc_err1ieee80211_send_4way_msg3db_mount_print_cmdcomcloseiopxs_mainbus_casetsigvecsys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodestrcmpsys_quotactluhidev_matchrndread_filtopsieee80211_get_hdrlentcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cdhook_disestablishexphy_funcsudsbr_setfreqbpf_catchpacketffs_isblockucomwritecbdb_stack_trace_printusbd_find_quirkuaudio_getuvm_aobj_poolhotplugcloseuscanner_do_readdb_show_frame_cmdsys_adjfreqpci_cadb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initata_set_modevop_access_descmii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubrevarpwhoamiieee80211_get_ratevop_generic_islockedrt2860_reset_tx_ringauth_hash_hmac_sha2_256_96uaudio_match_altbufcachepercentm_pulldownacer_pci_intrpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanudsbr_startpmap_zero_page_funcarmv4_tlb_flushD_SEminbuf_inituhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regukbd_cngetctcpcb_poolz_errmsgrt2860_updateproti80321_pci_make_tagBlowfish_stream2worduhidcloseipip_allowsys_pollalaw_to_slinear16_beuvm_map_clip_endufs_makedirentryusbd_set_configem_write_pci_cfgvnode_hold_listlastdosdateudav_unlock_miiuhci_add_bulkral_cdufs_linksys_mkfiforicohrtc_matchdb_cmd_searchifa_ifwithafural_read_eepromin6_leavegroupsqphy_caem_reset_hwsddumpiminsys_chflagsslinear16_to_mulaw_le_stmobio_bs_tagslinear16_to_mulaw_be_stmdelaysdstartdb_machine_command_tableskipjack_decryptddb_regsieee80211_media_initricohrtc_gettimeipforward_rtableiduvm_km_putpagecom_enable_debugportpage0_dataext2fs_vnodeop_pvn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncwi_setmultiuvn_clusterre_gmii_writeregfifo_opencd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueswap_bytesums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusdb_cmd_loop_donearptfreeubsa_detachfilt_ugenread_intrdb_show_arptabcom_detachieee80211_ccmp_encryptfifo_vnodeop_pvop_write_descaxe_stopbs_notimpl_bs_w_2ural_set_macaddrdead_printeephy_serviceinphy_servicemii_media_tableswap_bytes_mtswdstrategyrt2860_set_macaddrttyprintfi80321_pci_bus_maxdevssigcodedb_elf_search_symbolhpt_chip_mapipip_inputieee80211_send_group_msg2db_delete_watchpointcomttyukbd_bell_fn_argbuf_undirtysysctl_tstringdb_watchpoints_insertedxscale_cache_cleanDusbd_start_nextfilt_ttywdetachuvm_tree_RB_INSERT_COLORamap_swap_offpool_allocator_nointrvop_unlock_descsys_sysarchrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediaputphysbufcpu_reset_needs_v4_MMU_disableMD5Initem_txeofpcaled_gpio_pin_writecryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlcpu_info_storeieee80211_outputusb_dev_openfrag6_slowtimouvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorphtree_SPLAY_REMOVEmsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchboot_eaddrscsibusactivatend6_timercomcnpollcuaudio_bsd2valuevop_open_descatu_matchbioopenqsphy_servicecd_patterns__cmpdi2crypto_workqsd_ioctl_inquiryraw_detachaudiodetachpmap_get_pdeural_read_multibooted_kernelcompat_43_sys_stataudio_writemulaw_to_ulinear16_lebs_notimpl_bs_wr_1domainnamelenehci_pollpciattachigmpctl_varsusbd_get_report_descriptorip_rtaddrfiledesc_initrt2661_enable_mrrload_dsard_server_looptag_switchurl_ifmedia_statuspciide_pci_readatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmohci_alloc_sedem_set_media_typeem_update_link_statusprtrealloccheck_consoleamap_freein6_domifattachwdc_atapi_reset_2ugen_get_alt_indexswreadusb_blk_nfreend6_prefix_lookuptc_getfrequencyrt2661_mcu_cmd_intruhci_device_ctrl_methodscddonesync_inactivespec_printlocleanpagesarc4_stirext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokeohci_hash_add_itdfifo_printusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachradioprintext2fs_renameipsec_def_authmii_activateuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startumidi_hw_ifwskbd_default_keyrepeat_datacomcnmodeclosefvop_rename_desccomioctlumass_cbi_resetsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickcd_kill_buffersip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtssensor_task_unregisterehci_intrlist_timeoutpool_print1db_breakpoint_listip6_copypktoptscd_get_parmspmap_extractrt2860_set_channd6_ifptomacwsmousedoioctlamap_unaddural_watchdogbooted_devicecd9660_printohci_rhsc_enableif_congestionnfilescd9660_islockedswap_bytes_stmuscannerreadbqpagesin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutrevarpwhoarewecue_txeofatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilternforce_pci_intrext2fs_openpmap_devmap_find_pausb_insert_transferaxe_matchmsdosfs_vnodeop_entriesukbd_keymapdatamulaw_to_slinear8stopprofclockdb_hangnullioctlukbd_is_consolecertance_irq_mapcryptof_closepte_l2_l_cache_modeisohashrt2860_rssi2dbmparsediskumidi_print_quirkre_eeprom_getwordalaw_to_slinear8rt2860_calibwi_set_debugbreadem_intrieee80211_node_copyamap_lookupipctl_varsapollo_setup_channeluaudio_chan_rintrpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readrt2860_free_tx_poolwdc_output_bytesatu_ioctlieee80211_classifyudsbr_matchproc_stop_sweepieee80211_media_statusiophy_capmap_set_pt_cache_modemichael_keytcp_usrreqdb_playsieee80211_setbasicratessd_interpret_senseudp_usrreqifmedia_initext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfilteruaudio_add_processing_updownfifo_pathconfcpu_startupcompat_43_sys_lstatamap_refehci_device_bulk_transferuhci_device_isoc_transferfilt_fifordetachdb_command_loopwdc_ioctlamphyattachfilt_fiforeadrt2661_updateslotfdexpandtickssrandomwdc_ata_presentpdc20262_dma_finishmsdosfs_closepool_do_gethotplugreadext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intruftdi_activateurl_setmultiusbd_get_device_descre_setmultiwdc_default_write_raw_multi_2uvm_pagedeactivateuscanner_attachlinear16_to_ulinear8_le_stmcy82c693_initufs_unlockmainbus_bs_r_2tcp_ctloutputrt2860_mcu_cmdrt2661_plcp_signalukphy_statusieee80211_derive_pmkidMD5Updateblktochrvop_create_descifmedia_setem_setup_interfacebio_lookuppmap_createuvm_map_extractnd6_prelist_addufs_removesysctl_tc_choiceboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdwdc_atapi_intraxe_watchdogfrag6_inputuhci_device_intr_closeunpst_sendspaceffs_indirtruncieee80211_add_ratestcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolcryptopollpci_detach_devicespmap_pageidlezeromulaw_to_ulinear16_bemii_phy_statusmsgpdc203xx_irqackcpufunc_domainsieee80211_hmac_md5VOP_PRINTfdsharepci_subclass_memoryicmpv6ctl_varsfintek_matchcdstartfilt_generic_readwriteuserconf_disableumct_methodsvrefin_scrubprefixusb_detachipforward_rtuhci_device_intr_startdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateuvisor_cddb_set_temp_breakpointdb_buf_print_cmdinpcb_pool_initializedsys_nosysat_pollallproccdevswxscale_cache_flushDumodem_get_statusuaudio_process_assys_mlockallwskbdcloseuvm_sysctlmalloc_lasterruscanner_cdgetsn_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolrt_timer_countvfs_buf_printuhci_device_intr_transferusscanner_scsipi_cmdpowerhook_disestablishcryptodev_opworkq_destroyfilt_audiowriteukphymatchuvm_pager_putohci_device_bulk_abortudav_caip6_ecn_egressin_canforwardohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyscsi_mode_selectkernel_pt_listpowerhook_listetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mapvfs_getnewfsidaue_rxeofem_cducom_attachudp6_ctlinputitimerroundarm32_vector_initwdog_shutdownscsi_print_sensewskbd_update_layoutwdc_cdmmopenffs_inode_freeSHA384_Update_intohci_device_intr_transferpci_findproductamphy_statusukbd_intrrtioctlkue_ctlieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputsleep_finish_signalicsphy_cdwi_usb_cmdrespgeneric_armv4_bs_rm_2route_srcspeedup_synceraudio_blk_msigmp_sendpktloop_clone_destroyrt2860_eeprom_readwdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcm_getptrukbd_cauhid_activateufsvnode_filtopsreadbuffersuvm_fault_unwireuserconf_common_attr_valuhci_add_ls_ctrlobsd_pci_io_findumidi_detachext2fs_vnodeop_entriessys_getitimerhid_get_datadonicewdcstartetherip_inputcpu_configureohci_pci_attach_deferredinit_cryptoip6_freemoptionssqphy_funcsaudio_alloc_ringieee80211_amrr_chooseieee80211_end_scancdce_txeofpool_page_alloc_oldnointrpmap_fault_fixupdcphy_servicern_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelvop_generic_abortopsetregsupl_rxeofusbread_filtopssobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcnclosedb_tok_numbersddonetcp_do_rfc1323ip_fragsfilt_fifowdetachwdc_dmawaitmii_phy_setmedialo0ifphostidpool_chkaudio_ioctlwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutipqmaxlenext2fs_vptofhnam2blkip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessurioioctlrt2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodsuvmspace_unsharesys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_createem_hash_mc_addri80321_timer_initeduvm_map_cleanicmp_redirtimeoutworkq_add_taskulinear8_to_linear16_lettyclosewdrestartugen_isoc_rintricmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheobio_bs_freecmd0643_9_setup_channelural_write_multicpu_initclockscue_sendwskbdioctlmii_downrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miiaudiokqfilterttyoutdevice_lookupuvm_map_pehci_device_requestDebuggersched_qsbqpagelowwi_usb_txeofudsbr_stopcdminphysnumcleanpagesschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputre_setpromiscuvm_tree_RB_MINMAXtcp_totbackoffuserconf_baseSHA256_Initpci_subclass_displaylooutputcue_setmultirijndael128_zerokeysoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonepmap_clearbitcrypto_freereqieee80211_mgmt_outputclrbitsdb_boot_dump_cmduvn_putxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorcrypto_newsessiongeneric_armv4_bs_r_2soclosescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonuaudio_get_minmax_ratesskpcrd_sleep_priluphy_funcsdb_leohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8compat_43_sys_mmapvop_read_descboard_startupsys_socketpaircnreadpcimatchcertancepci_addr_fixupudp6_sendspacedounmountuvm_swap_allockthread_create_nowalaw_to_ulinear16_betcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizettspeedtabulinear8_to_linear16_le_mtsns_scx200_setup_channelkqueue_readieee80211_add_edca_paramscd9660_mountuserconf_maxdevre_pci_attachcue_initfork_tfmratesiop_del_devacard_setup_channellxtphymatchusscanner_sensei80321_bs_initpv_sizeuvn_sync_qwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutiszerodevuhci_devdciphy_causcanner_matchupl_inputauth_hash_hmac_ripemd_160_96ieee80211_recv_pspollumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthprobe_addrs_eepromif_attachdomain1raw_recvspaceieee80211_amrr_node_initdiskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadem_media_statusehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportconfig_pending_decrqsphyattachaxe_startsoqinsquediskstatsums_detachcdce_attachdes_ecb_encryptudp_inputnchrtoblktblbooted_partitionihashrn_search_mresettodrpcaled_attachufs_readdirgeneric_softclocksys_flockarc4random_initializediq80321_startpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatradioioctlmichael_finalvn_initialize_syncerdrt2860_get_rfxscale_controlcd9660_quotactlicmp_sendadjtimedeltauhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogsiop_ppr_negwdc_ata_errbsdi_stringstime_uptimecdce_intrfilt_uhidreaduvn_wlistsowakeupinsidebs_notimpl_bs_r_4db_putstringprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachrijndael128_decryptttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashremsensor_findip_fragmentfilt_timerusbd_endpoint_countuvm_km_mtxsys_statfsSHA1Finalsensordev_deinstallinittimecounteruaudio_attachrawin6pcbtablepmap_protectslinear8_to_alawkprintfdevice_unrefulpt_matchrc4_keysetupdcphy_matchscsi_startin_cksumvnode_poolrt2661_rx_intrdeflateInit2vnode_free_listtcp_savetiuvm_pagereallociicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadaudioprintpool_printitubsa_flow_endpciide_attachdes_check_keysogetopthid_report_sizearc4maybeinitricohrtc_cdmidiwritedb_deletewatch_cmdarp_intimerpollscandomaininitsii3112_setup_channelvflushbuftime_secondacer_chip_mapip6_forward_rtusbd_get_interfacewskbd_get_mapentryusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachuaudio_add_altieee80211_setup_nodebioioctldvd_read_structcompat_43_sys_getpeernamevdevgonehtonsehci_pci_attachubsa_setdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scanaudio_selwakeupcominitrt2560_newassocieee80211_add_pmkid_kdeenodevobio_bs_barrierffs_mountfsudsbr_reqin_delayed_cksumslinear16_to_alaw_bein6_is_addr_deprecatedfintek_fullspeedi80321_mem_bs_allocicmperrppslim_lastrtstatttvtimeoutatu_startabtstackspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEpte_l1_c_prototcp_syn_cachehaltpciide_sis_productseephy_cainphy_cawihap_sta_is_associeee80211_std_rateset_11akputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initwi_write_record_usbcompat_43_sys_sigstackcue_csr_read_2uhci_device_setintrukbd_bell_fnm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollural_startsensor_task_ticksys_swapctliic_dumpbd_reqwskbd_set_mixervolumebs_notimpl_bs_rm_2in_selectsrcmsgscpu_exitip6_initpktoptsworkq_threaduvn_getbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamernd_rselusbd_nbusesfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusrtalloc_mpathsii3114_chansetupxscale_cache_purgeDuaudio_match_alt_chandisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnsbflushehci_device_intr_transferipsec_require_pfsswapdevsiop_devwd_cakue_sendsysctl_intrcntaxe_tick_taskvn_readbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closestatminehci_root_ctrl_closewihap_sta_allocem_fill_descriptorscast5_decryptxscale_setuprt2661_set_bssidpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolbufq_default_addif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_rateinvalhashuhci_rem_loopuvm_km_page_initrttimer_poolieee80211_regdomain2flagrt2560_rxratergephy_load_dspcodeusbd_get_config_descsosenddosetrlimitrn_initieee80211_set_timcmd_channel_mapbufq_default_getloopattachusb_match_devicesiop_update_residuscanner_detachural_rxrateieee80211_save_iewdc_input_bytesRMD160Finaldb_listwatch_cmdrt2661_set_slottimeusbd_do_request_flags_pipeprocess_read_regschainlengthwdc_pdc203xx_vtblural_disable_rf_tuneau_get_gainrn_lookuppciide_ati_productsuvm_map_reserveuaudio_find_ifaceuserconf_show_attrsys_execveite_setup_channelamd756_chip_mapfdallocuaudio_match_alt_subrt2860_updatestatsrt2661_alloc_tx_ringscsi_doneexec_aout_prep_oldzmagicrt2860_set_bssidchkvnlockhw_sysctltc_ticktockrt2560_newstatedb_siftinguhci_device_bulk_abortdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescryptof_ioctlcomreadurioopencompat_43_sys_acceptuvm_pagefreeehci_device_isoc_abortukbd_decodeext2fs_inode_allocswcr_encdecdb_examine_formatin6_pcbbindreaperieee80211_add_gtk_kdecoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readaudiostartpuhci_root_intr_closeifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogprimemhookdoclusterreadcast5_encryptsys_exitsbtryusb_desc_iter_nextuvisor_matchieee80211_send_4way_msg1m_applyswcr_processcryptof_writeudav_startaxe_lock_miirt2560_detachwdc_exec_commanddb_watchpoint_listwdcintrusb_seleventcd_playsys_clock_getresaxe_attachsyn_cache_insertspec_bmaprc4_getbytesttystats_initpciprintpci_mapreg_probemidiprobeem_allocate_receive_structuresbrgphy_ber_bugncvhashucom_matchnd6_umaxtriesohci_device_intr_donedcphy_resetuaudio_merge_terminal_listi80321intc_read_intsrcnd6_debugmainbus_bs_r_4umodem_cawindow_deflatedb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_idget_random_bytesurl_csr_write_1SHA1Transformesymfiqhandler_stackcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetrt2860_newstateucom_cdusscanner_donesiop_update_xfer_mode__modsi3tcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initwihap_timeoutuserconf_changemakefstypedb_paniccddkdriveruaudio_closeuserconf_helpufs_advlockicmp_initsii3112_chip_mapuvm_growcsecreatevfinddevieee80211_node_cleanupE_ldsa_abs_reselected_Usedif_detached_initral_pci_attachpciide_unmap_compat_intrrt_msg1dopowerhooksehci_device_bulk_methodsether_delmultisave_rtevfs_op_initdb_history_currmainbusattachrn_mpath_initheaduvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlwdc_atapi_startsys_getresuidsys_fhopendos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poollinear16_to_linear8_be_stmuaudio_cduvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsys_fchmodvop_strategy_descudsbr_caatu_watchdoguvm_unmap_detachvop_islocked_descieee80211_recv_authehci_add_qhupl_inituserconf_common_devvfs_mount_printuscanner_do_writestartaudiogetbufinfowdog_cookieusbd_devinfosiop_wdtr_negvn_isdisksys_selectbadaddr_read_1vop_generic_lookupcryptoattachzombprocdb_branch_takenin6addr_intfacelocal_allnodeslogreadumsm_cdrn_mpath_capabledead_lockieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixext2fs_specop_pvfs_unregistermii_phy_flowstatusselwakeupumct_set_baudrateffs_reloaddb_set_watchpointsem_initialize_transmit_unituaudio_ctl_setmidi_out_docnwritert2661_reset_tx_ringumass_bbb_get_max_luncompat_43_sys_killpgdb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodefilt_rndrdetachmulaw_to_slinear16_lewsmouse_activatescsi_scsi_cmdem_media_changerip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrehci_powerbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountfifo_inactivesys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputcd_pausehashinitttstartumass_setup_transferrd_ioctl_kallocciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrieee80211_parse_rsn_akmrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsmidi_attach_miuhci_hubd_piixin6mask32__moddi3disk_countohci_confdscsi_detach_lunpmap_page_protectdead_openkue_setworddb_list_watchpointsatapiscsi_matchuserconf_attrwdc_kill_pendingrt2661_powerbmtphymatchicmp6_redirect_outputroute_cbexphy_cdreadeplxtphy_resettcp_slowtimoieee80211_std_rateset_11bamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbffs_mapsearchsys_fhstatfself32_load_filesys_getpeernamert2860_alloc_rx_ringrt2560_prio_intrumidi_attachi80321_bs_subregionchange_sign16_be_mtsehci_device_intr_closeieee80211_get_txkeyehci_intrdb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagepdc205xx_do_resetmainbus_bs_mapaue_reset_pegasus_IIcryptoioctlnd6_prunert2560_set_chancomconscflagm_getffs_truncateuhidevprintmii_attachuvscom_cattylclosecmd680_chip_mapwdc_svwsata_vtblpool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeohci_free_sitdusbctlprintworkq_createvn_closeuftdi_readudav_csr_writeuhid_do_readin6_createmkludgedoclusterwritechange_sign16_be_stmusbd_close_pipeffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreedb_show_regsuhci_reset__wdccommand_intretherip_outputrt2661_startaes_ctr_zerokeyuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlpmap_pmap_ctoricmperrpps_countuserconf_modifywi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_change__muldi3mbtypesumct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesamphy_cabufinitinswubsa_closebootconfigscsi_quirk_patternsuserconf_linesuaudio_ctl_getdeflateInitlimit0ciphymatchE_abs_targ0_Useduniqdosnamedb_recoverudsbr_activateusb_async_procext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolucomstartreaducred_poolxscale_cache_purgeD_rngip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapaue_eeprom_getwordukbd_cnbellrt2661_initdcphy_funcscom_obio_attachufs_dirbadentrylogioctlicsphy_funcsubsa_databitsgeneric_bs_wr_1_bus_dmamap_load_uiostrlenrt2661_intrdb_machine_initsensor_task_workuhci_cdfifo_kqfiltermidiattachieee80211_parse_rsn_cipherkue_activatepool_page_freewsmouse_inputwdactivatecopystrwdc_do_resetwdog_ctl_cb_argsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequestieee80211_encrypthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3proc_trampolinesys_rmdirem_attachcompat_43_sys_gethostnamecd9660_vfsopsem_get_bus_infoinflateInitsocantsendmoreproc_zapvop_revoke_descusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffarpioctlffs_fifoop_pfs_posix_sysctlaudio_init_ringbufferulinear8_to_linear16_beif_slowtimouhci_root_ctrl_abortrt2860_setup_beaconwd_shutdownudbtabledb_load_countwi_setdefwdcattachchange_sign16_le_mtsufs_printem_rar_setfatentrywi_update_statssiop_startusbd_printBCDsys_statrt2661_txtimein_baddynamichotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smem_check_phy_reset_blockalaw_to_slinear16_leuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadsural_bbp_writeknote_attachmax_keylenrt2860_ioctlbus_space_copy_4ieee80211_tkip_decrypt__assertif_congestion_cleardb_put_valuein6_prefixlen2maskudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheck_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramuvm_map_pageable_alldofilewritesleep_finishehci_device_isoc_closeipquscanner_camsdosfs_strategytimeout_delem_ioctlural_media_changeuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategyiic_cauvm_pglistfreemidiioctlusbopenums_attachext2fs_readsoo_statwskbd_cnpollckue_newbufdisk_detachrusage_poolstrchrubsa_methodshid_clear_localscsi_sizergephy_capci_mapreg_infomainbus_bs_barrierrt2661_free_rx_ringuvscom_cddb_deleteget_bootconf_optioncompat_43_sys_ftruncatecrypto_driversiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolmainbus_bs_w_2sys_chrootehci_odevdwdc_ioctl_freeubsa_cdieee80211_rssadapt_lower_rateumodem_dtrehci_device_clear_toggleuhci_portresetrt2860_attachicmp6_redirtimeoutenc_xform_dessoisconnectingpci_subclass_processorvop_link_descaobj_pageruvn_iouvm_tree_RB_REMOVE_COLORgeneric_armv4_bs_w_2MD5Transformumidi_matchmld6_inputgeneric_armv4_bs_sr_2rgephy_mii_phy_autobpf_d_listuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purgemidi_ca__data_startieee80211_eapol_key_encryptifmedia_delete_instancefilt_timerattachE_ldsa_abs_data_Usedurl_cauvn_releasepgucom_breakpdc205xx_pci_intruvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepgeneric_bs_w_4inflateEndexec_aout_prep_oldnmagicwsevent_pollmap_backmergeieee80211_pwrsavesys_profilvmcmd_map_pagedvnciphy_servicein6_pcbhashlookupbpf_detachdVOP_UNLOCKehci_root_ctrl_abortuvm_rb_fixupsyn_cache_initieee80211_find_txnodecd9660_wchar2charip_ecn_egressether_ipmulticast_maxohci_checkrevuvm_init_limitsukphy_cdsii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeVOP_POLLVOP_IOCTLstatvarsafepriaudio_init_playsys_rforkluphy_cdwdc_default_read_raw_multi_4uao_swap_offieee80211_map_ptkmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectradioprobeuvm_vnp_terminatewi_usb_rxfrmz_allocsys_getpidnd6_defifindexipmultipathunp_dropslinear16_to_alaw_le_stmuvm_map_advicetcp_mtudisctimeout_startupcue_matchfintek_read_regrn_addroutesdactivatedb_print_sadb_elf_sym_numargsural_detachdb_trapperradiocloseukbd_cnpollcshmsegdvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrem_allocate_transmit_structuresnforce_chip_mapmulaw_to_slinear16_be_mtsem_mc_addr_list_updateremrunqueueatu_initial_configsoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidsubnetsarelocalpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_reglinear8_to_linear16_le_mtsehci_device_ctrl_donend6_lookupieee80211_cache_sizepager_map_wantedurl_openpipesukbd_countrylayoutsys_getppidmii_anarVOP_READDIRdomainsrc4_skipsys___sysctlaudio_calcwaterarm32_dma_range_intersectin4_cksumextent_alloc_subregionuscannerwritedb_putcharrt2661_node_allocneedbufferusscanner_cmd_cbusbd_do_request_asyncin6_ifattachtcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4uvm_rb_removeohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobemichael_initipsec_soft_bytesnselcollemul_elf32usbd_open_pipenumdirtypagesohci_softintrbufhashmulaw_to_ulinear8msdosfs_lookupspec_pathconfmountroothook_listrt2560_powerhook_establishtcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptyuserconf_cntdcphy_caE_abs_msgin_Useduvscom_methodsext2fs_inode_freedb_find_variablexscale_cache_clean_sizeucom_activateip6_rr_prunesched_whichqsjmicron_setup_channelsbcompressiic_smbus_receive_bytemsf2lbapmap_free_l1nd6_outputrijndael_set_key_enc_onlycdevsw_lookuplogsoftcsys_adjtimeohci_device_clear_togglewdstartamap_splitrefspec_open_clonewskbd_do_opencryptof_kqfilternclruheadural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockuvmspace_sharert_timer_addpci_get_capabilityieee80211_print_essidroute_usrreqdeextendem_receive_checksumieee80211_recv_deauthsched_init_cputcp_dropicmpstatcom_irq_overrideudpctl_varsieee80211_do_slow_printm_prependvop_advlock_desccd9660_pathconfin_pcbrehashre_tickre_resetin_arpinputehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleeppiix_setup_idetim_drvsreassignbufuhci_confdsiop_minphysip_freemoptionsnetconums_matchsohasoutofbandspec_vnoperatevop_ioctl_descddb_initieee80211_release_nodebs_notimpl_bs_c_2nd6_dad_duplicatedfifo_vnodeop_opv_desc_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4maxvnodesether_crc32_besiop_setuptablesieee80211_add_ssidcpu_reset_addressuaudio_get_clusterpgfindvop_lock_descatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwareuaudio_chan_free_buffersswcr_compdeccd9660_ihash_slockral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2cd_switchiptimerip_inputaudiowrite_filtopswi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spacemii_detachusbd_get_endpoint_descriptorudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEnddevice_refehci_device_ctrl_abortrd_root_imageffs_syncuvm_map_submapcnioctlrt2560_startufs_vinitehci_noopuaudio_devicepool_primepgrphashtblcomconsinitsddkdriversys_getpeereidrt2860_read_eepromifmedia_matchstatclocksiop_ppr_msgaue_activategetnewbufrt2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writemaxcleanpagesuvm_mlk_hintuserconf_argbufatu_media_statusuaudio_chan_closeMD5Update_intm_tag_copyehci_idonesiop_pci_attach_commonpci_io_finddb_value_of_namert2860_free_rx_ringpmap_l2ptp_ctordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointm_devgetwritedisklabelmsdosfs_printkernel_pmap_storeem_write_eepromstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitatu_switch_radiomsdosfs_readdirdead_ebadfbrgphy_attachusbd_interface_countobio_cawddetachuvm_map_unreference_amapsoo_ioctlicmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readieee80211_recv_eapol_key_reqicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64db_lbuf_startohci_rhsc_ableuipaq_activatesoftclockaudio_initbufsre_gmii_readregieee80211_node_freetc_initupdate_modifierreaddir_with_callbackffs1_compat_writedb_breakpoints_insertedpdc203xx_dma_startblf_decryptswdevtdisk_lockuhci_initarc4random_uniformsbwaithotplug_device_attachufs_reclaimrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrkernel_debugwsmouse_cafilt_logreadsysctl_rdquaduaudio_detachuvm_vnp_setsizevmcmdset_extendural_cadefault_product_descip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachufs_mknodsbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetfreepci_device_foreachricohrtc_setcalusscanner_cleanupwi_ioctlugen_get_cdescffs_hashallocswstrategyuserconf_pnumehci_allocxscsibusprintehci_root_intr_methodssys_getpgrpuplcom_detachuftdi_breakukbd_ioctlaudio_defaultiicprobewuscanneropensonewconndb_fetch_regufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdogtcp_saveti6wdctimeoutnchrdevundefinedinstructionaue_cdre_pci_devicesaf2rtafidxnatsemi_pci_intrpciide_chansetupqsphy_cashmmaxpgs