ELFa( 4E4 (   0==((E#f#fLq / /;0&00Qd;0 2 @00Q8$/ // @ <  B00 R Р -L Tp#fДi+fmain() returnedi   ),@@(LQ 0/e8i -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0PSKU@ PU*00 ,*00" 4 Lx08K\ \0@D P gGp00 # P꼐=Đ==̐=Ȑ= -4!L01 M, P@0 00eS4 Z0p , 0 Z 1!R,00 )  #P,00  @0S0 0@` V LH0JP$ 0lP, 0 04塼=Đ=Ȑ== - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `jpQP* 0 P(U:p p-QLM0@`  `jpQP* 0PXU:p p-QLM0@`  `jpQP* 0P\U:p p-QLM0@`  `jpQP* 0 P,U:p -QLM@o0 od:p: -(L  -(L  0-" _  P0L @ 00hS p-LM@ 㧽P` 0㝽00PY YR` cUpp p-LMP@`V0 pdwp0H@ 0S' 000K  c 0H@ 0?' p-LM@` PN?XP 0s UP(0S{p(00PS 0U 0 0 !0P 0UPp -LM0pS 0S 00 47 0P%PK% [)0S ) %0K ! 0@&@K& [)0S ) &0K xUUTT Z   Z8,0X12hZ(1,@0X 0KP0 0000S 00  000 ㎼000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU000ぺ00WMꠐ= p-LM@`tPUGp -2LM PR|2   Jh0S`2`h0 L0SL200l0S 2 2  B^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZIE00,0K,pK!0(@ *pK+KSV λ0< P202(E202" ,P2$00$0h0 ``Xe000P w`e= X =jА=` :lg p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@Pၹ`T@Qp p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U Lm    (l llꠐ=j:;:: 0-L@LP ź0( ὺ0( 0h鴺' -0LM@p 㤺00 ` 㓺00 PZpd3 <# R{00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pWB0++'0K 'K$0 a0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 0V D0PT -PL 4p`V 4hܷ$0( 00kkk$ 0  $00 $00 DPT$0 0$0kX;p;::::: -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,M0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 P0 0  0 S   50S0`00`0 P0 VE00@p x0 vPk40Sh@@j0H 00OK ,IBP000/h:= -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|Pdj00 `0 0TZj2 <Sj20Oj1$Kj2Gj :0:;D:X:h: p-LM@8P@`4  00 00S p  0S > S 00p000 dj`p 0 00  (000C0 |::: -0`10#0LP8pJP@/ 00 0000  0 0, 0 004 P`0 0@ 0  @ᰵ0$ ?0   H" ,# : -LM0p ` P_㍷0ST  0 PE0 @ @00$00$0 00/A#bJiG ^ i* W 0 P(0 0S  0 Ph ,000i? 3YMb= -LM0` @2c1RP,p 00 P 00 0 (0000  dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph:4@000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,IJh: M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`K 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,Ih(: p-LMP0K`Pc @X_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@㮳P(%`@~T` R>0lg p-LM @00P 㑳$0`0$0 @R 0$ 0 00  0 aphV\lg -LM4@0S @440S -L M$X @R0  l0@ $@@g h:g8:D: - L  -LM @r>0 0S@0 @hg -LM@ R000 h^ 0-LP ,0@T 0U @T۲0hg -L MPP@`x < 0Rl0Sg 03[0 3[03K03[<3K3[03K 0 <K00;0K;3K080K 7 K060K 0@040K50K <0[ S^04 K5 K<0KP0,0 D ( P00 004`;00㪲@ቼ~3[- 3[@003[ 000403 [ 0  ;0[03[;80[07 [ 60[0`pf`lfX:: -L M\`@ pS 1\ p0 p @嬀P0S- 0*  00000 006000006@@vp 08 P D L 4 9`:::: p-LM` @0T 0T@ 0T 0T@0 T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0T@H0@0 T$P020J T0 0!0; T0; 0O $@0M T0P l R $0  @ 0O TM 0T@0O T0 7 %0R $0 p@?#όL 0 0T0G $00G T00" $0 00" T0d%M T0 T0k -LM` 0岠 Q0崀0p,$, !$@#  < $ +0) *(  :0S 0 0 < <00  0 0?<0040 000`000 0 T P 0 T 0 T 0a 0( `0 `o0S0 0 0 4a 0( 0 Yl:>9::@:: -L M0 p@ 0R , 00 QP X 0Uʸ00CXUP 0\ P Q,  P 020@ 00 ?@0S+ 00  0 <4<("4! < $ +0) *(@ 0 T 0 T0^,0S,0 P@0U20 0>0ʠ0 010 0 !  0?@?<0 0@0 0X0ʸ0U0U 0?0 pA 0\ ' Q0,0U0V0!  0W0T0 20 0 0100?<0 0 00[0S, P0U20 @0>0ʠ0 010 0 !  0?<0000 0=90@- @@P  @   0<4(<"4!̃ ,<,$,TW0U V0-  00  00 <4(<"4 !̃,<,$,TW0U V0@- @@P       0 00@ 0 0< 4( <"4,̃ ,<,$,TW0U V0<0S8<0b -LM P0@ 05 $ Rڤi`0$ , `0t * 0: 0 ( x0 $ p@ 0p0 0 $000 T0$p000 $ p@ 0p0 $0 00c0p0" $;#;0c;#;: -LM0@ P `@ Q> >0q+ 00 0q l* l<, $4 ,<!$ 4.<$,,  a<4<!4", 0$0$0,$,!$#<0  ell!i;l0 $  aA-@0p 2 PU0(`, 01ll 0$( ,<4<!4"<0cP(0U@0 0 l0$,$,l0!$#,l(0l0a(0 !ll04 8< 0- L0@P0  < W0TU V 00005 $ 0S 0N0o0l0  0$0 05 T0$00C$00 0-0@L $000 PT $0P U@^0 $00 T00: p-LM@P$p0B $C $P Uw^p0R $0N $ PR` @R p\^p`W^ 0N TpR0I^0꠆:$:@:d:: 0-0@L $PP0 Td 0 T0 p-L M1P`1 0 @@@^0Sf 0 0CBS]P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P ]]]0 000p`\XTPLHD@];:::::::: :::$:(:,:4: p-LM 0`P(@ ,Ta? np( -LM0)@:(Q( -0L !  <4<("4! 00, -L 0! < 4( <"4,< 01\ p-LM@1PU`K=.RNτV p0x0 t @QPQHQ8Q\00T 3XQ4Q  K400  B(=<=DK2 p-LM` 9ß@11,$,!$#<1@ZT 5:|S@00Y>0 0Y>0,$,!$#<@T 1  ß@T X?#/Z?B!P`10d!h1VO VO R0000 0 XP@$0SPX11@TPU0)(0S0>, \p0 0:(8 0P80 h $ h\00h 0 0,$,!$#<@0T @ 00" 0 0,$,!$@#<T00@ 00! 0 0,$,!$@#<T0pZ? 00|P@0!Y>!0@\T0 U P@h @P0|".@00|P!.@0|;>9=E9:E9 -LDM0P $@T P '0S 0 ,8Tp\ 0,0P*:P:\W 4 , (0 L0 ,H 1D 000 X V X RN0B ( 0H$Ƞ 8 $8`< 38%;0 0" W 0 $@0 \04 $0S` S <0  m[88 50 0D W> 0P 040 , 0400#0 0X0X0ST ! L 001P^ ,0S TQ0p0, \DH  0p0, \ [8 W 0 <#0! "  [8 < nP Z XP 0, ,00C, \X R 8<<̟W@ 0  Z00 ,@@ W   0SSp<@\ p`<\O \ L<\ @@ Z40S40,0N0 $P9 #P# 4P x0 Z 00 .VnXW 4  }vlcXS @0 $`zQs $IXG B@=8 ?X0, ,0@ @c, ,XW 0 !0 "$#(,<4<!4",dXb! 0"4#8,4 X= XXW0, ,0@ @c, Ww0; $000; TH ,p 4p D L 0p c8! 12cq 3 T0TW 0T:: :;L:T:::0:H:P:::::$:H:l:::::<:`:t::::8:H:L:p::::::::: :D: -L M p01 l!6X@T T T 0,0 `V    (0S    $0 ( $ `V& V 000     0ppoqs(0S $ $0 (P,@a.0 <\_0] ^ ,` 0 0" 0$ @ $ 4  P(0S]H1R/S0H1ppHq  $0 @( V0,0 0S0 0mV,@h 00S0cTb (T]0 00 '00R00 ppT0GG0EL:: -LM`0p @P h@T0A`(@0S G/: uV: -LM4 jV4u40$0KS80 00 , < <0Su8<00Q8 <0 4HQU @T00 4 0L1 0 00 PP0 MtP5VTP40PQU @T0040T10  00 PP0 .tVTP0PU+ $0  0$0@, 0X0 t xU 0p0CS00 00 , U R0000 0P pTp0 1`V0@00 0 / TʄQU 00 PP0 s U@Y<0 0S40$[ 00<48000<0 4$JT::(:T:p:: -LM 0` 0p0 岠ឡ, @QU R0000 0l  @3X 00A0S .P ,0 0  $0, `, ,100,$,!$#  < $ _0] ^\0 ! Ÿ @  $0@P n(0S    $0  (0800000 PP00S000@,@T  02 0 R T ,ڠU00 ,0S 00`S a_0 R00   00S  +@D⫢TT,姠 00T< rP <+000 8<0.P8T 0@@T 0Z  y  :::: -L M 4q ( P, 0 0HQp41pU  0 !01 R PY0 R0PQ00  , R  0T0 0S $00` `1S `VV 0(`S 'W ʇ0(@ P@ p'W(W V000S 00  0 "000`  000,$,!$#  (  4B C@A00! 0GDE0F000,$,!$#  (  4J HKI000,$,!$#  (  4R SPQ000! e0f0gd0< 0  < 0 0,$,!$#̂ , ,,4_ \ ] ^ kjhi00,0,$,!$# , < $ `a bc0011,$,!$#<1P0@ 8 4A=380600 4E=380800D D "4I=380800L L "4"8M=380800X"0,$,!$0#<10("0>,$0,!$#<>10!0?,$0,!$#<?10!>,$,!$# 10\0 @H00  @ 0 0@ 0宝P@0a SP &6`&`006 &006 , &6`&`d006 )-006/`P@K05K$KP\6X6$[  y=QW BQ/ +>4K5 05KP4[S:0:  ,(-w T&l5%#K #K<KP5  [5\# P6K 00 Q0N@H%H5 0 0* 4 4 w4 N4  ! s* N:$0:0t3l$ 0~ 0(y*   0m 0g 0a* 0Z* 0S 0N*  d0B 0L<* 045* 0. 0)* v 0p 0* 0* 0  0b* M 0G 0<* 0$*  0/ 0"*& 0*1 1@ \`0*:Ŭ1\:0:Ŝ1Q|11 P0*:l1 P:0:L1 41*@1@ Q81}>$:1* 2R 1R* * < :0:0 Q: ;hT!::::;:+ , * 2 4 . 6 : > B F 8 D ;0 =L!D_e(!Na'(j) -*8 L#8 $ʐ R2 d XH -*8 L#8 $ʐ R4 h XH -LM:`0 5Rʖ R2 d 0X JR4 h 2Xxrʐ R2 d 0X :R0 ` (ʖ 0R4 h  X2Xo_  :R" D ( ʖR@4 h 0XH:$HT@ 0  `1ʖ R4 h :X41ʖ R2 d $1X1S0ʖ R4 h 0X0ʖ R4 h 0X ʖR4 h 0X  ʖR4 h 0XHp -40Lʐ 0R ( H -LLMu0 @4 0`R4 Rd >{PP u{1{l00l0`Dp0p P <C4S< S 0oL0 0S /S cL<p0 S#0 Pp p<P3 R3Q {  SDl0KP6[5[ zPP {1  Y00C b b`2 Rz 6[* RO s RL $[QD X"0. Pdh0@"0h00S 5[  20S S 2 RlK 5P)= 0|p G P 88 _  G>=| |tK)$[Q>K  h'8K d' *K `' 0 0D Pl00l0 O R[>0Sp 6[´p   lK>'p0 <0 < P z8 TpKp <00 0lK 6T!( 4!:<:* |l:::(:05;505t0p000t0p0 p-0LM`a (0@)5K pGL0,0P@@T  ph%K=T!H: -LM|A0P 00K  00"[80 01R; R 3[pCX#wmW`ʕ   20K!0ʕ R8 p (K#[0 R3K#[101pW0 0 80xH@H0[ [=   T!H -$JL@DtpP ʗ (0  @D℘tTeaʗ 8R  #8X JR8  #8X 0ZR8  #8Xʗ 8#8 XA ʗR0 ` (0P@DEtT8< 0PJ :R  (ʗ 0R4 h  X0X  8 /JHd:: p-L My= PR`0 PEu @0@0 0S PEuU:0:T`e\01K02K01K40 K p(Ip:PT!: 0-y= LRP :*$@ ʕ<<*0T㰗 ʕ@*0T0h饗0 -L My= @RP 2R 2R 200!P 80Phr: R8 p (0 hVu :R8 p (0 Pe`\0  R L8 p C0? SG y= R 1R x1R 1R P P 0 00 0,1R 41R0AS꘢ ̢ ̢ Ģ ̢ ̢ ̢ ̢ ̢ ̢ Ԣ  0P 0S0S\ (PK?2K02K]8 80(PK U T!H*D* (!#(( -L8MP`? Q y=\ 3P [2P7  80Pp.Ԃʖ R8 p 0X JR08 p X0\  R L8 p lCL2 Dp0P0""K0 2K"K )= R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kd!@0p2PTKPK&U?G  K5K$0 Pp@W 0"K0C "K Sl 0[,PK2KX0000000S>D0,PK0K2K HT!!(* #(! 6S-L@p6 8S `,Pʔ0S8 #8X0ʔS8  #8X|Pt0ʔ R (0  PEʕuU< G `H: p-LM@80PP`0 (  R8 p ABpH -LMPp60 P a 0?  R6 l SB ʕR6 l 0X JR6 l 0X 60mP@ :R6 l (P0 S :R6 l ( 0 SH4xV -|1LMp00  @PHQJDaʔ R0 ` (0PE%uU4 :R" D (  ʔR4 h 0X 60Po?PPl0ʔ R6 l 0XP?U< G T!H: -LdM⌐Kd @108K0p8K05 -BTP @ 00`W a0S P"Tp`@00X 8K0 5<5 d 0 T! p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 `T2R L2RD2@@ :~D@0 4"  0"1R 1R 1R111R 1R 11u 1RM !ʄ1R x1R p1R)=`1\1R T1RL1@@1 @ v= $1 1R" 1R 1R10 0R 0R} R0`y Q0u  Fp 0v D >v 0 4 8 . 2 > : -%*< C* 6 B F :| -LLM]p@\ ޑ` :h l  0` \0 P`夑p=T &d=T\=T*T=T IH=T @=T h\ lQ `P \ h~P\1S ` 9Xh h ?0\ hP5 =  (<T> <T 2 = S! =@S <  8C8 : :  X< R ; 2KK"K`<0K  : < R X;2K03KK@ @ 505\ 0S ;  x;  \|ohPi \w r \ 4P^5@Y \ \:T )P:T H:T;hPB  h $\0*hP' h5 "\ 9. @RA\0S\$9T2 $9TP : R,\:!  00v-0?K2K 9"K 0K9TP \ h|P@ l <dh \0T)hPh \ t8P* Y8PP  P  P H 0hP hP5 0 h0 w7P7 Q7 P! 7R 7R 7R 7R |7R\: } : y :u :@q :m h7f7P 6P 66P \7Py= RRy= R D7  h!(7 @&0<hPB6 R> 52: y= R6  h h6)00 0 |6  hP5LU   '"0% ?A1c バბ  "0s 2c0<p%i%04% <5Te45T]*,5TV $ 5T 5T \ h T6Lh h4,085  hP\0h 4T& 4Th h \$hP5@ y= R hH P\ h\$m. \00  \ \ 3T 3Te *3Tt3 R}\: w h Yh <03 hPVhv= R \ 101M2TI5 2 R(  h 1h2,02  hP.h0 S* !!l hl  \ l! \ ! :i,hP !n\0l l! Pl  Q10Sl;@% \:P  @X`K@&@@`1@5KEK A%K RK: 5 0 l;@ Pl0  0T A0T&ꘄii2i 1i iii i i i i i i i i8-%C=$ gfff@:i i iiiB5i i i i i i :Ai86i(i|* 8171( T!@0Tu`P{d0 R  T\h Yh0, 0y-0S 0  hPRh0SO >\0 d  h00iZD\0|S@:Vp h  pPf @|*0 p0  p0@R0S@00 ~ %05<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0p Px00x0\d | <P\ 000hd0 |0 iZd0  |0R*V  |.`Bh0 [  !0h20l \|h (0h \0@#hPh0 Sh3 RL  R 3R 3  hh 3 ᳠ᴠh w T h0+ 4R$ 4R P hDfv hD \4Ry= RtDh [ 0h04h 峠0㴠0h0y-0h0S00h h 5h4,05  hPh0\0/ -껌 0-M0LM PcR  y= R :AKA A 8s < 0  0|0 @t0t@p0 Kh ̠0KPL0K  R808 Ca 0H:T!=gfff -LQM: `! 0ㆌd 5@G7য়0 3K?3K#K<K ?;'K4K DK$K 074K04KLKK >0 5K?5K%KTK 070'5K K%K\K 7'6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK: @tetvPK@&@Q@lP6@;`@K KK;KK 0@T 5 R- 0S R' UAoK@@@&@(@K  @`Z 04DK3K0 M I0K E 4K84 R 5 ll4( K-K00QK3 :Fo$4PCP 0nK0  P+`!0*  P:`! *d'5 @05%p3+%(a<+?0'?((3( K$S0BSKR/K00"2(K UK >K 0 2"v#00  y=P 0S P W_KVoK )=0\0X2(K!0p424"Q1"W_K(KVoK01( KOKN/K00 0JPK&@@(1@K@ =KMKKd 0X10K8KKK 0(1(!8K 0(K8K 0K:|v=0/K7K'K 0|K:l. T!* 6 4 2 : > :[8 , : =h:: |*D!F -B -LGMA0Sp!, 000Y 1 Rx10 S<0K y8K u18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[B90K 5KY B=BM0 B@l$[H4[Q04KD 0  0000 <  BM@ B0l DPp 0 P0 0C0 0 c0 R 0 R 5[ C  0T!E9: DQh:;:$:v'N$ -LM9`P(0Bp S? 0H S$, (  000NP@)P Ul0l 㳀pT0 R   * 4 6 p-LM@!0! 1P` y= R x1  , RT BRP1   R p41 00S < H T ` 0 8 0 \ 0 dp0 ^0 V0 t0 h0 \0  R  R40  R: 0 0 * 6 4 T! 0-MLM@P800000|1 R9  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽T d p | 0000000004 * T!D -ML M:BKI0 I| 000CSuv  D 0T p0S^XPpڴ8! #  1  P`C P`=04H8( K81BNK0!@@D(0K 1  P`# jP`8 0(K 0$!  0  P`   QP` 8L0  @ T  P`@ T! p-LM:v̀@ ( 0 P `  000 0S`V@PpR 0 Sc P ppp|i -<0(,0L0 : > T!0 0  : > p-QLMPC  R:`:: :!::`000 0P@ V p 0S`+s է 00b=C4`#hx0  1> 0P@8p, 0, ?8: `p,!T!8H: 0-LM:@+P"0 00> Ph0ʔ R  ( P 0,0B=C1: 0000-0T!H R-L  0 0C SE  $ 0 < p 0 00 0 0 0 0 00 0 0 00 00 x0 0-0X 00 L00< 00 00.!0!2!4!6!8!:!!B!D!F!H! 0-LM0@PSh  , H h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 00= x 00p0=\0 @ P 0@P<0< @P.!T!0!2!4!6!8!:!!B!D!F!H! p-LMP\` 0@S0\0S p  d B 0000 0-P@0@@L 00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S 0h\: 0-8yMLP @ t0 R 0s? X0  @0p  R0Z0x0 20h |6* LL h: -8BMBm(P L@"`p" `0     밠 'K6: -8BMBm(P L@"`p" `0     밠 6: -LM8yp {s/000, `V( 8c@0S91!@P@dDFA 02 S&h1b1 R0``00`Y `0:,o鶁@ R }2㩃@TZ @ @dPāDFA@04 Sʄ1d|A R@0 @000@0 @Ⴡ@,5  5~hh)h=:: -LMy]㎁ P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  o400 1+ 8`  1R010000 0 !0*0!00 0@@" `5 8` 101! R00:` 4=:,: p-LM0@y] PR0000 0` !*!0S00@@@P2 ph鵀0 CaD=gfff -LMC0ID`y}@De pD20u? @$ R00000   R 0 0 0 @0S(("@P奀@dDFA@04 S1d1 R0``00`g10C1ꔀ匠@@dPDFA@04 Sʄ1dXA R@0 @000@0 @ >@hh)h -LMp0! 1?2c!c2cIp@ymP0 `P0L UF Dx  @0u?   P@0u? 02#u 0 @,?@0 0  0PP0@S0 0 0P 101  LfH0– eD P~H+h =-0  t0 a1a2cP  0Q P 0S!0S~H -SLMy]` 0 P ʴ8k30N0  0A 0  pK0K@K @y0 SK 0K@oPZ Pp 3• P P; (3 p,B]P 3   M    B-" 0Z $ Ӳpڨ K0 KS&  03,3()= R RF R (pZ (p@\ 0  @K!1@RTں1D"01@82P @dDFA@04 Sʄ1dA R@0 @000@0 @~0@0(p}@6@0S @@00K@Tڴ( P2(~ Rp? UT%TxTb@ T  ,xd@804 ('>  xRbT{x'xxxT f@T XT84 $0pj@h@ Q8#x: -LMP@p`ux'> R( VT!h!H!H!p!x!!'> bR{884#8 Xi-x <B,dfhj 0D: -LM80`P 4, D ,, 5 p 8@4 0D \84 0\8@4 0\84 0\8@04 \,0QU@ P  s0S, p5<5W ' P 0@ 0U@pPW84 0D \804@ ,00SS S S S 840 \8@4 0 < 48@( <"44)< \<48@<("44(<| 0-80PL4D ,P@58 04D \0 0-L84@7 0TP Uy8047 $ PUU 84 0T0X+: -L$M0`p3K0x2:K 0#[78@KR0x2 0PPU0PK 00[S/0[S '> ORH7H7,98 ;,9 @0L)L)6 804@ ,\  0R SX !(*  *< Q<6o<@00@ @ ,0,PpX60p0p  0 Pp)6<&2 PpP.N&< B@hh5  PPp@?U<呞@>0 0@ @ ,,Pp<   )4  4Pp$ 5< <0p0p  0 Pp< )\4 PLpP @<@  0P Pp@M?U xP`n3PP5#3 0#3 0'.0S3 0@0 1  3#d23#~@h"l2p#p3LR 0̠UTBT  4 *" 0" )P1 PQ=?U<0$<0<0 X"8<0 ) 0@?P@QPUZ<0$<0&<0"8<0' 0<0<0 ) ) ) )) p) `) P) @)!4).0[SP-0[SM,0[SJ+0[SGpW  $+0[ 0+0K:804 ,@ 804,00)?K9|::*47!L1!`9!2!*!L!!!6!7!::@:d:::::(:T:x::4g8g -RLPM , 0 40p0u 0"0  0,0 180 <1 P4 ><(0SS(0,  bSB(0@S5T*80W40, 0,00@0?R4 A @<(0SA@<(0S40 0 0(0 0 0((00SX 0 0 0( 0 0 0(< $0 4 (<QWP0  W0 10P|W7: 0-LM&P"N@0?  RB0Z<(0S6F6FF0 $0  ( 0-LP+ +@ 67P@ ?T0$99(90 -LMPP<B(0 iS(0`SV<,)(0ASw  $2 0$)R1$y01()p (y ?#=?0c'> R`  Zl00l0$ P XW( $ 7S P l00l0$ P DW ()$)$9S0J0 0 ? B5c5c0JS 0\1 0 Q,1 A0 1()p$y 0J()$)0h00h0   00 02:S 9S <P 5  00 0() 000C 0V  $0 ( (p H$ T,00S 00S   y`G`/```V 1S(84> 0X{@ -L$M6, S`0 D ,  0 D D 0 <0 2?H0 , 3 P@,( 04 *S@ D00@ 40 640CQ@î<(0SX 8 < 0 R884024(2@ @ \84 0T8@4D <\804D ,58ppp4D 0\S09S884< 04< \1X84> @1X8@4L 0\'> R88X ;T ;44\'> R$ 0IT #P804R $80 040R T% @ %5;5pX0PI84 00X840@ w{=?#P 0-@L#PP`20\" 0 -LMP@`pPp 0GP o1TM1T7*1T# 1T %!8 @ 2A8#  @ 8C82% :@ _505%@ 0 R[ j4P5@ xt0T h0T-Pڜ0P\0S\80T#.02i 1i i i 5i i 6i( p-LMP@o`0w#t00t0OphRo,: p-LM`@PUPY 5#=5(P847 0T8@4< 0X84> 0X$ P$@?P2SPU@Z@?P7SPU@Zp<0 $oR07<0$eR02aR$Y(Y Q-L@0 ?-#@8?Zc?!NP  ARNZ`PO_P`` ??CS0cS@  p-LM@ 0PT 0T` $8  `$VpVp p-LM0 00 PU`00S PU@ 0@㨉 0㣉8P<<T:l]pKe=!Te -LP@nTp` T \n0@`(R 8S h - LMş0 0 P)((, @4 ]0qWY Zn8PPN ,npD5D% 0 l[   0 0SAn00 p0 00 nh 4 n, 0S 0Sp) `px$x4JP@ p  0Sp0 p0 PH2W .<2W& 02W 0 00, 0 ,T1W 1W0 @00, 0 0 @00 01WI 91W |1W@P 0@ @@@@@@0 @@9@S@@ @ LD,  ,0 @$@@0W 0W000W0 0Q0 0 000000ꨒ==]t@yt xt zt {t ktjt@\tltmt -L M#l00Q(@$0 P4, $0S S 0, R@pp  Rp  Rp   p0p00 pSp 0S $0R 0 0R0 p0 H`|2|"G|0P0C@|0p00, T0 0, T0 B40, T,0 T0,000 T0 0SH $0KS,0Ӂ0 T0004 0) 00$0(  0 9S0 &6R h0(!"P C0 ,000 T00, T 00, T$0KS!0ӡ0, T,0 , 00,000 TBꨒ=p:= -LDMP1l  , A4`pRjp  |0Sڗ0 j ,0S L,"000 T0 0 >HQ3Q ~2p 0p00 0 H0S HH00 lK H 0H@TP0 @TT000 T0Hp06Hh=x: -LM@ip0  0p0i p-L M@i0pPt`x0p0t0i880V @U 0@@p"<;D: -PLM@D 0R@ 8piP堀`U UJ +<W0  p0 oli0 0& diU*嬠`0 x p0 0RTp0x 00 h `P"U:@0a0400 TĒ=== -L M`84@P㈠ $8 ,    $W  $P\  p %0  ,pFP+0  , 0  , p0 0p0| R,0HY, h0"2  $ h0!20, h0!,2P0 000 Tlp Ph0 0SA 0h  $ 0@.0U:x t0 0Rt0x  $P|0Ta!0U, 0 0 000 TD0 R 000 0pp0h꼲==P= -LP `hp $  $ @$Gh@ -LMP`pbh}N $0 @T +j0 T00 0 }N $0 @T ji h -LMP `p@*h 0T@0DD @T0 T 0T 0T 0T0 T $ig p-L M0 K `0  PP p@ T \0\@PU HPH0 0Q S00 4 0PgeTgTe=! p-LMt`t0lP P0P@HH D0 0S0b$0@p?Pg@gDgLg =Xg: -LM℠Pp@0 `V 0 =8808 40P( (0pDg=gPg@gLg= 0 PgDg0 0 PgDg 0-@L Eg04 00P0 T0hg -@㈠4p@  0LTh5 QE  $  0P T  0T0  T 0Tdh R R  0 T R R\!]!]!]!]!]!]!]! ^!l0 S0 00 0 T  $0@  T@0  T0@ 0Tß#00 S Q0Q3 r T <| t TPl 8S080mE0$04 40 Q00m000Q 00^0@ 00 ~  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0@0  T  $0 0R%0  T!0  T  $P  0T  0T $ 0  $ P P0 00  0P000 |g0 @0 0 \}Tz@g:e=!Teg:U0@1!51 0!1 0 ( `h@1h71!11!!1U  X0U@0;$<P1PH1HD1;<   # 'RR >P$  P  'R R \7s  Y <0 e ']7=gfffh: -:JLPT 0p \-bʕT 0\$bʕT 0\bʕT 0\bʕT 0\ bʕT 0\bʕT 0\aʕT 0\aʕT 0\aʕT 0\a:T , ``WFʕ@A0T \aʕ@0T \a`VZʕT 0\ap`ʕ0T \a:T ,J, Ƈ ȠT 0,x\a`VZʕT 0\aʕT 0\aʕT 0\vaʕT 0\ma -L M:pV/,X:!cx2Q,0 8 Y (0\bS 00@T  L \  Q00P,     """Ƞ I( Rx 1?1c0A,0xQʗ` 0\x* H,(  ,$, $!,"̠"" H(ꫪ* -LMɐ`0p:(0\`*BQqP0@48 , ~ 0Sq|!}!}!}!L}!}!}!}!t}!}!}!}!}!}!}!}!}!101p  p ɖ(0S8 $@ B @62@ 048< "0""(0 ɖ(0S p*4 2?h1c0"BAhp*p*0 H 0"00(ɖ $0 (ɖ!1 01!p00p0!1 01!t00t0 \$( ,m <*5 ;5mu0H 0 00(bꫪ*: -LMɐ`0:(0*BQqPs0 48,b` 0S~!~!~!~!~!~!~!~!~!~!~!~!~!~!~!~!~! h $(,!ɖ(0S6 $@\A @1@ 048< "0""(0 ɖ(0S :0/". 0bA:*0 | 0"00(ɖ $0 (ɖ <*5 ;5m0| 0 00(: -LGMp0ʘ,0 ( ,(;L$c@+2R41 0~ >81 ɘ0( ,k0BRQp0 $(3,0Sg0S  9@P@ p@1 ɘ(0S $ɘ` ;` P 0 @,0# #$# 00 048<#80!:#:0 0+R>0Q 0@ 00  ' 00 0 00ɘ(0S@+4 ?=0 cR@+1S 5  ,0 S , 3@+0 "0 00(:D ,:@@ ,PP 0%%l%H8Q"""̠   0 @`6X7 !40XKK,401 0$Q 0$< 1 01\K,1 0 cʕ*` 0\1 ,0S , $0  (ɕ(0S *0 |"0 00(0p 0X7!$ X7KK ,4 0 >$ $< K 1  UP 87 L!R R07S@ PSP Pw L88@gL p PkP!PPXR%XX 8 ]  X 8DP6P`? ,@Y „0 < 0PP@1   XH ;0;8,0 S ,,.@`DX4000X41@!0 0 P,P,,< I(0S,0 0S ,0 ,PH H ,` QI Ž`0@a 0!< 0P0P``VPPx;SR4@0D!0 L8Y81'D H H 0L!@P0$ <, H!jI(0S,00 S,0 0 ,0ʙ0V/\s@ $0 (I(0S , 0 "000(@@,KL R 8X7!$ X7KK ,4 0 >$ $< 1 ʖ 0\J 0\WPBTX'l T7lr  Q 5QN n   ʖ0 \: ,ʖ ,J 0\ʖ 0\5;5%@ % 7 S  P8:9 000 L9S8: -pPU0@ڈ2"52 0|"|20 ( `Oួ'P2h7H2H"1D2!8"14< X0<@0h<<2Ÿ20,p<!0jP P  WS $POP=@U0@KdP@P=U0@MP@P=U0@o#JPU J02)M @APU0@DZ !!:H \:f9f9!!p! !!!t!!)@!h * n ="":L:f9|:x::: p-LM` 0@# PQ)M @PPU0@Z  Ep -ꀭ= -0MLP 0,0(0$0 ɐp!ba0 0 P@\ɘ,0K00 *,P@`Kɘ00 ,  04P@(<ɘ 0 P@/ $0 ,a P%  T`ɘ0 0  0 P@ `Z<7^/ @(:L:p:::: -LM0Y, ( 0 4 p00 `0S40@8040  ,0 Y(0S&00$F200 000 0Y,0ɓ(0S0$0 0,0(0 $0 (00$0 (,0Y -LM0pS Y(0SI$ ə!b! 89 0@T3 0Z o`0S Y (0S$10Q 00Z@@9$0 (Y $0 (Y -0L,M0  $0 0ɐp0`S0`  0 P@ɗ,0K00` ` *,P@ɗ00`,  04P@Lɗ 0A P@t 0 0Q,   ڴPj  4@ 4@00TI4們@ `0ɗ`0 <  4 40@<#0T8 40 PH0PA 0;!6 ɗ@ @ P@"< 8004@@@@ ^ 0, ""4"0 ɗ(0S $0 (P 94 @$ (:L:p:::: :H:: -LM0@Q 0#0Qɐ(0S0 0$0 $0 ( -LM0S Y(0SE$ ə# 89 0@T0 0Zo馴q`0S Y (0S$0Q0Z@@9$0 (Y $0 (Y -LM  ϳP@[ -LM@4P 5A0AS 0-0@LM$7PS 0hLk/ p-LM@0PL 7`S\    <0 <L,0phBT!= -LM@kW0CQ  T 00HSAQ B00HSʠ -LM`p L@᢮$W? =XL!!!!!U  :4!,ʖ04!\T7l> 00aT7l1 T7l, 'TGR & i   # 'RR R R 0 <^ H0, u 'z 'd0=gfff -:JLP$#0p \Nʕ"0\Mʕ"0\Mʕ"0\Mʕ" 0\Mʕd"0\Mʕ@" 0\Mʕ"0\Mʕ!0\Mʕ!0\M:!, ``WFʕ@A0|!\Mʕ@0T!\M`VZʕ,!0\Mp`ʕ0 \zM: ,J, Ƈ Ƞ 0,x\fM`VZʕ 0\[Mʕ` 0\RMʕ< 0\IMʕ 0\@Mp4 -L`0p:!,; 40S02)MҳN @,0 0QQ 00 S 3t00t0, 0 R0C, 0,!1 01!101101p00p0 @*5;5hG0: -LM`, ,(0I( 1cqR 80P0 N 048< 4 CA ,0I(0S1$0 .4000 48< "0""(0 , I(0S80(0 0S(040(0( !b!( $0(,I( -LIM00 ɘ,0 0! @ +(0k儫QCSp0 48< @) 0Ql00l0 048<0#,## 0ɘ(0S;0/"-? 0b;+0l 0#@0(ɘ<0<1 l00l0,P4 0l00l0 -41 ɘ(0S $41ɘ< 0 ;P8 x41 0,0# #$# 00QP 048<#8:#:0 0$,R08Q@0 0P <1c/ 0]v:",:@!,PP8A0 %%l%H@Q"""̠   0 @`K8\OD: KK 40D:,0$Q 0h<$ 1 81\KK, (1 1E3\1Ll4,0ɘ TT <7 PQ Q07SP T!S T! T10 4Pl0<   X P<Pg @ <@T@HQ$Hg X< }%0< 008#HH #P`K $PI0lq 0@  P@D!   P[(0Y((,0 S $,D1`E4000D4D X 0T,00\8(  0@ ɚ(0S$0 0/- 0b $0LL $`@YAl`00!@ Da 0P0PPPU@P|$<SY4D0! H0P<n<'L3L H!01P D0@,000(L! 8 xɚ(0S$  ?=0 c$ ʚ"0\eD  $0 (ɚ(0S $ 0!b!0 80( @@KPQK D:KK "4 0D: $ ,4 0 <$ 1 ʐ 0 \ʐT0 -LM0HP,@p ,`P XP(8`` ;SR <S 0 P`>  ` h  ;S  <S K V X # a b:-,0(ʔ((0-\0   , -LMp0<2P00P  R22P@ R`  0@ Sa1 0\E,0BBPCJR0CTD: Q  W@AD   XLa |0 %vB p l   f0 %`B Z V  Q0 %K l 0SS Y  ^0 ozBI R9O9 J H p-LM 0@j4P8 <0 \ 0ʕ48 \p00 p-LM 0@j4P8 <0 \ 0ʕ48 \p0 0 0-:PL-,0@5 ʕ0-\0 7 S<:0<: 0-L@7ʐ@0 P P,ʔ00 \0$0@P4!D!L!T! ::$:8:@: -L`20@ !.1! 1 /1 ɠ -    +ˆ : 0 ;M 0S<C<<N 0S<C<<;S</0C<AcTdTxP@p  @TP/]P@Q@TPZ u 8O9: -LM`<:@0)R,0<: O<:8*4RD ʤ4RD4K8 KaP 48 P4_<:0<:ʖ:H$\J\: +\ʖ:$\J:#\ʖL;#\J|;#\ʖ#3\J#3\ʖ#3\J|#0\ʖd#0\JTSL#0\p@ʖ!0@\TPD!N0 W'ʖ"0\J"0\@ʖ",0@`@TTj PaX7T'l0D:UD8:-, 7("(S( S5'& &ʖ0-\J0-000KLʖ!0\J|!0\ʖd!d1\J 0\ʖ!0\5;5%@ % 7 S < 4\ 0R@P<: xT:`:44 44P44 4 T4@,444N9X4000h4l4lQ}T}T  !: p-LMD*P0, `(` ;SR <S `: L,Jt   I  d>@AQT P 0Q01@n0S  @pcP0DV0!@Bt0:t0#t`@0 -LPM0T` Pp> l0 \PK  @ : @@~ʖ0 +00tJ0 tp0 R W0'S1#600 7Sf7,: 0-0P 'LR@p0p  ʐ\:P ,T7 '42ʔR 887 \0h0d0D:  <Q QJ@QZ@@@<Q QV@Qd@ -`L@!<Vp0P Vh;4<:)0R<: 5 9S5@ .0 p-LMhR@`lp2 ` h”l 0XdkhRlp2 ` h” l0Xp -LMhp`lp2 ` h2l $ThBlp2 ` h—l 0XhBlp2 ` h—0l T_ 0?iP x"0hB0t2lp2 ` h—l 0XhBlp2 ` x2hB ,0l 0 \gP@  PP  @00\P 0P00  tP@ 000  gP`v 00 P*@VP00TQ^0$0 0 0d00 X0 HBBt"01 QXP>@03 < LLW0\ 0004 @60=0 ԸhR `lp2 ` h—l 0XhRlp2 ` h—l 0Xoa, ,= @"8"= Q- L Q  =S p-LM@ `P PQ ^P 0:#:S0 000S0088 @T20T2a8 T20CT2o8L"<0S<<   <0CS,<00-,000 p-LM0P` L0S @0S0 0 V:<SLp00N:-,000 p-LM0P` L0S @0S0 0 *:<SLp00":@-,00@0@ p-LMP`0 L0S @0S0 0 9<SLp009$0 R0 R  = -LMhPplp2 p h2l ( H?` L10S<````.'  A0S 00VhB lp2  h•8l #8XX20X2\x`h`XhBlp2 p h•l0 X $:@:d:|: 0-T20QLPT2 @T0 0ST20CT2000 -LM@0SS#  R 0 R  0!  0:0::Q:\PhA-`4PU%@P 0 0;#;-R@ Pv@ Q0 00A_P09040Q@Dp 0 \+0"+^ @L00eL00@p@-P @P0` R p@w 000 0p@Y " 0-L@6Pb0h6 -LM`0Vp0PfhB p2l  h•l (0?`VZ P 0S P 0Sh_0S  0-LMhR@ lp2  h”l (0?00h~ p-LMhBP lp2  h•l 0X`hB p2l  h•l (0 ` fcVphMcVp: -LMPpO6h• lp2  h2l (pWp hWhB` hlp2 `&h h•0l X`hB p2l  h•l (08:0#0W` e V5W   5::: p-L Ml@V PK 0cP ,0"  000,^ `0< pp<0 p-L Ml@V PK 0ncP ,0"  000,^ `0< Tpp<0 p-QLM`P @Tp -L$M@, 0 40 t`@ D q 0@ H  0uPZ0 4PP%0%40 `1`R< J< `Z8 2,Q8 @T007 0<0 V0 8 " D0B B * ':@474$ \9i000 `V P%,000 0gZ 0P HP  ,  l:040 -LM@]P 0h -LM@!0P`h0SX0 Dp0H 3L0<(K,@K @AP , 040(,0P 0 (0  4l<S0,x00> 0⼌0 R 0 R @@ {4p0 RP@4 840 ,0 ,!  ="=Mb -L0@` 1p hR780 TQ0 Rd4pPP R 050 R.40dO4x0 P XY` 04?4P\m474pPP i: 0: -LM0@D4 0  -LM@\P 0h 0-0L L0@P R P(0 R0 = -LM@\P 0h -LMP !0`hp0S?0< (@K03H0 $K @@P@ ( 0403(0$ ` 0 D0T L0 $0  D0P$ <@0S,00> 0| 0@x3  $0S0$0 -LM0D`pP3@TY3@;cTLgiL0@TL0@T -L 0⼬0 R 0 R 002P@ J0 0 ,!FH<\040<,K<L T00@K @7P00, p00 yi="=Mb 0-LP[@T0T0^ -LM0` DP@1ZL0SE @t. < 00@0@, 4pP2Z @4 0 00oO2G00 0 P CP0@T4@6 ^:^ h• lp2  h2l ( @: 8: -L`0pt0  hPR40  RD0 BA-2 @`@<.S0<x \ 1 p-LM0@DP2 `0R0R00S4 S00 1* **P\^3OZph1 -LM0DPp@0!@0T50a1@ m0P` 0S S 0SP 0 0 @T1gi i1h: -LM0 @p g`PSU  44pp7DpD@PP! p0PU1Pp ͆0 0PU0K1 00 PUJ0PUZg㬘ih0S0S 040P00 00 -LM`pDPPhh@ L0P  0(Q 0S  R00 H0 <$K(@K @( 0P40$ (0 0 L0 $0P  $ 00 p-LMh@ PRh` 0S  000 0S DMX0Sp0 ph?Dm p-LMh@ `RhP 0S  0`D ph#p-01 0000 00 p-LM0 1P m @0S @0S0 0 g2 0S0 @0C0p00\2 -RLM`H V`☾Dg ^L@*P U  P011"PUP 1@1\:P UpL@0P0 0 U 0pB0P U@0L0Pw U": 0-@0PL80 >4  QL 00SX7"8"$8"D8"4100EPD PP  PT H0 ]P0DWP%T"0DLPDG0000h0p000PD, P0r00 0hJQ,0 Q$0000x====H=`= p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -QLMP Qh•@lp2 @ h2l (h• nlp2 @ ` ih•i< lX$_h•lp2 @ h2l (h• nlp2 @ ` ih•1i0l Xd1h•lp2 @ h2l (h• nlp2 @ ` ih•il0 X p2^h•lp2  h2 l( h   h•lp2 hB00l0 pGXWWP0  h•lp2 hB 0l0 DD N -LM@WP 0h -L M0 D:p` R%@ 0TĀ<0 @0% $R 29R R R .@Vj.R R^l9^>T9R H9RD9 RR ,9 R 9RV 9R 9R\ \^񟗿<=">" ?"<="?"<="<="<="<="<="<="<="<="<="<="<=",@"@"<="4A"A"h—@lp2 @ h2l (h— lp2@N  @h—IIlI= Xh—@lp2 @ h2l (h— lp2@N  @h—IIl?h—@lp2 @ h2l (h— lp2@N  @h—I7Il0h—@lp2 @ h2l (h— lp2@N  @h—IIl0h—@lp2 @ h2l (h— lp2@N  @h—IIl0vh—@lp2 @ h2l (h— lp2@N  @h—IIl;U `5 T5R  RU00$5RU4 N4S, S < ğU1# =C4  0SU 0R0 Rx$yR\$. U1 #Pj U@1 @# $ Ҽ μPdU010# \ \s^o<="C"TD"<="D"<="<="<="l="<="<="<="<="<="<="<="<="<="<="<="<="h—@lp2 @ h2l (h— lp2@N  @h—IIl0h—@lp2 @ h2l (h— lp2@N  @h—IIl:  Rw L2R R U005U R+ 2R U1 # B1R\ \Uh— lp2  h2l (0@\ \Uh— lp2  h2l ( H0     RN4JĠ,K +0K)K,K*KU        # #D ؓ=::=== = 0-0P L@3 ⦾ $0S0$00h\T -LM@TP 0h p-LM`0 Pp03M @RT0 H ?A3c0P`*@G S : R#: , Jc0 ͸@`p`B0 Xp0C$ 0P8 R <0 ,4 0 ᭸P@ 0P0NPP`  0 0B@$B -LMxPW$`K 0-XP@)v*p$ ,0#  0@0(0(?^ H;*`*H 0p8 040 0)* p-LMP@D*`8 0Hph* p-LMP%h• lp2  h2l ,` B\0 @`0 D T8V 0\2p0::;:: -LMh`plp2 p h2l , K T81SM h–lp2 p h2l ,hRlp2@ p h–@0l \@Yh–lp2 p h2l ,@cT\\hBlp2 p h–l 1\UDhBlp2 p h–l 1\: -LMp 0PPU $0Z 0PPU &0Z>o ($8 0#WP@ t2 |,[03P @ 090P @ 090P@ 0P900E?0P! 0U90"$P0>U 0ڔP2|"PUh—lp2  h2l ,h—Plp2  h2l4 ,h—lp2  h2lH ,0 h—lp2  h2lL , \4 ,P ~dXhBlp2  h— ,0l\dXhBlp2  h—l 0\P *h—lp2  h2l ,P Ut @P1PM>UHEBVh—lp2  t2 hB,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h2l8 , I$I00<#N>C 0ChR0l , Ȅlp2   h—4 l 0\2hbA$lp2  h—Q0l@ \hBlp2  h—0 :lH \hBlp2  h—P 8l\WhBlp2  h—lH 00\hBlp2  h—l40L \00#bWP `\Wh—lp2 ` h2lH ,P U P 1@T!0040THPHs0L8 ߹h—lp2 ` hR3l1 \hBlp2  h—l ,0\pPUJAPU@DZ@@=D:@%I$`=<["=0 THU -LM HTe | H0S 8$T| رӍ@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPp&UU U m&teh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \2V00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\VhBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\UhBlp2 ` h—0H l\2}U 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 R`e= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 (N@gᴷx {p1@`{XhB lp2  h•l 0\ }I`\80\8NP`\(0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pLX:e"=t::: 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@L|$(PM0hK$ -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p: -LMT2p0T21$0H0,08,8$T $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT200F3 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0#`2L#0S R000R0 A60S!0\@PN R 00c0C20000#2w#`Kj#$0S` 4 00hB lp2  h—0l \Z0 00r#`KF#J@Y$0S  -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@㵭 T 0 0 mZKTph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0PR0 QhBlp2 h2 l,3 `VZ00h K/0S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`+P, @ %P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0O,0P @, k4040<0<@   140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $p "08 08hBlp2`  h˜0l \0S 0 R !P@ሴ` OX0 P0 ,!K ,(0=r"=Mb0 0  Q-L 0S S 0SQ 0 0 Z:-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@aCxr" 0-L@E!P0h! -L Mp0,"`P0U@, > ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y s"Ht"\t"tt"0!<00  NP  @ 00S  X 000oz000 , 0r00  o* 8P 80(S"ˠ ʠ0S80 S0000 ==ܔ=Ĕ=|== -LM04p@P `PPh 0 0004i6 -LM@P0pl14 RO80 TXH1 R<k `P> 090 P[ 0 ` dE0 & K L0$ `R 090Ho 0 #>XS @ $0S Z00& `Pi:<: p-QLM@`PpXT 00 @DRT0  0 @DRTʃ0p -LM@HP 0h -8L9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳Pz"z"x"x"x"x"x",{"x"x"x"x"x"x"x"h{"{"{"|"X|"hB lp2  h—l 0\0ISh— lp2  h2l , ~hB lp2  h—l 0hB lp2  h—l 08 0 Sj`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0>P`$ @ 0A,(0"A 0 P `4@  D 00p(04 0,08`090ox0  o:0 0P  -LMP@00pSS 004`090LP40S K.JmpB0( 90 i; P40S 5iK: - 0p`L<0@@pKP4{ 0-0L@P80h0 0 U00#1300"#"0aS -h2pLl $h2tl ,h2l ,h—0\2t"0l\Ih—lt"0\PIh2lt",P cU h—`02lt", Pd"""";2o*0yGPP  0hB02,0t" 0l \2H 004 706@PP U@P0U!"1P0 0DP0P:D 0!@0U  0L"PU@d:PUPX P :0P` @00 `HD``LPh—P0t"0l \n «o Ὣm\&h2lt",hB 08lt"10\h—t"l@ 0\Hh2t"l ,JP cUAh—t"6l \&GR"P001"@T:<5<3h—l 0\D:t=p":: -PLM@ l0 R`0 Rhh2t"l ,?0h”t"l \= p-PLMP+ t"h2l ,?@p6`ph•t"0 l\T2X"0 T2X"60*T2V0CT2p6h•0t"6l \ 4nN#T L0`4i=` ⶣ `X:H"=t: -Q6600Lt"h66l \ -QLMP`, <0 @Ɩ1p0C S1 !@T 0 0 i@t"h2!@ l,?>*0D <@0T 0-T20QLPT2 |@&Tx2 6S d 0ST20CT20 00CoN@ᖪ ]0^\"= -LM @R 0 R  "888@S4QPk0h9hh:0@-SS0 04@ Q 0 #88R8 ,40S,(4((40bQ,5@   ,20#0Q00S0 00@?S@ p-LMP0U`0@9Gl0 Rh”t"l ,&00?PUZ00ph?0S p -LMh2t"@ l,6 hw 0-7PS@Lo۩n٩P 2<SKF0Gꔕ|PPꀭ= Q0- L@P Q 07S0@  -`LPVm MVK&0@0T0Fh2lt",h•00`lt"0\@h•t"l ,0 @ FcT\h•`lt"0\@h•t"l ,0 @|FcT"00C0 mt"h2q @ l,"@ R0 6Tڥt"h• l@ \Th•0t"00l 0\2•hB,0t" 0l \&hBP0t"l 0\h•t"6l \6@Tp&h•lt"2\hBt"l@ 0\@h•t"l ,0 @ FcT52Et"h2 @ l,-R`@@0' 6TW 2E6@Tt"h2q @ l,-R`@@0 6Tڪt"h• l@ \t"h• l@ p\=D:: 0-Lh@lt"0\hRt"l0\00 CC -LMFTe m H0S6T  ~$0 p0 t@x s|@("6H SH0&4 010 -L MP `P2 pR,  R000 00 2 ,0Ru 0S kS 7W00Y00SYP@@ 0, 04$W 6Y8Q70!"#;81;W0   0?04@W`"Ȣ"آ""<0 BP0 00FP70000, |0r00 o$\S R<0 R4000 (:===ؕ=H:==D0HD00DD 0P0R0H0HD0 D0D0S H-0 0@008 0 00  RE0LEZ -0` LR@ m~pk}]℀ Ph2lt",h”0lt"@0\0@ ?0uP` V mk}=: p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@W=P 0h -9L4M , 0 Pp9\  R '%@ 0d<0t @0% $R >9R ,R& R 00>@<8 ,0S ,\000 R 8RRWh8pW\8R H8R @888R 08,8R 8R8R8RVڸ6V1h•t"@@l ,0G*pS񟗩L"p"""""""""""""""""""""h•t"l 0\h•t"l 0; S / h•t"A00 0c S @1::#:Jc8@`@ d=:#:0P*pP 6. \ p:4 <8040P<0D 8 @ ОTP4.4 Z@P @ P ` ) 0`,(P8 p-QLM`P 4@QTp -LM04p@`u PrG0 ?04i -LM@P0`p24 R80 TQp2 Rd0 V 0`0 @0("06000P`΢hX2 H0 ,0 &@  0P4<1@@"5 x!0͙ L4 0Y`8@P8Lp P 08 0Q S0@0 S@4p4P 0P 40^0 80QP4^ Y , 00.8 o0000 0`PYh1i:;;@-0(0h@ R @=@1 0-L@P.0hk 0-LP@40h_ -LM@]8P 0h 0-0L L0@P R *P(0 R0=-0 R0S |Q00  -L$Mp%% 0 P D4 < P@ P`@ 0D@4 8 08 44"8  80T ,` X<0<@  㸞10< ,0 0 0, 14 <  R, 800004 4 0V0@p0 RP@Ҡ< ᙠ40 ,0 ,!ᕠ ="=Mb -0 R0S |Q00r p-LM`P0CT0CSC`0 R 0D00 C1T p50D @`e -LM@6P 0h -LM\!0P`0SO0  4p0 < $K(K3 PP@  6(0$ 0 $0S 0 R 6@S|0&|00j> 0V0@c p0 RP@< 40 ,0 ,!ߟ ="=Mb$0S0$04 0T 1 -LM@P( 0R`0S 0S |Q00  <  0 K$K034@ PP $0 0 $  p+0S `0 R  00P@ᰟ0 w(0 0 ,!s="=Mb  P p-LM` @P080 4`0 p阻; -LM`@ Ƞ Ƞ,Ā\ P 8\ \0 ꔖ= -LM< @.8\ 0 锖= 0-@L Ƞ Ƞ,PP 0\ 8^00-Q |0Q 0 R 00L0Q  0 @T 00锖=RR,@R, -L M@K 0  @ z(" Q- LK(; -L0L\88 00S \0  B'e"TeQ Q< -`V`V` pP0UL`p` r@]d 0L0S APP U hPsꨖ=\gg4;<; -LM@>0 00@ h顭꼖= -LM (0("t0'Q0@K0 0Q0KU 00KR0@K h 8P@0KR0(p0tP@`%#7"00Kg\g - 8h LM8#0!P @0 A0T S  =0S  g\g -L M @ 6@t錠$" -L M@ 0@t錠$" -LMD0P#((0"tL1'ATM \0SJ<`(UP 04000@`;00G @&i 0S  㻫P*ڼ0SSS <`00$0P$0S ik<4wtOE&(0("4400$ 0 0 i~\;h;WEV" 0-D0P @L 0P 0000P0= -LM0s@S* 00 0000 - qL`PU  0㚓P6PU $00<0$0@X0 P:00  @ 004;0000 `\ @1@!0 H ΍P@00d@0 H B=t; -LMp0PU  @ {P  0 S X c0`K 0VPPJPhB|; -LMp` t`P0S@0 0 , T@  p0S00@@ o@`*hĖ= 0-T0L PR 0U@ T 0T000@rpĖ= 0-D0L@PT P @T00Ė=(00S S0SĖ= -0L  0 0 -f+f-f -f 0-L MHP0 @(K00  ,@ 0K# 0S 庞0h; 0-L MHP0 @(K00  ,@ 0K 0S 堞0h; -pL0S' P`@V 0PPRPt0   p@ht MbD 0S000,0 R u-f-f+f-f -f+f; -`P0LS mX@X0p0 0S 0 0C01 -f -f+f 88#4  R00+f 0-L MDP00@K0 P 0 S0 0h+f; -L Mp0`S  @8PK0SXX  0#͑P 0 S (  Jh+f;;Pკ -LMA@ 0  R @%-f-f 0-1Ls8P@  0 08000@ -fȖ= -LM@H 0S00  Q0 0 0S00h-f 0 0P-f p-LMPK@` G10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$: ᯦ -T LM@HT00  (0R =ܖ=ؖ=g; 00ܖ= -Lp`P7@T@ h$ R(( `@ pp00 ;(;= -l`L@PTp P 0S `@T$h0T0 h=@; p-T0LM@PT` P 0S @Tpp= -LM@h 0-pPL0S`0@T P@T00020#J== 0-XPL0S H0@T P@T000 .== p-LMP60@`TL  (`0#ptp(; -LM@ h- -LMx@0SlhZdX@T BLP0 @@ K0 ,E@T=L;`;;;|;(%; -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0Q=0= -LX P00@-SP@  0P PR  0S0P 0P 0 -LM@Q׹  0S; -LM$0p@$0  P`y Pq P  $0S $幛T` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !P! @KKP00  00`` P 00 0ZKPPKdx tp 0,0 `K h ;;\ggg=gg;;;; fQ%(% fQ(%m(% fQ&(% fQ7(% fQ|(% fQ%(%0 R ^h0;; (%Q0 qqꘄi(%U((%0 ᬘ=꬘= -0LP4M 0X 0T@K@dGt0 Rh@ P`00TøLL00 R 0X  鶸gggggH=; ;== P-L 壸06G'P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P\g]gg$;8;D;\=PgT; -LM||`P0Ulp@᪉0T UPe PUP0U00 PL=D=P= 0-@PLP 0SvcP  P h 00C0\@P v0SU00h}0 qPP;H=; 0-H1L0@S4!0CQF!0D]S& T T T T 00hE 00000P@80040 0 0n'p@x0 0 S 0CRL000 (00  yT=H=D=P=L=X=0D= 0 0 lQ 𠱴X=D=; -LMS@ \00S SL L0L L0P 0^0?l 0 0\=;;;;;; p-LMP@PLU` ph鍮8`劮0 ,$0廚偮Pp$-f; ;p%;p; -L MP@0T(*$K(pK,`K3$0 S $f , @Q h0( \$0T\ >(0DS<80T:,0H0$ee(;Ȝ=4;8;;Di -PL`s%HpDP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 w4 S 1!0S 2!8S  d1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@ĭ,1@@DT$@D⼭T_ 嶭 00CS0 00CS0ڸ0 R堭E圭00  0 00Sv h00S 0So P00S 0Sh HpfdghgTg`g@;;;\gT;d=`= -LMp0@SSHP S 0S iX 0  xP~i/ T`0 Q00 28 6S Q 000dg`g 0S00ldgP0pQr  8 80, ,0 0\ghgXggdg`glgD0<08 pQ(0 0dgXghgg`glg-L0H D0pQ, ,0 0dghgXggTg`glg 80cR   (0 0 0dgXgg`glg p-LMHP@ - D T h0\ `` T` T0V D0\ P00p|P 0`=d= 0-@@L08PS0S0 0000d=`= - 0L@TT xP\ lp`bXd0 4P 0S<00hbp h[Дi==tgX;\;l; 0-\L@P 2S P(00P2 00h=; p-LM`P`@2S@T<phPT0"2 000ph=; -LM@ K;40S0:00A0 R0  (-f p-LM`@PP  0S  p׃P   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$ꇃPh=pg; -LMP`@V 0FS \onP oiцp0S  SP;; -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP2 xW0`p0@2S @T:0T0 P0(mPh=; #; -0LM pR K >TP@`2S@PT P Wp =h= -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5pgh= -PLPM`\p 0K@  0SV 000pg -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (rl RW xK| K0P x| P@hK0@@ Ĝ=hȜ='< ;;$; 0-LM(P@ 0@?0pg-00 Cpg -L\ tg - 0L0S tg -L\   tg -L\tg -LM$@Ttg -L\ tg -0L0Stg -LAP MK!P 0Q)0SH0@0U0 R0 Rx3Px圩t嚩l嗩d X0ٕL匩HH0 @冩Di`gX;h;g`e^ht;;;(%;(;Xglg@; p-LM`P pP@0T:tPt@0T*dZP 0 @T:@p0MP 0 @T:@;=̜=$ee\g -LM@KP -LM KPK -0 SL 0  -L \   00 -L MSPhRKP K PE@KPP CP,B<9@; ;T;R0 0 0  -T LM@HT 00  (0R  ==g`; 0 0 = P-PL` @T pP 0S @TP@ 0P0`0 000 $m銨0Sx;$==;; -p`L@PTp PP 0S0W: ` @The 00h$=@; 0-LMl@0S`0hSXQPU ;@P@D ,, @A PU0$=;;;;; -LM@"h 0-LMPKP@@ h0 0-pPL0S`00S @.0 . 0ㆰ @T0埲000=$=0 = -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@$== -LM0PhS` /S+ bS` `$pK 0S #@x $ h垧$ 4PX @ @0f0P,`lS;(%;gg ; p-L MQP@D00CS |)#)#)#)#)#,*#X*#0 up-p0 R 0up`0K0,0 uPU 0S0pD0 R< 0(`$p\=X=T=P=$6hL=P=(= -40LM @R A?J;`e 00Cs0 -@L`0 SpP 00L S0 @0V0 0S;0 S@P 0 a0CSa0RS-(P@a@0a S_R@ zThԦU9V9 ; ; -L4M0 sS, `@HKTK   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SVQ000 Qj1 tV@xq >}0PS`LK0 PBTU@P !0001 ,0S ,T$pX T KT@ mT0cP T K0T0 b0X P.U0:S000 S 0a0CS0000S _0a0B`F|00C ZSQhgg ;h=0 ;*# RA0 R0#0Z RA0 R0#0Z RA0 R0#0ZRA 0P0 ZRA0 0#P0 ZRA0 0#P0 Z RA0q@ R0Z RA0q R0`Z RA0 R0Z RA0 R0Z R-D0q@0# R0Z R-D0q R0#0`Z RA0 R 0#0Z RA0 R 0#0ZRA0q@00 q\  ZRA0q@00 q\  Z RA0q@ R00Z RA0q@ R00Z R-D0q@0# R00Z R-D0q@0# R00ZR-D0q@0#00 q\  ZR-D0q@0#00 q\  ZP -`LM0@ᤀ,0 88@40 P0p40h d#  8Pp 0p40ɤX2 ,0S T,崆HBB_D\ ` p<9drpO?-pp\Xs 08q@qt|qq\SOK HP0@3S X30X3 hKp|@3PXSSLKh|PX#@3`# S,K_|PX3\3  X3 HP@3SX30 0\3] <3` S 1s<3\SPK)|PX31 0K!|PX31h;\ ; ; ;p= ; ; ; ;0=H; 0@@K04 <0 DP`PV8 $0PS U V L1 ,0S <,a{40s@0  D  0P | @KD  0@ `004 @K<0 DP`8PH P@$0  4|@KD  0@  fPH00H0 PU@H^@0lD -¢hx ; -L@40P`pDP 00  00040DP 000 -L,MlŸp~, H T0 D G 0@ SO 0@@K04 <0 DP`P0U<0 8 $0PS! U D0HS0T  00 rT01 ,0S x,z0rT@`40s@0  D KH0KP | @ @KD KH0K< y004 @K<0 DP`0P<0 H D P@$8P @KL KP0K 4|@ VPDL0H P0` D H U@Z Dr 0HD0 rH h ; p-LMDa0RP0  0s+ 00 \) 0B0$ S0,0 @0S PT 0 S  zpZ$004 0K(0 @@0\,0 ( 0$0P( R (0S@ 0400K@h ; 0-LMP@0q0 00S004 , (0 ,KDP 0 S y0 0S 0P$ $0\ R0P$ $00 Rh ; -LtM4 ȟ 0R,0 8 0`p| 0 f XKB/ @pK0Ps X0  80sp0  0|sT0  0sl0 0| sP0 0sh0 0|sL0 0sd0 XZX@Z Y 0H0 D 倐 @0s Y 0=0= 倐  0=0=  ,1S0=0 R- 00\ TpKXK T = pK0 X0KPP RT Tw pKX@K ᨀl` r YW ]PP|0 r YE PP0s ]Ox Kq0K q0[@PP| 0s Nx Kq0K|0 q0[-PP30S ]Ox Kq0K30x PP|30S Nx Kq0K| 30x  PPop0s 1s p04 @0 04K<0 8 @K@PPZt@t Y T 0!1\l@P0s =  0SY]xq 0 Q01S00| r 00CR01 x0sA 0 0bQ000S 000S0S=0#|00S 000S0S=0  3 ,0S ,1x I@PU  =@PU|0s .@ PP#0S- /=00\00S 0S0S U=0 00R00S 0S0S UpPPl0 S0PP[{T= N0 @0P9W T@4$t@" |  B?X0T p0 l L0P d0 h ~p0l X0 T d0h L0 P uXKpKZ6(`@ \ 倐 @XKxPP<pKrPP6 h ; -LM@40 S`p( 8 0N0!8 ]_10  10 1 0VR@1H 0k0L30 G1s 04 <0 080 4 <KDP00[ 0p0`o\o0  c( 00b(0 !, ,000 0 00S010 2 R 1 2<00060<  6 070 7 3o h/o +oPtx $ox o|=00(0 S (vh ;\0S\ 0S 0 S00(H -LM\@T BZ@T - L霝= -LP@Q< Pp4`D $1P 1P @0S@ NG\0\08@0P 0P0@00H 0@P@0ST0@ 0Dꜝ=MA0@}fMM, 0-h0@ qL! qPP<0 080< O00@$ 0DPꜝ=== 0- @40L000  p:#04 0qcp=@0 @tn0 S:![00b0![000![00b00S <Yn$0  R*0 S`%*0^ l0 4 Pp ^PU \e*!l!P2@0P8 Y 8400 00U \F*80!l!1@Ye0P 400 0 0 , 0 0 0>.0 N^@PT \*l81 @e00  0000  \*!l!0@0P8Y 4 00,00S0c,00, a08 c@4$ $T$ p-L$M@P0`   K 0`P0Sp -LsM, `Dܡ  ! 1 儀 |` KpPPȁ ́ @80S P104 ,0S |,~S0 0PPT0$ 0 0ePP`@K 40PPgP  KPPC[B $D 0@uPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1$0 jK! . . R l>K! \=33 5 Ƞ ٽP!>Kn kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0$$$$$$ȑY; 01 bpnKoK  m?KP H\5!:0\*  b 0 0b$10#[1 @T00 X #ܡ $ ^P PGpG0!>0kK1 ̑  c. . j?K!#[ ̑ ,h, ; -L,M 0 D 0 ) K3S`@  ^P1D RBB #p  0@pP@01 1PP"0PS@ U3 414  h3@ 0 @/P HP) [R0 0S2 @ TD 00KP00T00ST)0[402PU52 0C4 < 8 @S%$$$$$$$T $ $8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%D R +i"]@@@ )K@\0 S*dgD   D0P@( ) K zP =< ;=0>0^`P 1.*!n!00`G/ 0B!0b0!P PPP0^*!n!00` 10G?  B0 P0PPpT$ -5襟LDM05JOՃkZmY뀔a륡"X `  ``0tddş0P0S P0 0 40 < R0< @0 @ 0S00 0$0D`0H  !0 ',0  !44 15 | $Gxl Id IXXP0 @e(0 PA-(4 (0~.0 00;N0P000#3@p@A Q@Q0@0P K3PK@cFF_Pp00 0B`P@0`*1HH``4ß83$ > 00S P0S@HPK{"ٗ#Ҷ "@11@TrLŸ0 @ @pjP\&T0S @0 8"@0S(4rPŸR $09$00 P@ a 0z,!0 @ 0 0l 0 @BZ 000B@@Z441 eP([ 1  ]PS 1  UPK0 MPC0 EP:ih\90;lh1h 1hht3h<h"=T ;"% =%hhlh =ph]i`hPhhpiid=hh$\ ;T]hh ;x=p ;lh4kh ;hr/ ; ; ;"$ ; ;"$ ; ;!$ ; ;s/;h=hh h@;PPKPKBP K GL0@P@@4\0@]AQ -@ LHM0, X 00 TK0P0 T ( "P0 S$ iiD <;L;t; -L ,0P  -L M`0  P@D   0S<0S90 V5*Y/ ,0(p0,040V, K PP ,0( 0C,0 U pC@,=,0V0  0P00` e =8; -L,M@ @PpL OP`s ,00,0 RJ.$/$/$ 0$00$0$,1$1$2$4$0 0S70S4\5 X0*(0P0 D K P P  ,0( 0C,0P,_=P   D06P,0( 0C,0 ,I=,0( 0C,0,== 0000  00000 8C80C (0B8 H@K 0 0 00H0  0P0@0H0  0P 0 00H 0 P0S$0<   0(H KH00c0S P0`0P 41    0 $< 0 @0 0D0x0S s@K $5Pk2[S 2[8SS C8S S]@  @0KPT@K 5@ K 0S40S00@0K@K 8Ks @K0S@0S@pK $L5P&2[S' "[R R0 0  !0 0 !L 0 }R0 0@@ K 0S40S00 8Ks 0S@PL  =~f}fwt@vt -L pq@P? 0aV,00,00000 ,0( 0C ,0'V 0V@ 00T   1 2 1 1s 0T@1 21,;,0( 0C,0 ,; -LM0 ! @ Q 1Psbp 1 81 U <0!'! -LM@!pPW. ,00,0 b 0Q 1s 1 01 U 00Uip   1 0 1  -PpL(`0S @ @ -LtM`p됀KP@  0 ,00,0,0( 0CP,0,U 0 0S@P p }4P!; -LMp`PP* ,0 0R,0 R0S<``0,0( 0C,0,:-`$@ 0 1 `  -L M, p0 , 0!  Z PP0b\! Y!04   Vg0EEW  c03PP N@B@Dx8 X0  R@0SB4  c03P- 6@B@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T = -L Mp 1Qぐ2 A' 0a >f<:`  > f3: RH02 0"2 SA' S', 0 00202a ,z>,0@f :00202c0 k>00Pf900202S,00000''' -LM@`p PK 0S Szhh1 Q100LZXP90(0 R 0S00P P0 0Q 0V  000PW 00,00,0 0S0@  0^ R1s 1 11 ^ P`1 11Hh =hLh~; 0-L@ZJPa9T @00 0S 0(d`00@2000@ 000 @2 @0hH; = 202 -pL<gZP@ =P P0\2f@0 `P0 20BT0Ҩ 0 ' v'0 0pB @B`c= _=!CZ= V=00s @` V 0S 0S ` V 0008 4 < ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV'  0 $}"xh -pL2`0C(2P@U R ,00,0 ~PU@Z000Sl0202S_PZ PU4Q,<Q|hZp1p!@P@dDFA@04 S`ʄ1d8A R<0 <000<0 <۬<I0 @P@dDFA@04 S`ʄ1dA R40 400040 4ᵬ4#'''0hhh)h -PLMP`; Q 00 0SU ( K 00CS 0,00C,0,0 S( ,@0H![6,0Sʸ0  0S 0S@ R000  00C0Z@p0K$8K @㲂Kp@ 0 㴂K,0,0C,07p0K$8K@@㲂Kp@ 0 㴂KP;Hhh p-LM0@6P3 R.`P(0K$``0KaK`P`01K!K 090 0 p 0 0pp`aK0 90 0-p p (("` -LMŸ@0p \`P 7 R `0R Pl U. U  00S# 0s 0P  00 0101 1s 0Wp1 21   P1 1  0Q P 10 1 1s 0 W 0pV ` 1s 1 2 1 VZ1 211 21 阄i p-LMP@` T0 @ Tp -PL(p`@0T 0@T  0-@MLDPD 0<PV, (@0P@V0=X;Phd;h -4 L014 s$ 08000=40$ 0S00 Q0 0 0S0040$ Q  0-L@PP 0 0 0^ P 14P 01! 0 00  10 A 000  ꘄi(04  1S0 1 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  iP000(0!0 (0p -L M( 0 0@ 0(  1K 0 D0ϠAl2l1!Bb!!  <<Mb -0L M PRЀ 0(K)00 0ϠAl2l1!Bb!!$ ( 1p 01"0`S@ 00 < |<~<<@ @`=\=*hMbM$ -<`L<0 @P@dDFA 02b SpT0 S0``00`ᷩ 00C0#hh)h\= P0 0 -LM Kp$ K`PU0  0 00 0-V@4 0P@$@$  00S0P `(00(0 ,00C,0 (0,04Ph= -L$M`8 P 0S ,00,0P^P$< B @ P !!@4 -PP?4p P" @0 :0GPUp  0<S< ' 90 P - 0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,a40@K 7-PP@ -LM0pS,p @`PsJ ,3Y 0S8P < !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 Ө80` P (00(0* ᝨ  (0  (0W  , 㰨(0` R0(0 ဨ  㡨(00(0v UPP( W`4p8 ,0( 0C,00p,0 0 p p00fP,   ,3 0,0  80  0Vq1RnU rmGPp ,0 0 ,0 00R]*40QUY 0V PUR!0S d=h -LlM Q$P  S% 4 P,/A#bl p p@K \0 0  % 9Pip T4RL$002c2c30 xK 4 t0p$x0P 0p 0 =9@ =C  0p 0pS`XQ#0#00F01ᬧYAp0Sl0S x@K3xp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30  Z0  h0  !! 5,l t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 51G 0`01 ' 0 (0 0(0 00C0ZH " + 6Yp ` 00 0 @(  ( 00C0800 F p80 P(00(0  B ڦ X, Zj ⌐ p l MbQ=?Bl; -LM0 @$P`ަA@p 0 S ᫦o000 p-LMP$`p208O*0 H0p -LM0, X$p4 1@`T 0WP`/ U@0X8Q q < 1@`T 0WP` U@80X:lT,0$80HTP4,00,08  4 TPPhh -LM0@  t h n 10 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 4  -8 L0pS`( 00Q@LT  0 P!450`/14P 0@4P40Q000p(0* 8\ 0< #4# 0Q80 @#8< 0-80P@Q08#4#04 < 0!0LS0  Q0 0 0S00(080 R40h?S40,  , 4h 0-@L P句00  0@(00(0   Y0h 0-@L Pv R 0 0 00  0 (  ( 00C00h>P(0 0 (0!P -L$M`"0$0( PfP@8pW@ W @4hR.0 0 #P@T0$0!0@;00 0 P@1 I 0 0P@ ^ 0 @p 0,KP@/, 0@0b 001 Y$$q0S  p*0TYT$1 !S@#@3R 0! $0S: 0S* @T  0 4`URP418 (1TP#2@0T00S DK/K KT1 l < dQ 0P 8P XQ HP Pph<H0P `: D@P R   R? 0`SD;+@P@d6DFA@04 Spʴ 1d1 R D0D0D00D  H00H0 D"PUp H0#KPP2 @f7 42 *(Pp?KP 0"Rb 4"*P42p` ?WpWKH0M0QG8QL" 0p Qx:P'〛?l% 0  !0 0 ! : *@P@dģDFA@04 S`1d1 R 808 08  008  უ8 @Q0@ H0 ?D"0PT2 U 7  42 'Pp?KP0"R T" T" 4"c*P42p`P2@f H0 `R #T"0<  P"0100b0P 0S42 pm !P0 六h0$P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T008Pp~42OKcT2( 2 K P2<$Po = 'Pi W|1S0# 42 2p42  0> Pp pӻp @!0!!0 0)0 !!0  Q} 0  !0 0 !2 0  !0 0 !0  0 000 v &P'jaPL"p 0Cy Cu<,0S KPD< H2 K( <P800 1?l 1S H R < S <H0 7  @0S@0[70@0S0  !0 0 !K < l?  0  !0 0 ! S@40 0000 0 0  0\j PL 0 !0 ',0  ! L@62  0 202 0`  20082 0S/KK 82 4_VPpH; k K⿹PpD 0t @ Pp#H@"D00D082帀8"0082@"82$ 8(00(08",00C,08(0,`Vź-<@ 8@Һ"0Q68Q OOL"p 0!P'K;1!@P@dࠡDFA@04 S`\1d1 R 808 08  008  _8O< 80Q~ 0Qz0Qw0!!0 0'0 !!w0!!0 0 0 !!L,Uc?_00C ?D%h=Pehh)h0nÃ0g`ƃ. B0p!0 0 #PP D!D0 0cC61 Vp ಐ 0 f R0 f 0S P00,Ř ,忘@Ppp P P pp P p p P  P P p p PppPPppPppx)h=;4;)h=hhT; - @0 0cC61 `BL!bQࡘ`p T 0 S0``00`mi 0&% hh)h=h0@-0`S\PX0 Q?#/0 IS0B!@R !R %50谬===e -LMp|`00 Kl !@6$ K@LPP @ 4$@0@"0==8.f=ht)hh -L0à PP PP @P@ P P   P   P  P P   P  PPP -0L|; -LM0@ ;Ph? -<0LM   @)0Sh,ꘄi -LM0@ CPhp -LM @ Ph`0S00 00 -0L88!M11p *`@0 PP0S H"@ @ 0@ 8PK0R<0 " 0 < P!Y @0 #!P C!h]9i p-LM@P`@V0D  Ppph! -LM00 3`0 P0Q&Q< , 40 0 㠖00@00000p0D`404x0, 80 Sl 08 a R` 00X 0@ D 0D$;D H 0S8<0 @  0<$ p @ h2Ll p@000P<G]9<;;"!;;<;QX;; -LM0 Sn0Lr0 R 0R  R RmPPx 2nP@h _aPU T 50LPS 18 T *F0nS& aS @0*T00S1@T<1$l FwSt0S! P((04!5U8`P000t R 0S΄ 0 F 0FwP 0d 0F|FxFtFpmF;1hi;1h;;;;;;; ;0;@;`;h;x;;;;;;;;;$;P;080L800400 0-LQ@P 80Q P 441 R 0004 0-LQ@P 80Q yP 441  Q 0 0P 8000040000007000 000 0-0L0\0P   0@\!:P@0 p-LM418@ Q ` -PU  p87800p p-LMP`U6P1 80P. P@ Pp441  Q p00  0 R U8P 80U phP 41  Q p4@p -L0P` Q@p -pT  %`X  WV  -LMP0u@] 0UZ u 0U 0 U 0U BPHv 0V 0 V 0V 1P7w 0W 0 W 0W  P&u U >;Pv 0V :`w 0Wp0  !0 0 !v 0 Vw 0W -L0P`Q  @p pT  `X  WV  -LMP0u@N 0UK u 0U 0 U 0U P9v 0V 0 V 0V P(w 0W 0 W 0W Pu Pv `wp0  !0 0 !v 0 Vw 0W 0-LMP0|@  0\   K0~P U00 0 U 0-LMP0|@  0\   K0~P U00 0 U p-LM0@P`0S 2 T 0T 0T P$0T P T @@0@  !0 0 !p R0Sp p-LM0P@` 0S 0U 0U P 0P  !0 0 !p p-LM0`P@0S + T 0T 0T P0T P @@0@  !0 0 !p R0Sp p-LM0P@` 0S 0U 0U OP x0P  !0 0 !p -0Lp`@/PPUU![P P0!!0 0,0 !! 0 R*0SR:0 00S 000 JP -LMx;P@8001h 00CS0<1h 0-0LSP P @000 0-L@P P~000 0R0 41 ` 0-LP@P0 04 ?P00  0"R   0-L0QP)@3 Q 0P P0@ )T 0D000Q^0 000P 0 0S P 0T@P4 P ( 0DT@PP"1h -LM0SP`p7 S P@ T  >[@S0S0 000@T 0 0S @TW pP4 @T   D@Tp9P1h p-LM0P0@^ `V 0 0^ V0 p\0T@ T@@ TP 0$0 @ȍ@%ᜍ0" p-LM0(@KP `P0  p0 -QLMpPI0 @ R  0R`0S  0RnP-` Qڐ0V 0GSH$$$$$$$X10S0S0P 0R W   Q0 PQ0ba>0>0$ 0~0ab0P\0HL0 /<00A0@0 @Ȭ=Ь== =\ 0  -L$M@ , 0 40 0 @@0Kό@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% [. pV0@R/ :"M2 0S @##mSPU`!q p0奎 @K3' 8 3,@  4X 8< @K@KP à ]C@TPa`~ pà &@K( 4@@K @Bh= 0-LP| 0\ @ IH 0h0 0H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L8@ 0 0 pP700.fx3h;= 00CS09x3h 0-PL@ 0S  000@000寋p0h\0^  00lS R00@ج=ܬ=; p-LMP @ᯋT0`SX 0 R0Z<00@4<0 R00T00T0phkX R44 44^ Q4 ^<000 <0@40P<0< 0bS -LM@ h` `00CQ000 0 S0  0S00+h{ج=ܬ=; 0-PL @DT0X0CQT00X0 0 S0  0S004 <00CQ 0h,0 P 0SPܬ= 0-L@PP XP 40S P0<0S -LpP` (@ T $0 `X*0$ -LM@ $0S :S0$0$ Rh0( $0S0$0$p=;; -LM@0 <  0P0$00 $= -LM$0S@ 0$0$0 S 0$0,0 h0$0hh=0@-P@Q: P8 SO 00 5 ^.`$`$`$$$$$$$`$$$$$`$`$$`$`$$$`$`$$$$$$$$`$`$0 Q \ 0 Q \ 000 0Q Q \ \ 0 Q \ 04!4 0S -L M88 0@, (O 0@55h$=P;@4h 0-LP }6(O/@0810@4h(0(0( 81081 0-(0L8!PR @(@0( 810CS810(0s7@4h -L M@PD^`(P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 06PP P 0 $00$0 $0 0$0  -0P` AL r(@o01 0!000X8<0F 0110010@ 1 100 1011001011001Q t1! Q0  !  !X10110 1m101 R100, 0  !0 0 !80S 0 0S 0  !0 0 !0  !0 0  !0 =D- 1B#20R00S1 11R= -@L(`P# pP @101 ! \1010!! 0  !! !1S0 10  !0 0 !PQP= p-LM1@0P |0`S S `Lp0!8< !S08<1 1000 -LM(@!1!0108<1 J0P X; 0-LM(@P1 10 1Q#P0 K P P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 P 0-LM(@P1 10 1Q"P0 PK  P0 1101  !0 S1%Fτ"0#1%( 3(F q P -@0QL`p% RPP @ 02PTr 0 R0 b0h -LMPS`p$ (1@T 80S@TX0 Ġ T\0P V R4@T 80SD@T0  0P V 500CSP1h P-Lp`P$ $` xP @T U 00 V  V 00V U U U D@TBP@ U 00 V V 00V U U Uhi -PLM@1 P h p-PLM`P @T U00 00  D@Tp@ -L M0A P`p(@10(,q$ai%0! <  < !@ !101! 1V01 0!10101= -L M00p P4 rCp C;00  0G4 a0 1`1000 10 4 0  \#0S00Ň 41 RG  0  ! 3 ! 0  !  !.!0 %0  !@0!! 0 !!00S , 50SN HS ,4 RLoU0   (200Q00S#&100Q00S 0!! 0 !!R/p .02S200ŇL0!! 0 !!S1  0   W Z& 0!!0 0%0 !!0 0R40  0Q t0S0500!! 0 !!Yt0S ~ {Z~ 50S{l="`g -LM0`!30#P03\ Rp0@à@0!! 0 !!!0` 0` !> S> (0!1S S  t?90`0  !   !80S  41 RR?Z8Z  !RZ %Z0`  P 0@!à 0!! 0 !! ф  =`; 0-50L`0 , !0 0, !@@$!0 "0  !  Vh4X0 @P0pS ᓄ000 0@@0DŽ5hh 0-0L@T P00@T00!!0 0"0 !!L 00 L 1h -|1LMP @0r`(@0 !    !1$!,0 0R00 ,1(40 0140 00 ,0S5 Y1011  !1 1V 01 0!10101 0<  < $ Q001$1(1,140000,0 0 oꘄi= 0-0LP@ , !0 0, !DD 0001 0h(0$QPPJ= -`#LMM0 ,0 00 @`$4 006:D R @0S 䒟,0 S ,PPK~" 0p"p7!P 0` 00 K0- 0P 0 @ 念PP 0MK<1   0ᑺPP<80S P <0 <x@U,\8 016 ᜚FK 0 <xh!<0"00.<7S |KP (P $1pKh0 (!`P d 06\0 <&X  Ơ0T ,PP< 0ኮPP8 8[<P p`@6PPPL 0 = 8 0S9 0S$5 Dh;,;8;Jt=D; - L~N -LM@P`pBT0EP@S$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$p $ 1 014 10 ᘄi4 1S0 1 Q0 0 0S00 0S 00 0 P -QLMp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 SP D0  0S  6ꘄi 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` P 00 P0-LP@T*@T:P 0S* !0S:0D004l; -L@`p PP0 Vp P  00 00S0@ R0000 0 $ p-LMP @T @Tpp@T ` R0000 0 V@T 0- L@PTP( 0 S600鐭= $0R0000 0 ꐭ= -PL チUp ``@T @ThK(`@T @Tꐭ= -LDM0`SP\` p 0B S|!XKsP@MX00C Sj$$ $$,$$$$,$4$<$T0尡 S PH\  P@.X t1\ H  a R2: 0uP@'\`0 \KA0TK 0 @Q XT  Q  @ u \K P@d`\XT-HDP@v$=]i,/p'}&$\1$)#d' -LGM⼨\, P`p @# 0B9S9$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0 S ,U0BFS񟗙$,$4$L$T$t$|$$$ $t$$$$$`$$X$$$$$X$l$`$`$$$$$$$$$$$$4$d$$$$$ $<$D$L$T$$$`$`$`$ $$0$8$@$H$`$`$`$h$$$$$$$4$<$L6 8646  6Ɵ 0zƟş 7䕟0 0K fPPW 0S0\80Sro0|i`ş0 L@P00W00SP 5 E0MK 4 /41P0FQB _=944 i/ğ0 L@P00W00SP H4 0u 0p4cğqğoğm 4 ̠ße 0[ 0V0 S<0U KOKቧ PP3Q p3R  04L 0@8C ,3S 1 01Q2 2 (2 z"0L 0y\"""`2^ P2R  0ZL 004BNK 08 bPPz8!0BSR pnL 0@e!!!1 Ϡ&-WL 0QL 0(JL 0C  0>( 0PP`L 0#+L 0% $L 07 !h;:::mh= =$6h46h 6h@7ha h 5h<7h:==\=gt=t^ha0hijhhch=0===T=Hhchmh$dh$== -LM@ \QP@ 0LS$$$$$$$($T$$$$%p%%%%%2 -1!0 1!06!0 0b6 :DP`|10St19P`X1X!l0  $!A 0@10S (KP` (0-Ƞ0S 0 IP`0dSd00S`Wh00SX0T0P0L0dei=e]i=;|]h=D7h,6h=H7h(6h87h06h47h 0-LMPR@@ K P0 0R 000, p-LMP@`  0STRPPP  0T0\00S p p p -PLM0 @ 0 SR0 \K  0 @0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  0T0\00S p ,p p M-PL0@ 0 SR0 \  0 @ -LMP  -LMP -LPp` @ U  0S*T S 0Z030#WQ$U T 0S: E0W0P00S 0 00@SC /00@C -L@`pP T 0 S:U T   p-LMP@`P  0S:T\P P  0T0R00Sp f p p 0-PL@P 0 S:R 0\  P -LMP@p`& V00P P P`FU@ WVX X`F PX@PU0h00h 0  !/ LhHh -L$MR, 4 00 8 p04pS,H0 D Q ^0S`@0  Ps4 2< @T 50S Ufp %% % % % % % %80S$ @T< R < <2 ,0S D  0cR0  080S 4 R D00 O=0H0S @0 WSD0 0D0 4Z 1/#4 P@   Bpj@ W*D /D 8M .P8/PG00 41 R41 0S80 00 41 0Sl00 00 Q~Q Q0SSPS ``@ 8 S01h1h p-LMP41`  0 @P 0 5 0BRS^@KA AAA- > 0K0 1 z_08 K10s, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 L0T$!P=9@ =C, 0 ,0 ,00  "$20 $ 41 !01 !0@ <1@5  00 0 1.`0` X0Qt0V/@<  00"3J6?B1!2 -QLTMQ0DSP Y 500CS00   V$0 00 a 80K`0 \ H D T P0K =p`KX @P < $ XKFnP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt P`sxP K0@@ h0K `0 `0KH \ X0 T D <  $XKnP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 $XKmP`@P@*0S @T:0l00S0*d P`* d0 T h0d 0h0   `P` pd0A0 d0 p x0t0Qx0 t lR:0l S: `$匂A0dKt d0 `,0  TT070- -LM@Pw0Sz b PU  PUPfP_x2p"@`@  @WD2  QP@U`@ p 0 "S0f"+0 @ `   $ 0, $ 4 ,0< 4 D <0L D T0L PTpUV00PC00  T 0PU ` 0 @_  0$ 0,$04 ,0<40D <0LD0T0L PT`U꤭=p]ht]h==|]h;; -LM] -LQM\@@Tp`W\0/ PP'  @@@( $0 ,0(4 0 80 40<08@@<PPP  TlT@00 < _TPTPP 0gP p-L M\@` Q 0 %ppQ0 \"\ 0 1PU P P 80K00,0 0080pp 0pp鴡==@-QMX@ ^@ L|\0( Ѝ@Ѝ蘄i p-LMP^@ 0(`K^  +v0@vupf3e@0T0P00Sp`e^hL;h -@tL  pP`uH>"/P`嘀tp 0 S0 00阄iL7h 0- 0RQLP@Q t0 < u0  !0 0 !0  5 @00@0 ꘄi!Q0x ꘄi -p LM00K0x>0  !!0 0+0  !!#阄i 0-0Q@LP) 0  !0 0 ! R 00 10 P t0S0 50 0QtP0ꘄi 0-0 SL@P P  R 00 10 P  ( @0000ꘄi 0-@L *ut0PS 50S 0  !0 0 !0ht} t0-SL 2?\ 00S00 0Rt0L7h -LMP pt2 ?`@T t0S @T ot t 0pGS50S0S 050嘀$0$ WP L7h`gi -Lm  0.f -LM 040,0 @ p0 c`0E"0 $@ R:0S*000, R 40R8= -LMp(K K P`5 (42@ ʚ; -LMp(K K P`5 (42@ @B 0-LPL0@ R:0S*000 0000.f -LMp(K K P`5 (42@ ʚ; -LMp(K K P`5 (42@ @B@-TpHP` 40 ^5 420@ 40^ʚ;8=@-TpHP` 40 ^5 420@ 40^@B8=0-, 4,00Q0 40Q08=0-, 4$00Q0 40Q08= p-LM `0@N 1QQ0 U 0 0@ RP0R 0S  0R@p00 0$s'p'=@=<=0;; 0 08= -L,M@KL L`0Op0K! (L04K @00S@,04 S00S0B40  0@80 aS :<0S*000K0Q@PP40`0#0 RX46QL@@P 0<`@H DP & K@Bʚ;.fh.f; -LMP84 40 80 4PD D@D2p 0g^ Dp @@@ ` 0@ pp% "0 0S:0S*0004pK0 K0@, R:00S*40040 0  $04 @cT@T P@DD RTD4 $ 0pKQ_`5 42(0400K,0^`4542!000^O0$  BE!;!ᣎqpW!᧮ᇑY ! Q P)o `!nQPU`  D 8@D@@p @$08@ O8@04 40  @Bʚ;8=<=.fD=H= -L,M, LK@P`p @  01P@ ,0 S , P h0@T  PP @T 0@h<=H;@= -L4Mp@0T,0 P ؀` @ `T @0TP0 LpK 0   %  @`T 0 P,@$0 ,0S ,@=h;;;;$$ 00S000.f.f -X0LML0}/P@/88@A3b000 =Mb.f<=@-QM@ 00CS 2%82%X2%p2%p 0 Ѝ@-@Ѝ 0H Ѝ@ 0 Ѝ@ 0 Ѝ@[.f.f@-0 MR0000 0 `Rc =9 A = /02t@0 $ 0@Ѝ0}S}?r000$ =9C =CS0 P;h<=x P0- 4 0$000Q  00$000<= -L M@ p0pR K\0 R 0HRb $gjs 0R~\;$6h; 0-LM0@S S 0PK X0SPK70"c11PK 0 0-LM@PKP  0P0SP 0-LM0PSX@ S0 D0  0QK 0 00Pʚ;= p-L,M `K@ P p 41(PK 0@a(0 $ P@0S:ẻP0ᵻ0 p0#PS 8K,4 ,08c00Pc0 A00 , 0 ,0  ,0 c00Pc\0 A@ 0@ < <0 @0@KS0@0 <0  0KpMb.f;ʚ; 0-LM0PK S@ 0@S  0 P= -LM@PP P0S0S Kl00(K"c1 1( $0 P K PK P= p-L M0@SP0SpP @K PP `KP -P 0-@LQP(0S0S =9C =CS x0S0 =9 =S B JP( ~P PP;h?B -LM0PS@9 Fo0`S ,@KŒo 4pK?,@K$ R Q 4R $  0 `cQ$  =9 B =$ 0 00Q -L M0PSp`@T 4K P6\DT@ ,@KP4`KP 0S#P<K,0S(0S GD( 80, <0P=9@ =C, ( , (0 | n @ n0$K $0 XP?B -LMP`^0S@$pK0  0=BR L0 00$ S ,K ( 0,cP=9l A =( (0 , , ٹ00@Q   0R?BL0Q R 40RQ R 00R0 ?B=0S0 0R0=0- R \b =9 = L 0 0 aS 00S 00S0S 0 000 aQ 0=)0C -0 p-LM@ KP  0 `0nRC(0 ( =$ (0 $ S` ^P 0K ` p $0S -LM@(KP`l$00`( S a,0 =90 = B0 ,0 U QP 00S K0000UQ000000!0 Q00X[hX;h00  0-PL@=p0  0|0  0 c0cR 0 0 PP$0h-p00 PPL=hX[h -LM@< p00 0 00000h pL= 0-Lo  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @o@T@0L=hX;hX[hXCh -LMqto0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0So:oS0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@onX[hL=X;hhXSh -LM@PT 0倐0c/a"|,K0K #u Gu0H0\0  b,G$0@TX;hh;; 0-L0LD@<n84PK@TP0hnh;;L=X[hX;h -LMP@T0@ < 000M0 0X=`[hTH%\==H%x[h -P0LM D@R80(0 h+X=`=\==`[h -LMH@0DSK40$00 X=`[h\=`=d= -L MaPQY P= P9X0 P@0S ,Q0S" PU qQ0S PQ00 sP 0Itp K00, 0P@U4 440$-X=d=x[h`[h`=\===H% -@ ML400 @00@h:;|[h|=\K% -LM8@440 P000 h=$N%'<$; p-LM `P@P0 8 00 P`   0pM% p-LM@ j0 0R`0 P0 $ 0SjphP; -LMP`U Pjp&@j T0 0` 0j000 @  0pR0R@ bjY0h=|[hM% -LM@<0< H0S$000hU'<$N%\; -PL Zj0`$ @T p0Sp0000"j  Cj00C`0P@T0 4 000C0jq5|[h; -LM@P 03 -L; -@@LM 0t,0, /C!b0 h%.f@P%=gfffP\h -d0LM @T0< R@ @000i000000iP\hi`gi -1LM|!`0Vダl1, `d1@T X50 0CS0 00 p Q5p0 @Tv1,o idVpPl0p  l h00p l0^hK1Q |0 T 50S d0.ZiH 0#1!S  00haih1h=L\h=i! p- LM0 P1R@0hh00BP0 0CS0 kbP 00CS0hphai 0-P0L @=i@0.0P50 @00@0$0hiꘄi! 0- `0RL P iH0 >@5 d D00D00hh똄i!; -1LM`$PK@0$pQT 0 c$ 0 cR=9 = A$ 0 $0!Q=9A =C 00 P/0S0S @0S0S 5000  QT% 0R 0R 0@ 0Sꘄi?B]i( 11 R00 T\hD\h -LM50@SU%U%U%V% V%U%U%U%+0500S0 S > <0S 000S00  R? R  B0 , !  !;i`giT h00 0S0#4 P,0 <0S0 "!i`gi 0-PL #hh0@0$S$0#h001S 0 Շ Ň0hg!-000 00 00@䈰=X]hh]h`]h -LM0@S`p>0S,0S00S7  0PS0U 0S PPp0Si0h 0T0S <4p0Z따=;;<;;(;,; -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0_,`[@08JC8 1!Q4K 08SVX]h=X;l; Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00X]h -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0P4K 08S,@=x= -@Pp L4`V 0 h$W  0阰= p-LM @`PU 0 php; -PLMp 0 Q` @@i`P 0,0 a0S00Q \@@00 `DW?  $mY   1P @0S S $@0SP 2 ,00 R c] 0R0 S0 0R0.0 S00`]h0 ;X]h`e; -LM`@/PpU PPN Z0 S0 (0 @00B 0d! <P7$` 0\V@@Tʄ@T@ P fA+V 0 !R0,0   0V|y 2S00S \0 !R Q;;;;$;,;4;X; -LM0`<K  ,0  @0Sj 0S-aP g,0 S ,oA0S S: $@0S R 0X10  0P 8 0Q 1 U1S RR 0 R <K\0000 ;0S Q0 0Q B 0 R00'P h;x=`]h`e;; 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ P4  0@ P0 0h'{;h]h; -xpL@`T 0P$ R U@U00000 h]h 000T]h0  B QT]h -tp@0L P `R $0S@0  P PT0`]h p-p0LM PR` $0@S T pV V -P T8`]h -QLM@0Q 0AT (00@T,00,0,00CS,0}@-$ R$ $@@0^"*$0S $@ @0S:$0S$$$X@@0^:\ 0RX X0R$P$0S$ X@@ @0R:^:\ 0RX X0R$P82P *0P ":p-(0 S<3(057<@@0 0<080Sp ( 0 P0Z;@@0 0< P `0;P(@0  ;0'; -LM 7, R0  '0 0PU < 4( <"4')Q 0`<4<("4&<S4` x'48<#8S8p 2\ *0R :P,(4@<` P08PDp,Ll T \| ⴠ< < 嶠4D 尤 G?QP' @0 0 p0XW}^{ P @K 00  000S' -S$ S @ 0 0 Y @ 0SS S x0@KS0x  K00 > 0 07S  0CSS S0 0%t04St@00;(;UH;`; -L$M80PS,  (0S KKT re 1R0S PZJ ,@@(208 40 R00 Dڸ`帀0p 0@Q6R40 4@ 8@ 0H0 0@@K H0@K@@ 0H@ 0@RQ 0S0@ R 0  0Z (,e/7e/1WEV -L,M, <,4 D ?08p ;4ᔀWHp Po0 a 08<0 (pT @K T# 00$@@p, X 8 8PK"PK'!0@T S<0, @@K0@# P0K"`PQ`p4,0@" V",4<0(T 8H 0Tp0 @@0`pFH X,8%0,0@, 004 ;000 -LM`D 88#0| 40 , 0 a@̡ 00!1  0,0  X@<  R TUş d <  B?+$0O@ 0 W5 U44 20 @8 P0 0,0  8 0,@P0 0 p` @0@ X < (0R 0 p%]9%x;L2<;;;;;;0  0 |]ht]hp]h -LM@+000 -LM0@  ePe ~DL00@ @0 00$0@  t]h|]hp]h; -LM@f LR 0@00  0 $0 BR  |]ht]hp]h; 00SL0 -LM0@0CsP0B ,KL(0, 0aLS00  `=94 = B4 00 T004 0TQ=9A =CTT 000K Z U4<$` p@0ʏ 40K*n,0P@ ?B4;| -LgM 0,0 B!1 Ġ "88 #$$    $LdHA  0*pP;00-K0PP*0*KK "0 @@ & .K 2 S0 S A0h,0 S p,)S`000 0H0 040`#fhiTeedA\#T;r-;J.;;; -LM  P@- 0 00  뀃%%%;R, R  00SSAπ " 0 R$0|$0\| -LMP@ PLLH0@T 0S$ @T$;8;=`]h; -QLM`P6 0 SaBQ00`R00SppPEP@ 0@T 0S  @T)P00SrP 02$04 40 ,븰==`]hD; -LM0 ,0  PtܔW00 `KRW M0S HF R\P~@~ \`"P  0W0T00ST0 S*R PK0 EP p0S W 3P#   \PP~@J~[|P 0W0T00S 0Sw[ ((0"4400$04 ă\ #3C 0S  ,0S ,R2  a 0b!((0"4q!$#@9 0" S!$ "^P@uP( ,B0U00p  "88 #$0a0""p  "88 #$0a0""}AS   0KPM 0S \@DPK 0|Pp ,  |@aG5PP 0 2$40 $`0ā T@L0 PK$hh=#fP;\;=.;;0;l;<;4;`#fh#fd#fD;t;(%|;;;;X; p-` LM0`S@ PY P @1Sp1pe@ 0S 0 S1Se-  0/f]hx; -LM`@pPP   pP0D 000 0  0@԰=/f R0 00  0 /f -LM`Pp ^H QDP?1@ T 0S2 @T0NS ꜍%%%% 0 -T vZ0MZ0 PiT 0 T 0S 0\/f]h@@ R4 000 S00 /f/f -L M8@4^ 0 P00 /f]h; -(0LM@T @T/f -L MV, 0 XP. ,PGA@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000 0  #  P@ 0-@LTP  @T000@RT R000   00h -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hW 0R 0000 0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP)  R 0S 0S * R 0  0000 0P  # ; -L4M@`p`P, @jP@ ` P 00C0@ @P T4 : P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  )<R0#03^0S< 8@ 0P L<0 0QP8@0P  000 0P' ,#,0 p0@4 L , ; -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp0000D 0W ` U*00 U R000 OPp   V ;; -0L@`p# PPp0U W LP  P @R000 xWWP$@HWT00;]h p-LM P@* 00  00 R 0  @000phIW`hW0 p0 0S0 0  @2W` phW]h -PL M@ L 0@ @T  @T ;;(;<; Q0-L@0PA 0R :x0 0 PR0 R P P0000 0S0SS RRt^ha0p^hh^h-0x0 R0  0^0\\00 0RP00t^ha0 R00l^h0 l^hx^h -D1L P@pV 0R`) hV000\ 0 AQ 0 `\ @1@!T P` 0Q 0Q`0S@0T``` P` 0R +V 'V#t^hx^hX; - L@PAVA@`p 00( Sp  Vst^h|^h 0-1LsDP@   0,0, 800<0V00@U ^hذ=t^h -LM@ VH 0S00  Q0 0 0S00hU^h<0 A P 0-0@ LRPD0<0u 0h鐯00000 0l^h|^ht^h p-0LMQ@. 0Q 0Q p0 p` U0 $PBUU0 PP0Q x0Q \ 0 0 000S$  00000}ff@wt@x^ht^h~fvt 0-0LS@P00 > 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-$M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000$Ѝ0\ 0^ : 00  0S   P0@-0 M @00 Q \ 00  0S  0000 00 0000 Ѝ \ 00  0S@0 p-LM0PS0`0C0D0< 0bD0 R000Q  0S00``80 0C 80 phh0t( |T@ OT/f -LM p@|WpP`0S:000 0`030@0 0V`UP@^ 0  40 Ph 0 `0L 8,0d$`TpDH000P0 RU 0 /">CXh05%03h05 5P% PB2P5t% `(`0<0`PlP 0S0x p0|PPPPPPPPPP 0PP00 X@@XP0\0 @X 0 Pc<<L 0 P[ z=^h/f^h=`;h;/fp; -LMX @R\0T \0\00X \0 P PQ  Q R0 00  0 = 0-Lh0P0 P 0S@P]S/f -LPpH L0Rx `V,P@  `VT  8000T Pd0` 0 d00000@T[ R0000 0 D H0 B0D H0 R00C0 R000  R 0``0 00 S  R000 R 0` 0 `0P0D, 0Q0:"0Sd0` 0 0S0P `0;; 0-L MT0h @ 0Pt0tS _\f 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R0000P04 0S0T0  0 R000  R 000<00CP 0 R000  R0004K:t0 S:`;| -<@LAPifP`@P@  pWT  00V000`F400 R0"40%T  -LM0$(S00pP 0@`p`@h0) |x 0Q0||Z0@ 0j@<D00AqD0 0A0 q@@ 0@0 S80p0S800tg -D ,0LR@p:4PP  5`VU  0D, 0Q0:U" p0S000 Q0-LP, <@@D ,0R0:0 Q0-PL <@@40 p-LMPH`Q`3:Qq 0L`` <@@4p p-LM@0T`0  V@TPU 800\ K@D0<,0lS:PTP P R000 h0t PUp /Q@ Q/f -LP`pQ@ hP 0-@LTP  @T0; -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXH; ;( ;\ ; ; ; ;!;!;,!;;@!;d!;!;!;!;!; -L* 0S ph<$; -p-LM PL 0@``L,0 \0 p`l^h -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00ShQT0(PW  0U00^hН=p^hX= --L0LM0  4!0 \ ꘄi --LM 0 --00LM Q0r(= -p-LM@XXPN 0`@^00@ R `Np<=H=^h p-LM@\PX`N  0PP=00@ R PNp<=H=^h --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 2 H0 0%SSRs HT \  pH d ` H L H L  0BZSU%%%%%%%%%%% %%%0%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%4%%%%%%%%%@%%%%%%%%%%%%$%%%%0%$%%%D%%t%@%@%|%%8%%%%%%%%T0  0` 00x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ:X ,0S , \@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm``  [cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  .,D@K(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @ T@D 0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OTT@ 0 P`'0 0 P`!`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tppx0 @0Tpp000 hHT0 0T0 b@HL 10L 0 B0@C RH \@ YTT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R x3P0 h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 P00cP0 0 `PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`l T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D Kh$;$$;;,$;4$;P$;\=d$;l$;H0T @H lR H  TT0 0%T  0X0/ T 0X 0 T@ 0X 0 0 X0 00Px0L0  PuoL 0  T0P` l 0x T0 L 8H  V t0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T"x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` t0Y00S00P0 P 03R W P  \P PaPh hp ` Ph l  S -L0; -@LMX; -LM @pT0Tk0 P F @ 0` 0  00%XF0p@- `0Q c: 1P#(80S$H*   0!!0 0)0 !!0 p`g -LM00P20#0R0Sp ` 0Qc : <"K#80S $H:@@R0S 2[02KP E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0x=d=`=h=h= p-LMh`@qP T0T Q 0QUqU@@0pg0@Pl=p=$;$;,0, 0$ Q 0÷t=|=x=^h -LM0(h h`\@\ 0 0S<:80 B000@<^hx=|=^h000 Q 00x=|=^ht= 0 S-L< 800( S $S WhS<\=$;$; -t0@LMA \B0S%%%%%,h5$3h/x='<<$;%;; -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHiW0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81P t 㻍@0@0U@(0@07<@01e 0p@ < @0l <@0!g<@04!0㒽Pt@ m(0#p@@ 80Pt r@00@0 0oPp@0} p~@0@0@0@0<@0߾"<@0, 0PP@  ch+;+;0Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||5Н=x/h -LM`lPFY0 p0@"W0  0@D  D \@0訠 $☀ ";p05 + R @J 0SU 0S = )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU Wg x ݧU WX 0xU U U|Uu 05 0=  (0r05i UZ   ^;8p09` (0S.@J 20U0S 6 ?   y0PD 0@$  $ dhdh]9Tech - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HS?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&@&@&A&A&'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d H P!0?0S@&@&@&@&@&@&@&QA0 0(!)^  so 0@d 0 d  0=`H V PPT JO  L-0c Z0 =r-PH @ 0`0Od  d :--ch]9 < -P$LlMUp` r:U9k9U95g:4| 0S 0 x0\ 11F0S A)9@ P@ `9U8 T9U l09Uc 89U 09U  -p0;p0,-p0;8U 8U,p   5,0p   4 0S 0S||^ ^^ 00CS0 4 0004! 0|04!x 41 0 !0 0 0  !|OP@ 7U; 7U 7Uh00,d7U! X7U41| R pPxPy006Uh  #kp,<dH0h,pzm0&0p" o6U9 et6UK / 6U \6U<I,0Sp0p000p0V0 Q U 0 Q 41| R00 h 52D5U' 5U 5P lU*h0U ,heh02 P@hP h0  +Q4U 4U 4U#41| Q]00Z P 0SxO|4U :p40S+\40Sn0S_p 0   P (0$0( R|P P?3U ,<R R 20 0 0;; 0 0 2  ,`(p@x PKK020 Ѥ 0<p0 P@WP@P|2U@  㹶P7  x J.3+t08t0 @8t0  t07t00@t08t00 t07t0P/ q0S S p0(0(S# @0H0 1P pKl p0 LP D` !>P@\ `o_0`0 a@ `Hc`DT  0X , ㌺U0U 0U 000St{t rtzt ^t L\h=t,@ot t t at nt x/hst@f@t@[t@wt@ht@Tebt~f}f=t=Ztetvtgtt,Н=<; 4-0L0Œ@P*Ap`@ .H0S`VW T_*  P`0 p0Te p- 40t 0LM"@`1Ps sP<0 p80<`S*00@(*0Te== 0-=0p 0"L@<P:*0S00  Q0 0 0S000h*Te p-LM= x0 2`<P*@J )0 p0191p 0SpTe 0-=0p 0"L@<P)0S00  Q0 0 0S000h)Te -LM= 40 @2< H >PTe -LM0@  (0 P0SM0 p-LM@)P`H0Spp% 0  0S H0Spp 0  0S p, ,0HPP S)p= 0-L@PP 0 p-LM@P`)` (Q,Q&p0 >;-p0.(ph!)p0m h< p0ŒHQHP~HP(Te Ѹ`= 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@L(p0P0p00h( -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"%p(Km =?P@ ( P@0p 5*0p D%-=`b0V``V=J `VZ0@   p0  X:p0\]9+; Q0-L@PA  UPE0 -LMPP2 "%(`$pKP@ $! P@`P@ $ P@p0:p0$0>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^zU?@0htU0 -LM@p0 t hl~x0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`}P,"0$"111;/"b111A8|0St xQo @TPi zPPD@T50S8 S1 1R0 0l $K0, K+ HAN=0S 0 $00!0 $0 q?B6c$ (N=0S(0 ,0 0 ,0 ( (0?B6c, p05c1 @R  1P2;P$0 <0/0"bT uDaiQ ,;0,;L,;l,;t,;,;,;?BHh,;,;,;,;P0@-0 5@5P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S0  000 8 80R000 R8 80R0Ph h0RS p-LMP@|#p0`(0(S U  E#p@#p 0-L@  0^P>U00  dhch p-LME#`P0> S@0B0" #Bv ( H P00 D @000 0@儵plj@x+hdhchS& - `0L0C0 R 000  0 (H0 @P"@dDFA 02b Sp>L 0 S0``00`h"#chdhhh)h -0  Lx0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Qchdhdh -LMQP`/00CS lm&m&m&m&m&000 Pi逥-p0l0h0PpT0T@ 0 / p嵉dhchchdhchdh-R Rt0t0\ \t0t088Q ' -P@pL >x0E/>1 `W>p 0 0P0  ҈_ -LM0@S0S000A?H>PB>J p-LM@!0`SC  ^P` 00c!R!l0PU00\ !p -LP`!Vp&0S 0\@l0% @l T@ j00S 00`d d0Vp 0SS 0 0!h0 -L@P!`\p U, 0 ` \L 0 1S>0`QW!\L0 Q` \L0 0H`F V0`b 0-@LPZ! U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h ! p-LMP@,! `R2 R0S$ 0 0 0P 0  B\   00  110 0 0Q00  0 p, P0  p,;Rp@-@) 0/. PaCPN  10C00& 0b 0 R 000 Rp0a # B 0!0 0p1 ! p -QLM`PpF  R- R0S1 0 0V$ R! 0 @cR@cT@ ?`dPp  00S 00 0V  RT  0 A(d (P0,;-0S0| x 00QSCT0P0Q R 00c!0R#<02f@- T0R   \ 0L0c!R!@ 2f 0-@L  PR 0S0 0 0 0 Bn \P 1S>\0S0 00 -L Mp0S# 0S 0R p @@`KP@K  -`00p41P LP@U @ /T 0yV @ X -LM`00p41P HP@U T 0V @W -LM`00p41P HP@U S 0V @W 0-LM0@41P P" 0\ 0\  0PV041 Q 0  !0 0 !000at qt @-00@41 00S   @qV@b 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ Zll VLXP0hT dh==d=egh gh2f dhl&gh2f~&,0 P 0SPdh -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Amd -h0LPpU` @ T*0S4@  T:PUdh p-t0LMP`U @ T*(04@S T:PU(0ph郰 dh= p-|0LMP`U @ T*$04@S T:PU00(0aph^ dh=gfff p-t` M@Lh 0\P@dL 0@\,0 0ph@fhP-;ghX-;(=,= -,0LM$@ <0*h=$=gh@fh p-LMl0`PU @ T*,04@S T:PUm 000p dh$dh p-LM@`T"@@PLH0@P  1 0a1Bp@fh$dh p-LM@`]T"@@Pt l0@P4 10#3 a    $ ( , 12 p@fh$dh -LMP@  ݧ p-LM`@!T"@@PH440S !0 ;@0<H`8L`!pgh 0-@L P 10C1( HPL0L0L H 0 1@ x@0 80S 4@< 4D4lI$dh@fhgh P-L P Q-PL`%*@0fT 1*4p)  !!0 0!p0P0 `0 ;`-; -LM -LM -LM`pPJQ1V Ut 0V:`cVP0W,0 ,K9U  P@x Z` 0!0fS0! 0S 0S,04004:H0!H01H@ H0LP1L@1W   0`pbVP`W,PP!000 !0 00`<  H0S 0W01 0  fR ! 嫫40@ 00` 1:)01T04 W p,4 0000W yw|-;ʚ;gh-;-; Q-LP`p%R!Q U 0\: c\PVU @@lV@1  `dKVpPDA-;-;.; .; -PLM`pP, @Q R`d/ @PVW 00fW@1@!pd W@` R WPʲ1 0 SP W010# 0P0 S0# 0 p-LM0@SP @0SU !  H0SQ `"  H0S V    Ū 00 0 PPpPp40@ 0 0bV 00c<P@-@ Q 0Sa0 0c 0\Qʲ1 0 a0b0a0 SR:1 a 00a1a^࠳\ 0S %*c\\ 0 0\ -1LPF0,0SA* R> 0S 5`1P1l0:L 00c|0 S01W01R@1@! 4 00 0 d dR0 0pd0 UX XPf 000]PXP` 1p  p :)014@p1 01@ dhgh Q-LpPa1; 0+0S6* R3 0S 5`1P1pl0: 0S@1@! ˩ 00 0 pd dR0 00 UW WP= 000P WmP` 1 1@  @ :)0 01@1 01h$ghQ 0S cP QQ 0 -LQRQp`Po@Pk 0\@ cTd 0\T_ 0 SSQ 1E  H0S04 0b: W+PP 1 p000 0X0j 0  0 S  0S0S  0S00PX 0!0 000000g0S000a0a40C0C  0P -LM@PpP 0Q@PcTx 0UTs 1 e8Z` P`  0j0    Ḩ 0 P044H0!H01H` H01L@L`000 P` 1:)010000h004  ,0 Z0j0Ó00<0 P@,00 -LRM(K@0`0*0ppA`;PPM 0W@ 0p(,0S7 0fS1!P@% P@! *,0S0 R0 00 0S  ` Vpd`WP, ;1 @  TK# @PP 0 0,gh -PLM@ 1 4@ 04  @T -RL@`P0p%Q" T S:0bS@UT  cU 1PbP0U@ 8.;L.;h.;|.; -PL M`,0  RQP \P`lUVU \PU \ U  0   H0S 000 , 0R0V0S  0  0" fZ00S\ pfZ@ gT  0@ T0 S, 0R0V0S 0 00c<  H0S{ Yi, 0R0V0S 1W  H0S04 0bL W5PZ@%T   p  00g 0 0 0 0 0 f0`0@P,0S`*1G @00S 0 S:0g 0  00`0g 0PS000n0n40C0C00S0 00 ^ 0 0 0  40@ 0 0b S|J 0P@ 0 S  0S0 `0`1.; - RLM`Pp:Q1X @TV T 0  `1@^P@ 1:)01p`40 0 0-@0TLPoQ}PP@ 0000 S00  Q0 0 0S00o} -LM@P 0o0}PRP 0SP 0-PL @T0 00 -@LpP`U P@ V0000P`U00 -@ ML 0@.;gh -SL Mph1@S `P` 0S+0SD, zP90 0 @0  Q00 0 0  @ @@@8 `P@ 000W,,P)ꘄigh p-LMP@  0`@{p -LM`P0 p 0P@ 0S000U H 0UP80 UPSR L== -LM@Q0 0S h Pgh -LMPM0p` @T  Q@T @T F @T R 0 0 0 B?BS  6@ F؞P`0 R 0000  0V`{P` =^9.; -LM0  0  -LM@`0pP  0   0 5PP 0Pi.; -LMP0- p 0` 0 8@| #P @ 0@ p-LMP@  0`@Vp p-LM@t0`9P  0%P P:p -L$M0 00 , 04 0P0D0 R< 00`p`W00S~ 0@  0000@0 Y 0S 40040Q < 0;0 0; # P00:00P J03SB 0 7  < 00R0S9'00 B0cR D0 SH  0@WV<^<0O/RQY00S DQ0 <0XX<,K8 aY ,@TP̠P@@W00 X00SDZ 00X@@^d ,  T00R00S 0d0   ِ @8ZP, `p000;W8P ZD0X00S@ R0000pWPAH 00R  , 4006@ P0000,0KZ , < 80 00X00S/0; 0;;* ,P Rl i0;sV00:0V, 1011i D0S ,0S <1+`R@@do V@KNVLJm젠PA p` 0;0;; 0 00:0Z 0;0#(40S'0#  }  gh -L`,M, H Q @ , 0P L0 0 PP0S0040 4 0 44 4R0  0St707 4jLPZ~8 d@T 4L R*`0R:4 @ T0Q 0S@03S  T 0S 80080@04p 4pL  , R 0 ,0@T~ 1SZW  R 0 0@0SL Te 1SZ T_ WXl@Q4 H  4 1 4̌4  4 4 T< D  Z00R00S 1S6 H0S 0H @00PRp <0lUP! 0D0P 0`UP!QR  0e0 D0`U 4 pD00D0 0\  0?0 0 e00 L0P 0e eL0P H0S W0eSH00@00> 40#s:0T00SL( 0S% 00#0X00S 3S0 PPd@T70778_07|ǜTi  Z00R00SuT^ @04 p< 4p4 5 L 0P0P00S 40  70778)0|7ᒜP 0RS04 0070778 0|7yLWT @0 0S 40Xdlh 0Sl4p<  R< V14  4 40p@D @L  aL 1SS P00bP0X0,CX 1@00cX00P @0@ @d@0pT Xl@Xdhld@8D0 P P8 \ H R KWXdhl L00bL0!RR P00bP0X0,CX 1@00cX0\ @0 Q 0 R  @0d0 d@c@ 0Q 0 R zd@P L00bL0!RR P00bP0X0,CX 1@00cX0,\ @0d0Ld@T@d4C  T T 1S, 1)@T 0 90 SR  407077L#8Z 0|7f#@# 0@@4 0   @Pp Q! BpZ00W00S@ PT  p-LMQ@P ` Q p T  0pQ -L4MLP3 p@033@033`3033#TK@040ݚ2[03,0(0n0 00S<003ʚ -LMX`p,0 P \ 0 S*U` ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@Sh&&&̻&P 7jPT|PL0T@0T0T`@`00RU 0S@000 0004  ` Q!k401#8S#00Sd0W  H0WS 0S 0S S d== -LM^P@p \ 0S*p 0 0 T` 0 &T T T |0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 T 0T 0T 0T0xP 0^@AT0 3 003` == -LM@@ D0<Іp@hl 0-!40r@L$ r 00LP<0<080 (  3(@03  0P괴=Ĵ=Դ= 0-40@$PL t0S0t0  Q0 0 0S00t0S7070h 40$ L 0  191# 3S,000`0Q 0-40@$PL 0S00  Q0 0 0S000S;0;0hk -40$ 0@N cQ  Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6ₘLZ0S 0hQLI0S 60h) -LM0@00 68 T,L)0S  -LM0@00 6. 7L 0S  -L ML0H 2cC0Q0^, 00 m3#0 SfʤAPD A0 @0 0 @0 @D@刀   -LM @40 0Q 000!RR 000 0, 1@00 0 0S 0Q0 ! !101 Q-Q 1S/ S' 000!RR 000 0, 1@00 000 0R 0Q ! !101 0Q -LRP`p  10Z @W 0R@0@ N0aR P\:P= 0 0 gTp`Wp @ 0  1SS 000 0, 1@00 0@0S 000!RR 000 0, 1@00 0 0S@ -.; p-RLM@P 0RP^ 0Q0`D F0aR \p0S 0  1SS 000 0, 1@00 00S 000!RR 000 0, 1@00 0 0S@@ @pϼ.; Q-L@`Pp 1 0\pW 0S0 0@TW U 101h0S] !1R U5 1 \  00c<H  H0S< \!1R U@ @ 0P00!RR 000 0, 1@00 01010@0@0  ` 00 0 0  1SS0 0040@ 00a\U0/; -LM 0@S 0S p-LMP\` `U@\ W 0SE Pc c 1SS 00b0 0,C 1@00c 0WU\* 0S  c 1SS 00b0 0,C 1@00c 0;P 0S \` \ 0S p p` 0e  000e0!RR00e0V`ƻ/; -LM0@S 00 0  c 1SS 00b0 0,C 1@00c 0P0S  00 -L @M Tp`SPP0 T1@ @  x0 0 000겼0$/; -LMp`(PMq(K, K ZP@0K (0 ( 00(0 @T0 (0$ ((00(0( ,00C,0((0,,00Gq˓,W(= 0-LM@ K(PUK0 0PP  ,00C,0(0, 0$P 0-LMP KP@ 00$ @,00C,0(0, ~ -LM0`Sp  ,KJP@0K P@ 08 00< $P @S   3S 3S0@3G  PD 00 ( @ p 4 KNYP@V40tu0 ta@ 00 0 00! 00$NPP@ Q% ,  0R,0  gP@ 4=W0Z(yp<8,0( 0C,0 ,,K I@T0 (00(00,00C,00(0 ,ߒPD 3 0R3( D (00(0,006 , 匒 #@5@3Sn3Sl 0T 6F 0P@3S_3S [5 50#W D=^9L/; -LM0P K$0 P@E $`0A?AST $K0P@'$P@!0A?AS4 50p 3S6P!F0P@ 0 3S T0C3000 ,00C,0 (0$Pt>,J 0,  B, (0$0$,;,00C,0 (0%,/^9 -LM `P ,KpP@  0KP@t( 8Kgo4K %XP@d804 D0 0040 4 弑<K, 40$  XP@G<0 < 00<0DK<00 $ 80,0@0 P@+0SF  5P@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 8o,⻑,⸑U<Y000 DU4Y0,0 0P o,P~0,P@ D= -L(M 0@` @Kp8 0 8 K4@ , ( @P <` p9 -LdM0DK`p  FP@8 P#PPKP !<6P@0 PP 80S pP #P U U80L0c08 0@LP / ~P PK0PP -L,M`0pS8K 80 2DK `< 4 < K0 D@ @P , $` L0n0P0 -LdM0DKPp ]P@"8 P/P`K#0P,0  !<KP@  00c0Q P0SX0   X RX JPP)X0X0 XK ?PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP,⮏ @ V05@1 0305 0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$Q @,00C,0(0, p p-LMP KP@`*0 S@ 0S 0`S$V  *P@ 0 00 $0}`@V00,  B, (0p,37@1 0-LM0P K 0 P@) 0S 20$ 0KP@ Q  R 0S R YP@ 0,  B, (0 P0,K @@K 㼇P@ p-LM K`P[@T(K  p 0(0 $ !P@ (l(S$S(2l -L M`$ KPPp (K PP$0$@p  P0PP (  0R(0  PP $0,  B, $(0W k,w ˇP -L M`$ KP@p2$!$P0 R5 (K 2P@p  @0P@ (  0R(0  嗇P@ $0,  B, $(0",- ぇ@,00C,0$(09, -LM` K~P@  0$P 0S4Pp7@  @0P@  0S-@@TP @P@ 0,  B, (0,֍ *@ 0,  B, (0-,Í -SLMpP`$  RV@;1  ` PPW@0`JF7R -LM@=OP  0& S,0 0,0 -LMpX5 Q@`P) QX 0S%0Q0U00S3Q4&&&& & &p&|&& & &&&&&&&&&&&&&U8 X4Z 1 !N }0S  0S 0S  冑  0zi0S Sk P `, X0 a00,L(0 0` (X P0S= S9W2 0S8 XY  P `QL@ 0P7W 0S   P90p  P X`& L0 ,0 P X,0 0c c 0,,( L0 b0b0 (Y0S L0 ,0 5" H 0S 00 R1  0 (0    P`L00H0--0S 0  0 0S 0S0c8"00   ꘄi=T/;\/;d/;hhl/; 0-0LSP T0S0Sx0x Sl0l P 8 fgP@ 80@Pw070T=== =x/; 0-0LSP% 0SP 00t0 R g0hw0hg6Q0S@|@@hh -LgM`pV0,0 ` 0BSPB[FOK 2`0qK1 A 堡 嘁 iP`AT8_OKc 0|1  ˠˠmK.K0x 6P` 0 ,0S ,A0 |0 0@ 0P 0P 0@P$@f8K$8P 0h/;ʚ; -LTM @T`PD0 H0 l p LP D` P\ pKP@`P80S&@ 0 06P@|pW? 0R)@ 0 ) 03 P- t P0  p0 0 0 0$  t t0$ 00 $@4 0x x=@0TS (ʚ; -LM@ 0)R  0S S00 /; 0- @LT P P0S S 00S00 @S 0S00  0000? P0h;/;0 R P0S 0-@LP0S000R0haf -LM0 4 0 0C#q!18  `e40 0<0 (gZLZ<@ P,K  㝎!NOP@)0 P,0U1W<@ P0PU,0   B A8 <~8 0 4000 (g f PUJ6NPUZZ( (rgOPU<@P0,0 ,nPUꘄihh -L MP@0S 2R 0 S 0L# q 00cl0l m  H0 Sa ^ H1 P 70` 0 Z0 @& ,K,LK0PK\q 0 @D1 0s 0s 0  0 Z0 00`F000   @Zڀp0PK ԍ0 J 0Z0C 00`00C0  B  @40@ 00l^^hh -LM ROqa@0T0  0:0@T@T  ` * 00C0 0*S E @TPUh1 &d@`TP R Q@@@TPp  0S @TZ@WPP@TZ&e00$0S 0R0 @, 0 0 0, $Q \0 R0 d < Q  0QhhLhhhHh='P ' P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VPP   0 S0*00 * hhP-,, 0 0C0, 00C0`Phh -0 0CSL0S R B02P0P  岯尯/;/; 0-LM0PS@ P0U* 0S PU:U- 80 >0C&B 00 08 . BA R0000 0 080K0 8 D.0 B6C0080!>0C&B!hhhihjhjhih/; -LM$`KN&|P0 000 K? 0D }d0x0\`\p\P\@DF 10\ 1 !CeH=jhhhihih jh -LMp`w@PIU|0+ 0P @K/X0 0 @00D x@8H`4@<lhtpND @0SP0 Pp0ihH=!Ce= p->0L>0MK0 1`!0@Q6垨0 @0PP$ ^ :\000008 HP0 @R0 0 X 0S@@0 @pጩpphhXeihhhhhjh= -LM @R0h00 H R Q 0 0 80 >0C&B$0 H8 ^h]hhhhih -@ML,|0$ @;00Q* Q:0`00 K !@6$ K@@@0p_%Qe @0Pp@ay0P/"?CAx0p l0Q 0X 0 H0R @ /;ihhh=Xegfffhhjhjhihihhhihhh jh 0-LMP00@  U0&00060040 ,00,0ꘄi -LM@h -LM p P@`U @P PU@ o1 p-LML@`PP 00 00 ;00P1S?b0H0ph -L,M@@8 >0>0X    00K84@K@63PP400 @r4@ T\  < haPp < `U0 @_@P 8>0S 8P <` V<@< 0 A PP <0`TD@@ O8",1D` !H` !006000"P000!R !|2|BP000! !T2LŸP000!,BP0( 00! 0KH /XH08 0CƂ80Q!>0C& Q!0 S0 00000@00 10000S00 005000C 0̃ 8 4.0 B608 K 00080> 0CƂ80!P>0C&0 Q!000 0S0 000 0@00 00  0T @0K?@08 . Bhhjh jhihhhjhihH=jh0@-0 Lt0P@h0  P P0P S P00Sd0S00 jhih - \L MPP`P , 0 p""#10AT P0P S= @TWT 00:00 R 0 0p p ,0K ~Pp,0sSW 0@0S0 0 00X0P @`` 4 40Sd0S4 00 00  0000004W 00:00 R 0 0p p00L 50000l04,0 ,0Sx jhihjh/; -LM@ 0P 00(:00 R 0 0 jh -LM0 4 8 <0 y\2\"0@ QH2H"0Q8层00,K,0 C@,(PPQ Q@TU UI`pA0!R&̡凁 PU! @Fx0@DS` 10SZ0000000d0SON`1!0R PU tpWVU$4@80@!@ @؀<0S P @ 00d 0R00@000^@0PX 0D 0@ 0 0<@p`4@lht20jhhhjhih jhhhjhihhhjh0; - 2LM 2 qaP0K@K R 0R!0S !0u @T 0R0S 00000z00 Lx0S 00D!\ <PT8K⚂ 408b00Pc=9 = A@ @ 0@0SzP@T00300p80> 0C& 80 >0C&0 0  0P@00000  +ꘄiihjhhhihhhjh jh ;hhih 0-@L=00P  00 00  40S000;0000 00  0; -LM00@ +00x <R00 00S00 00@ 00 h00500h@00@000`00d4001唨hh0; -h4L MpT4PQ`  0SP A2q 4 $00 AT 0S @T#000 P0R(0)Q PT    YA0S X#000\ 0<0 00 @#000\0 20 0 R000 R 0S  0 "000$, P0QT" 00 0Yy *0 b  -0 60 P@0"0 R? Z8P0, R )! 00 00Z0Y0S0!0 R  )P060L!000\  0 0   0@  000 i)P060   U P0 0 R 0 2-06 @0   090阄i=jh$jhjh,kh(jh kh -LP\` 0P 0 Q 0S Q $00$000$0S@T T  P0R\ \ 00 0 p( pb W)1p@0"0=(khkhjh -@2LP`P^ 0S[r"0Su@TQ  R0000 0 0S R00 00 0S  R 0 0 0 0 `VP0$0P0)0 ( ( 00  0P@ @2p1!00 R 0@0VV@0 0 80S ( RR*0.S 0P 00S0 0 0@ R )0.S@fH@&000= kh=,khjh$jh(khkh(jh p-L MP@ @t0q``? `P0qDPP<< 8H0@=p,kh=$jhjh(khkh(0;=(jh-000P0 R`` 0Q :0S $  0S0AQ*000P0$khjh$jh -pLPQ `0@S TT0ST000 ``0 0 0S R00 ` 0S  R 0 0 ` 00C0,kh(jh kh -LTM0 P0K 0 d < ` X  0`0 0 @X X ` RD 0 X0<d0  X`P0@W0@X<d  <T04!D @R0, \0   0OS a &80 nU@ V 0\0 0 @<0P0<`PP 0O`"8@#!P7 d,K< 0:+P0X0s ,0S 0@00\@0Xd` \0@d0s0t0 0d `@ \0`X@4 Q4@VX0@WXD@ Q 0 < 0 `!<PB0+P @T : +\ Y\000< NT:@T +YXd `@ TX0X<d B`0p K<0pKX$0OPK0^Xd -0S*P KPKD 0OW{Xy T0<0P@@@00@ ] M-LM0000K0 p` \  0. 0@U( W00@0P`pG@0P`pGY  W 0 00, VW @0P`pG -L M@0, 0a + mX 0@0 Rp`0  @<0A ,@f@0Pp` W 0-@0< L P  &< <0<0 | 0P | 0S P<0 <<0 088 T00Q0S <<0 0"{ꘄi00; - L0; S '4>'$0 $I$ 0S B $0  0R 0P@ $0 $0@'@0$ $0 0 @ @0$  -Lp(P@A 0@1A 0 Ps `@0PU`P``0@008 0 0 s@0 p-L M0PK0%@ `K 0`P 0S 0 Sp p -L M , P0 ^  0R 00P,0  0R r0 S R :t Xʄ0S00 t0 0 0S0Su00Sb X00S rV tQ 0SR:X00S :t> r07 SRX 00S*0S$R"*r X00St0 0 0SRr sus0suu0sXR0S0 uq000 0scg0; -LM 0R ) 0 `R 0 4 P|p`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00w \0 -L,M,0$ 0  0 `P 0S 0+sP@ R@@T Z000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @@^T0S @P@v i <204"S_ 0S0 0X0SpOP0K P@KH0 @00HK00 4 ,P Pp L D 8 q$P@680[c  R?@# *\0×000I@0/S_ @ {ݙpR ֙J+00˙ 㥘p>@ w$ ;0 p峙d寙P嫙pGWa:0/S W0+r4 y'@!T@0\ 0   0V0P@@T@ 0004P %s0401J0 R 0S  R0\7@ \ $ \` pgP@d0 Rd0 0Dzdh -LM@0  01}J p-LMP!`@4T  kJ00`VPZpj' p-LM0`@P  0p20P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  0-LP@P P 0S  SP @  0S 0@ 0S 0 @  -LM`@pT P R0 U@W L|X @x0 CP  pklh1;2;i$2; -Ld@^<0< R  0S hQH2;^hh\2;h2; -1LM 1R  jp 0`PU 0 00S00`PUV Y'Z@t#@00000W`pGYꘄih'= p2;t2;0@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@Xd$6h= -LMA\-P   -LM@pPp `pPH00H0 0kPp0S P- L p00Csp0 H Sp HhlP2; -LMPp@`e`hP 8 V T0SQR1 @R VP T0S00y000000  X00:00JU@ A100500D!0kP@ 1lQ  V T0S RVQP  R T0S R T0S/0p Rl0S 0 P@p0Sl0S  v2;2;2; -L`pl@PT 00  @RW 0| l0S h00 00000d0WS 偓2;2; 0-d0LSP@d@800CS|00 D0D h0h S0h0hP 0a2; -Ld\8  R R000 H  l0St0QH0x0x0x00d0L H0 BL  R@0SXPP\0\ D0\0 X\ 0X0 X\ 0 !Cemhlh 3; p-LMd`@VP0 P00S  R000   pp00p0!Ce 0- @RLd R000 00H hP l0St0QH0x0x0x00S0 00@P0H0lP80SP 0? S 40|0 R 0 C!Ce=VUUU p- LM@`T PkP$  $@TL0@Q$@`0(0Spp鼵== -pL@`T PkP $`$@TT  R$00@T 0$@R T0 鼵==8@P -LMP0@`XD,p400 `xd` p\ HLPx``p88PP `p h 3;3;3;T4; -LMP8P1p ^0T|@10` @Lp@@ D0@Wh@T  @T\l@T < @T괶=,5;=45;d5;5;5;5; -L M`$Q @p0!P 0PP<@@0@DH t`L`X\ Lp 080@PT ^P !`\#100E SP`@TX@T `\#10l0E SppP`@T<5;@6;l6;6;6;6;$7;H7;p7;7;7;7;;7;7;7; 0-0P0@ 0L^\0 000=2f2f 0-0 L0@L Q@ @P@kH0pt t Rx0x0x0 H00H0 1t0S0!x Q01x00h(==2f2f -<1LM 0100 p(!<1 P0 S000@`T  0S 0S@0S0C0ʄ0 S(| 0xg0 00PS( ꘄimh==D==2f7;L\h= -LM h0@P t T0R D0D  80S@% W@W@TU PKT@ K0@x}\P0}tKV U@KPP80S@@KPP,,0- R000S000 -LMp|`@VI 0 00CS0> 0 00CS 03 0S 0S X\Y0 p@P@dDFA 02 St1b1 R0``00` i0|0+ldhh)h -LMp|`V$ 0 @Pl@dDFA 02b SP0 S0``00`,0|0+hh)h -LM@5x 1xx:;;|0 (x:;0S S  (00S 0 < - -Lv:;@-| q  qL@H0 800@< (  3 03( 0==8 0SP 4U|0STv41sTeeehd:; p-LM0|8@ d0dbT aR  T p psTee:; - L80S 0E|0 0 2Te -0L| 0 0 02(,Te -PL80pS l@`T 00  R@ 0S D 000 00000ns:;:; 0-@Lx0EPS 800S(0!e10hhe0- Q000S00 R000 -LM@P8|0Q p/ QXP P<0  '44!002(*0 h0S 41 Tq04!0 0<0 " 0 <0` V aP<0  '$ @0!b1*   rTee;; -0L| "88 #$ t(;;00CS''''''''' 400 0 < 0 -L M@|  0 P@  -Lr@;; -LM`p|P Q2020 P?U@UQ |D1 "  80 $$s|  40 KzP@  | 0 @|  0@* @ T |0 00 ;&0  | P`<0;<0 | !88#js阄iT;;Te;; 0-PL|0  Œ*P@0| 0| "8|8 #$ 0|40  !Ƞ80 Ƞ!$, 1s0Te;;iG-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ8=nhųE.nhnhnm^9_9nhk_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$LrQnhnh_9^9=<;@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00 `9 a9E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM _90@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S a9p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 90=nhnh -0LM0吐pP`,0 ࢂx 0  AT 0U @$0V0W00S , @P阄inhnh@- @ $ 0 201 R 0\ R R $0^0T00S nhnh0S R00  -LMpx<0 3Qp`@` PUh,0K\ @Tv0 SP0@=0 C@F0<"@ ,0P, @ @8@00 `$ ,P@ ,=T 4p 0V 00r x0sl 4K 00K P@ \4 J40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 8Z0@0@ 00S0C00 40Sp`Xd0` PP嚺`0X P c@/BX` 0 P[P0  X0s0s), 0P@0, , t0Sg P@ <,0K@-P@Y fAe@ohnh<;<; -LlM0 p d ,0 0L X0   T 儠x 4T0dp h00 | ` 0 \  0 @DP@P 48 ,0S $,:H T kP@<0 0.S  8K07P.(.(6(6(p| 0x0 SS| P Pt P 0r S .St00CSt0 0P0 h0 HK h@ KD0KP@p@0KL@KH0@ĶP@H `PLH0@\\Q|0UPd \0  `V ¸h00꾸U|Pd \d 0exd QQ   00S0x #70R00SfT0  I 0 P@X|0L,0d(0\;Q0 K X 060| 0 UPS 00 h\P PH L 8K <Px (RP, |0L,0p x 0qTl D0lS`P UDP `bL9px x0Us@PR `x0\0P00S1  . v* 0 %P@lt 0\0R00SpD P0KP@P0T \ 0P;0  X t  1lt 0Q0R00S T 0 T   ኼpD P0KaP@\0S  X  D060P0T X  80 60pDP0K@P@\0S   X  >P0@6 P0 X 1P0600 ` v 0 P@Nlt 0\0R00S gT?pD P0KP@7\ P0R T0 j X 060 p$@XUPp0 0tH  LLLIHP E| *?| " R R0.Sbl DP h<; -L,M(`x@ \p4:d 0a0X03 04 P@X0x 4(#x X40K<8K0 KP@(40D S\0D 00K80  (:P7x0 qD0 4Ht0T$p T q! (0$r (0K$p Pp( $\ W (0SvDob V@0T$p@0R=;$=; -L MQ@p`d%X` 0D 30nR\050@ 70 0 `PP X 0\ H 00`X H a0N 0-LM$P 4@0  @0 -LM00(P0C4`p00 P,K0KX PE5 0P@600K4@K00@ŲP@-4\0H0 R (0U  P 0 PE A\0 0S 4P@ 0\ 00U00S鮴4嫴 -L$M40@0 < D <0 D0PJ 4K 0 K0APp<@00K408@K@hPp+84H@ `0T*PU  0 @ H0 `0T: fWD00D0  8P 848pT8PPD\ -LM4p`0K4K 0PP-00K408@K@P84H 0R *@T T 0S H0 0R:` 8 -LM⤐Kp  | P<1P@$  ԁ0S   @T:$0@-@T4PQ @0(0$ , P@z`80S|0" 0Q{0 0S $0 LMF0 0P@  $0Q 0V@ Tԁ40 08  0,0005x0s/ KP@  S0@'P000@KY 0f3Za70Y \3Za7 M| <00 05@ws K@\ 0 0S10S`` 0 0%P@  q e -L,M|0`p 4PP @P87 V, 0@ 0@@kP `U $0000  0PP(KP!4 4 ;寰PP, 00;000,0iH@i7  0P410 $8 !8 0 UP42 0 $" 04800 $" 042 4$ 2?S\P 048<,0 0$(,0 2S<0 \80S0 4S2 x0  048<80 0400020U 0E8  R:0B0Q 8\ 4@ ,0@0!@ x PrH 0,8<@D < 2B!?04 H @D0H00cO9D80 4Qt0LP 3R3 H0 x0l3H tR880l0290P R*l0 4p0;4 C@`\ d0;d @0RX OP|0@@,P0 R0 Z P ;<A<7Ʊ,ñ0,0 |Q-P00B 8PP< P ` PP$00100P0010h0 0ԡL P |04 "!;42 lPP,0\H@ 6P 0|0,v0,0 y$ 6P 6P 6P{/0  4 8<0@Cf^P@V0  x0H0 ?"!0 #L,4$ 8<@0H&%0@ 4| 0 04,08hL=;T=; b9\=;00 -@L pP`0 A|`PQ`7<l;i$0 :$0! -LM0K"@tP0   p-LM@d0P0d ` L0 0T T T0Z 0,0T` 9Z 9MB| 9 D 4p p-LM80@SP0 0<l0S 0S 1`V p 050S0  -LMQ`0(  $0 ,` h0@Sph, K 0STL  0 P$  $2\VpVLKN KO0KJK00FKH KP0[ 0P0Kh=;;,>;e;P>; -#LM0 ,0 `t0 S4p( x0R#*@K 0@OPK@K-00 p h.0 00 0 000 `X0Hl0Cd0 d@H^-H@ 1 [H 0#40L [ 4[#40N [ 4[#40O [ J[4[#40F [ 4[#40H [ 4[#40x trh !4;0:L [0 4[#410N [. 4[#4/0O [- J[24[#430F [8 4[#490H [6 4[#470x r>  P.\ K P'@ PK K 0@ PKD @ P nP0  娺0  0 ,0S ,7>O 6O卺;[0 [ 740w 5 @0QLKN KO0KH0N0 JKA0E0FKH K:P0[ 0P0K5h=>;K @h |A  KKK,h ! P 0@ 0 7 ,0S t,6h1 `LA0X S 20A Tp1 T T 'T80BPPڠ `Rl! 00 ᪠Ll0 p10dA1t 2R\1 2 x0s, h`V# `>K/>KX X 0`P@ld\d0x a0`V`!\T KOK\ `1QKd =K'PP >D1ROK@PPP HD1@ H0bT!S0!P1 0U*0S S0|1  Q > | >KH T1  @ 0 PU:7hA0S`LA R0p0l0!h0XA00dNKx XxQL0 0P;PL0 x0 pĂ0 4ȌS \p@$4 (@K 4 |!R<  KK(@KA?A/(@K0K0000h0 S|! :h!MKG >KPP  lAT p 0Lp \0lA H}H¦H忦x1s KtAtA?(K K?K 0 48<S@1\SX `H@ a0C`p  1HF,`$`\2 (K 0<|!MK| 0@ HNK0Hu]`/>K<@0R@@0@ T` SbV~KA_x0 s@041 14 (@KV 3 V) (K00000h!0S:MKPP @ 0l1S pA@DpA Tl1 `Vڑ @0@ NK 0(@KKK,0c00(KKK,0l b @TS Tt  TNl  TK T TT  TDL  TAT< T<4 T9h>;*h;>;+hx+h+hX,h,h8-h-h0 <0< }0<p 0-LM0 PR 040@0T  R00`0X @ c;.  0 g00 -LMPpd 80@0CSBXP0X`\P | | 0 D0400s㯞@Ꭸპ 0R40`X  l-0  %P0  X|0sH<)X@0Q딽=>; 0-0L@Pt $0@hR 0"P  0 0.$ZR0>;?;;=; 0-LM 0Px @ 8000  B40R~(~(~(~(~(~(~(~(0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QLM`pb VQQ :QK Q 00@ Tx0iTP017. @P P% 0P: 0 S:Y  P `  W- 0 0i 0 ـ00Q  Q iQ Q00  0-80LS@P0 S0  0S S00Q0 000,P8BP PP ?;0?;0 Poh 8 8-#LP $0X  0X H0 x= 8 80-#L@20PS0 - 88LM#h0PS  0R~X0 0rpX0 $0S1 $  0$00S\!S :0S \D | 08 &`vV- #V 0S ẜ (`ڜ0 p 0  \ᩜ@TQ 0 0 @@HᕜBᏜ$@L\#`*0  0  Q 0 0  mhH?; -LM@'D0S H0S \d0`t`\0 h0L , -LCM q 8 8#$ P @R `52 P$0 S $42,IK J/K0JPP(\ 0S@0SP0  K 60@ (Pa(hL?;0 S 0 4   0  - 8L8M#@`p];0SP$h5T \5T{ ?P5T0;0 #<5T 45T 0S 80@S 0P080ۛ@4T 4T004T000P 0h4T- \4T P4T@0@4T=0<0(4T 4TL0 4T0004  C ) )3 ㎛0@S0@a@H03T 53T- 3T t3T0:0d3Tz00S0@0vQHrp43T00=0k 3Tf0Sc _2T0D000S0<0U2TQ ,2T$ 2TI0L0 0P0 0T0>2T:@2 82J)@T @/0S0+ 0) 2T 2T1T0S 0S 1 0R R   Q  0P  P 0T 0T 0T 00T 0T :00S0T|0T*`0Tl0|0T 0T|0T |0kB @sB@vB hB iB jB@fB@qB@f@xB@tB@|B@nB@wt@oB@==~fyBrBpBuB}BzB}fwBgBvtmBfBlB {B|= -LMP0R,(Sp@TyZP,@(NJY ` VA  }P[PMZP,( -0L@pTP`/ 0S( &PV 0R`@TV 0SP!0@V SLoh( ) -APL` 88#J@ pR:0S 0S  0Ps $0S 0 $ \%bṙh p- 88LM@#P!1`s  p 0<@80ƙ`00`P囙 = 0-@<L 88#P㲙`0S0`0  Q0 0 0S000hx -LM@< 88# :0S00 0 P -LM@pTP` 0=  00 @T(\0 y<0SX69 R-L`Pp U @V@1 (`VPpKX?; -QLM`p P 0 PR@T 0=00 0 @T(f\0 1<0S101,( -LM@0 0 $K01K $@ 1[!0 ! -L@M 0(K( 0 $K01K $@ 1[!0 ! -L M Y pp0Wp`XP4  R400400@0 @ @9`0K@$000,0 j0  尡 4:0S$P X 00S* P0  $    h -LM@ :P 70  20P00  70 -LMX0@0CSX0P(P,PhP P  -LP`p @00P, d 0 `0JLohd?; -L@T 0` S V@0<00`PU 00S PUQ dp0S S l0SQ Ch 0LoheT(TePoh 0-LMQP-P P@K00, 0AP0S000-0T@K00, 0,PQ0 Q0|=x=,0 P h0SlPPoh 0-LP@T t0 0CP@t "( hP0lSl00p@p 0Pohl \p0p0p0 -0 @LT`P p 0S @T p0 S 2! 0W*Pp Loh p-LM ` 0S 0 PU 0S PUp 0SU 4@ppLoh@-00 Q:bP, Q*@0R : 08 <4P 000aS a00R R 08< 408 08 -00 Q:lP Q*0\:00 0P00 0 -PLTM@`P p@@ @0S񟗱ğ(̟(ԟ(((( (((((((((((((($(0(T((((((\(d(((|((((((((((((D(L(((X(((((ȡ(((((((ء((((((((0(<(((L((((((((((((ܢ(((((((((((((((((((((((((((((((($((((((((0((((8(@(((H(((P((((((((((((((((((((((((((((((((((((((((((X(DpB `0K> `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh Kh0 \P*U 0 P: cR 0P*0 #0\*W \*0 RUhl K9l000| 0 RUTp Kjp0v w0P:UC 0 P: cR 0P:0 } { `0Kw `0Kqs0àpǠn0<àk<ǠigpelcaP07*0qZU 0 P: cR 0P* 00A S@-@**\ *!00S ((((($(T(T(00@S S ST!0S * R:!0R0SS `S0SS 0@S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P|= - @LM &h,2f( -LM( Q0`0  0 R1S 1 R j 0R0!R0q50S 0S 0R+d\ 000R00R00 A  PfP11 0AP PWP0P0@0@0a !R0 0 ! Ro> # = # 60\0 F==== ;=dhp?; -LMD1SA(P#Y0Z0J0@(@`  pp(@000 (a#0Y%X00` q l0R0 000  0DAV@ @@ p `F0V =( p-P0LM`%QU @ 60D1phNp= 0-Ln,0P@T @T0h:Xoh -L`ZpRH0PU ,0SPUh!@AHdh p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`PP $ 0`S00@ ph E=`ohXoh?; p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`0SD$0 `0`00 @phO nE=`ohXoh?; p-LMP㶒5T";5L2 0D"D2 0`$x8\ R0 10  0 PA A R0000 0 0SP 5 P 0R 00B 0B PQ Q0  0 0S0C 0% %01 $0@T 0 R 01HQ@T(=ph 22< R@0@ <0@0 < @0 ,(|(((0=vhpiXoh=dhxuh -PLQp` 0@S` TV@0@S0 0C0` ,u000 p-LMK`L@T 0S PU  pP  p-LM@*P`% PP 0S 5P@p㨑@|-ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T  0S  @T PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S =gfff, ,00S0 000=Toh Q00 00C0Toh -LM܀`0 V$0  % P"0 @PPPTU 4pKC " P`PU@00T00S$0 S $&hToh=?; -LM0@S  P, 8# 00ah4#Ꜵ(=Q 00 p-0LM`PV @T 0  R @T`Vp P 5 0S 0 S PpXoh p-0LM`PV 5 @T 0 R @T`Vp0S PpXoh -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z }&P  P 00 P$0  Q 0 Xoh===H0Q P 0 RPQXoh -pL W`4 @T 0S @T XR 5 ^P Q VP0PP*0 0#P:P P-L`Pp @@T Q P P@ 00 0@ 0S0C 0 @@\ $0\   s/ꐸ( 0-5P0L5l @T 6q@TQ 0 S11 10C1r0h9 -LM5@05H9h  -LM@9 h 0-@PTL @rT00000 p-LM`Ap0P@T %5R0C @T 80ph!(50S Xoh= 0-@0L@PT (P @T00Xoh -LMPU, `@ 7U 7U 70SP7U ,0 S |,$Pp L7%U p W87Ul ,7Uw c 7U- 7U \ p  0  0,5 㩎@L}-P0`0 |P%   ,&q< 00\5   x@Ln@B 50SEPr0S  6Pc<%5ATO PUL 0SI0FX0S ;S SK@s  n #5L@K05 P3Kp5 05P3K @TR 0S 0S @TFyS SS 3Ua 43U 3U&PPK0K@ P"@@ @ \@P0S"  \0S  3U 32UP ~P U<P sP@K0K cP3?3 2U2U*1U 1U 1U!1U1D X`001U" 1U 1U@K@ k0K@ ?\0`1U T1Uy<1UrM3@K M0K 1U 0UD60U>20-P'?$% hi$ii$zi ?;FixIi i i i qϖ=i i i i$Fi@i$Hi Gi i Jii i 5i i ~i i 6i(i$KiŠi$xi i$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,"P0pD1XU.LK(  U 0S7 U@` 0S<Kc$ PU 4Z 00pZ@ PETUXUP0 0eP  0 % p<K P PE p hXoh?; -LM@Q 0 S11 10C1o 0-@ L,PP 0 V80 $000 $0(0P0`oh -LM0`SMPU P7 PU  PP5  Pp+ 0@T P& $@TP@ 000@00 pp  0P ! T0P/S0P9S`oh p-LM@`TP P @TpT  R0000 0 P 0S P00CS00$ R( (0l0(0  $(0pP R000 0 0 `oh -LMȀ 0R$0 0@T 00@T$0 S |$7!@`TP 4pKV`F ` PP@Th?; -1LM@ T$ P P $@T$0 S $ T  R0 @T 00@T@`TP 4pKV`F9 ( PP@T`ohh?; 0-P0L@PT P $@T0T 000`oh p-0LM@`T P $@TpT  0 RP U 80 SPUp"p`ohi$ -LM0@S SL PT(  P h0SL9 0-T1L0MLQ@ T  8MP< $@T(@K0 (0K'K/P@ <P$%P@D@K  /P@ <P %P@0 S X 0 T @T @gT`ohh?;9?; -L$M@0Q0  %2 800S80 0 S h<55P2K4 K 800CS80ʴ5<55 h@;i -QM 0P P -Ѝ0 Ѝj P0  Ѝ3 ~ -L$M@A`AVD@ H@ @ p2@ Z lPS 40 40 \0S P40  TQ 3 R*UA@@@@0 R,((((((((((((((((((((((((T((((((((4`K  @0`rP 1  5  3Qs H0S02K H@ 0 1^  H0S 400cN  lZE 1000@*K   D0 S<KsQ@"! 1`R001S000 00!005  !@ ވ  5l101ш77@C S 0 B0 0   0h0h40C0C!0RlH @0@4`K @BK@04`K  ` P02Kz ( 3R: R1 00C B 0 !  H0S400c  dk@T 1000  S0 0C 0 0d0d40C0Cbm i5k0 , ! , !2 P`0pS! ὇lR 0`R 000S@0@0@0i騇000k0S000 0PP0҇1U) 1Ue0, ! $ , !h1 P`埇0pS rLQ000 0PP0奇5igs50, ! ' , !0 P`o0pS BP000 0PP0us P TiJj`Pl=iivh5݆pi0=@-@@:@0\#" 00  @Z003f= 0-s/0L@P0S0 Y 0X \ZP0( -LM!@R \0700*!R\@-@ *,  0!\ "0! ":\b9@-^p`*#!^ ",!1 #: b9b9 0-0LSP@/ S /0 G C0S0S 0S0S0S 3000  00 00l !d0ST L 0^ 0 000  0 ==== -LM@pO@,`K4K P@Q,0[ 40[A T  0S  @PP0 007 P@"   00 p10S!00u?A0! ! wP1 01х4 ͅ7 Ʌ -LM@@,`K4pK 1P@A6T - M0S  @DPP00CS0 ᚅ R0700 10C1 (P10C14~z -@LMhV= -LMpዅ`P0S@0 s01 WTs 0%  0(90 \0%0 0 0 WPX0Z Y@5~0 < 0P@x+h4@;L((hoh -40LM @P0 {0hoh -LMpP`@ <P 5vTP 4 10Scp00p0  0SV SAK` 0R:000Sp0 00p pP0 .!  !1 @`0S ᶄh0| 0h0  | 孄000 @@000g ᚄ7 (t8g/`@g40 3A0 O7piii@;vh<@;Q0P0ḁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0\02i 1i i 8(i -  0@  -@L`p  P P @  0` pP0 6X@; p-RLM`@PPU@p 0-L P@\p 0  80P \ 0 ~P6x@;@; -QPLMpP` J WH 1RG 1RB 0S?0@S000000@ PU P@U 0S @T1!  P UR*01P UR:$ c0U0P00S @ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  @ 0S 1 \1S= -LM 0 -LM@ P`P, 0  xSPc0JSTU00U0S X00X0S40  ([- PpA X1  Π L0Ap,0HDL (P$P` ( 0$ ( 8D ( P0380 0< (8 00 S 80S <0S Pl0  )P04 | 8 80,0@00 oꫪ0= P0- L @T 0S $0PS 0,0PPP 0R PR* q  000 PH0 -!40 00 p-LM`0@PT@!T 0 S 00 0 0 0d0 00dS00 0p  00 0 p-LM@PTP` 0S0S|2 v0Sp 0P*S~ 0Su |Rk <2R` 0SJl0SGVB VV  2R V6 V1  0V P|00pV p0S p}z 00RpD <00 CD<A1 1R V00|0SP0S K0S 0  pq0VV0 DP |0( 0C&0BS0#< q c0#22c !kp0=B p-LM@PT00P``V,0Q#8Q<QQ([-$`pd0( !$D ( $$ ( $$ ( $p -@P0T@!TL0dp` 00 S   0 00  0-D$ <0P0 4 PCD@L<Ar |D 0x0 00 0@Pt X0dPTPlP`P0=G-$d A?L0CR0`@0ltAp0PppP00S M,0 8, .!0S 00Q^Ѝ0 S0R 0R 0RP 0R 0R 0R 0R 0R 0R  0R 0R U: 0e,c0 \CRPEڈ0Rh00S0 p-LM$Pl@40d 0a`SRQ` v`F $00A?C0CR$*0S d00l  !l00Sl0 d00 P @0L<#0@0l0 S0 Rp0 h0d TD< e0eed h0T 0rSe \80 0rSe \` 0-L@p0p`l0RSSd0 @ 0PL 1#0,< @00`8 `@0< 0Vdz $0dA?C f0CRs0S dXX l0R X0RWh B al x0X `Pl :R80@X0d0 d 0@P L2#0< ,@00` 80`@ 6< 0X00CSX0d00d0^ Td P00 `0d0T0L0 Rd 0 0d X0@0P L2#0@000 )l0d 0C l0d X l0SW S^Td P00 `0Ud0T00 R  -L@pl0SSSd0 @ 0PL 1#0,< @00p8 p@0< 0X h0PW\0p XP x0R*$0dA?C g0CR0S 0dXX l0R X0R0S R} p RX0S,`0Sl00C ` dl000 0 SP Td P00 `0d0T0d0l 0 Bd0l 0S\l0 a0 BA`C}l0  Bp0 0Cl p0d0PUdP0 @ 0PL<#< ,0@00p8 p@0< 0p0CQpd 0 XX0d `O Td P00 `0d0T0G0 Rh0 0c S}XP{dy l0SZ S2`0STd P00 ` 0fd0T0"0 R d 000 S 0`0 p-L$MbŸB 1!PPPU  Q 0CA 1Pڨ1PPUQڀaà1#0CP!\1P0PUQ8 K0QP 2[PU02K00Z pP2[PU02K 00\U 2[P02KU00ڔU 2[P02KU00X\FX`PA0  4PUp;f:fb9;f`c98f9f$3f7f 0-0L PR t0l0d0d ;`0$;X0X 0;T0΅&MK(˅0h D7f8d9Ld9`d9 0 R0&=  R0ZL0  R0Z000 00$0$  0t G-0P 0T@T`0 .T0T{X˓ 1 Q:0 R@0T1 Q:L0 R ,00@ TT0THPG-0M  @ 0"00\0Z01T+!0PUE1T P0`1 \ P @ڏUZ0 d`H0 RL0 R 0 0A000J0CZ0X 蠟0P NT;PE! S`P\Ѝ0@ S c0 !! 0l0000PnL0 La0 0! R $00" 4 L6  -L$Mp@`K 0R0(P00"Ƞ@TQ0 @RT000 -L M, 0,  pt"t2pŸ Q0 `@00 PR 1 0R00!0` Tk`0 VŸ 0SW,00!0?`V `FV0Q⨑P 0Xk!T0C 0X l0X0CC!1TkTD!0 0000 Q0PP X[ 0PSX˔0,0C!T˂0.0 oQꔐ`唠0 Q1ҵ> 0 0 P 1   B0^ 0 0 0b 0 0Sڃ=LHPG-@TpPpP1^`ᶀ&^@\ ^ !000 \ \ !000000T p \pP QpP ^  Ų000t G-M 0Q  ZP C 1Z00\1 ZAl~dep@0dQ.ڰ010   !0 0c^ B Z^  Q  00 S 0Ѝ 4 010\~ \" 1. HD0nPk40($000 "$ 0 0c\à3 B J3c@0d^@ڰ3 3. 0 "$ 0 0c\à B DQ8ßJ0 10 #0#40 0bP B2 yŸ J010q2 2. Ÿ0   ZKl2Tb@0d^:@P2 02. 0 "$ 0 0c\à B  QJ0 10 !0#40 0bP Bl J01Td1 D1. D1$a@0d^:(1 1. 0 "$ 0 0c\à B  Qژ J0 10 p 0#40 0bP BV< J01Z$<0 0. t -LM@+, +&(uD01>0 R@P 0000$d9 -LMR@ \`pڈ,A0 B<0(0#40"(0aR# A  R PtF000 0#40 0bP B Q \PڤG0<0 0#40 !0bQ B PU"<0a0 P$0 1>0 0 0"$ 0`\à @PU I& o0 1>0 ` G0<0@0F   00 "$ 0 0c\à B 3 0S:3s`P0fU\ß+050 0 "$ 0 0c^ B  3 #Ѝ+0 50 0 . 2嬢` 1+ 0nPڰ0000 "$ 0 0c\à B <2^ ,2  nPPaoڸ0000 "$ 0  0cP B pGW113<`ӗ`Ӆ!0tQ0nP?ڱ0000 "$ 0 0c\à B  1^V P1 nPpaڸ0000 "$ 0  0cP B 60 0 000   0 0 00   v:fb9;f8f`c9;f- 8Q Z y8Q ,8Q .\000 0A Q 0@-@0SP Sp 0 0"$0C0 00 0"$ PP0x00t S00 "$0 04 4000S 0 0 -L@`Pp0 T  0 &Ġ`00  0"$ `Fv 0 `Fv00 -PLM0 @\ K @@@ 0S0000 0-PLM@ \ $PU 0 KS(  000$P P-LP`+ (  P pp0V p 0`f 00FS0 `@P 0&SP N) P-L@p 0S `P 0S$)%)%)&)P&)&)&)@')')Q 0 0A ^ 0` 2 0P0 #20S 200Q  0A  00` t2l"c0#22cP` D200  9Ws |k \_   0 S00000SL  0C00< 0 00Q: 0 A0 0 80 PQ) 0 A0 0 40 00Q 0 A0 0 00 R ` 0h00W  00000` 0000S0S 0A;A;0A;BHA;`A; 0S p-PLM`  Rp0S00 00\/ @Q Q0#S Ra\00Q00S0 d0Q0 @PW 0@P0ppSp 0-80@S<0L0 P0BSR 8P0(U 00 0$040<  (! $ -LMPp(@  P@  ( `P0@ <(` ,0080 ($ -LDM`4T 00L PP ,0%T%0`0$p PC2a \ q$+)-)-)p/)0)1)2)3)3)l5)U XU 0uPUP H@0 0R+)+)L,)`,)PE@0qPd7t00K4 K80K,KL,04 80~P   0qPE0 $p PL0 0c P  T 4 LP j07sPE) 0qPE0L $p P$p PL 0 0c L0 T4$p PL L0 0c 0P0  T4LP 8U X& 0uPUP H 8"(#8RR00Pp 00L( $p P0 0c 0P0  $p PL0 0c  T4XO Y, TP> Y @ T@! T @! T0 0dP 0ST00dT0 d0S00CT 4 P LP 40T0 0TS, %T%, 50c0C2l P Yh(0Q ST0 T%0c0C2a 00(S QT T%0a0C2a $p PL0 0c  T41 U X 0uP UP HI $IR@2P0L@TL0@(  P x 0 @0 'wPE#50Y*U XO 0uPUP H  !0#50\qPE: Y p0 S000L0  ,P0@0(" 00<0YX@ '*@U *X 0uPUP H:ğ 10!@P 0 Pd7t  @" 00<0QX@ :L@0@K0 HK@  LDK<0K < P@tL<@D H0P@W L (!L0 $D0H  @0 $p PL0 0c  T4P LPP O LLL4 T 00P R,0%T%0b0C2a 0LS$p P U0PEJ0T 4 P LP 40T0 00T S500$p PLLHjLDg$p PL0 0c P  p $p PL0 0c P@ dL (! L0$P@ P U *X8 0uPUP H:7tPd\!X@ " 00< 0RPl7| Y00PQ P  1 ^  00 L0 $p PL$p PL0 0c  pP L (L0 !$ 00$p PL L0 0c 0P0 0 xA;A;=td9A;A; 0-P@L,0  C(($(@ $0 -L M0 40`Rp<0S7,0b$0,0 0XP00  80Y @1@!S   0P00,00PU(Pde0PX,0$000 00 0c  4P<<0 S00  -WMLMh , h d ` \ X T P L H D @ < 8 4 0 l% p5 =K hUp h@K1hK0PU1h0hS0@5 B hK1S@T|E Q1 Ph K1SPU5xU S0!5 004T5 *hK1@^ JT:hK1% R% JEUK0LhK1 L@PU `E dpK 0PU@@QKA ApP @T! E0Q00hPU:|x%PPdU P ubU |Eh0K10Cst5 E| ^\t x%| j% 0@j$ P !R  t|0a CTh0K  *@T*0 R c@T:`(  0 P ` 0 0Y0K !   <$%  `5B%05 Q=K  E| ^ʘ%|hE1hW <$?0#0#% 5 % *l%QL*QE` 0 %  p5H0T *K1@T:|%0BC P%@8P%0C !0S %EbI80C !0StN~t P|xP| Cx%E0R0T00S lE0np!P  % 15 Y PP 0-LM@P 0 P @xp p 000000A;B; -LM`P 0pD SP@ p0 p 0@0 x0 8P@ pD0 p 0@04e9d98B;\B;(f9e9 00a0(=ZU"@T 80@ 0CR80 +@0S$ 0S0C 0 @` 0<0 0 S  0 H1 ,0S <,  @080PPK@">"0NK P0KOKdP Y0S P@z 80@ 0CR80t X>Y3AN>P7 @ 4phD;D; 0-LM`P@\ T 0L@F@@0 <@40$ 000Yt=ohD;LfohX)=D; 0-0L PR  HP@0 H 0QP  00@0t=oh p-L M@PT`"  R 0 0 0 R000 0 0V  \  p0S0C0 @T R000 p080  0OohD; 0-d@LTP  tR 0 0 0 R 000 0 0  0S0C0 d@T0(E;oh -P1pLMD!P0d@0TT0` 0S& @TqP@ /p`Pd00Sd 0 0d0d@ 00@@0007 R 0 0 0 R 000 0 0  0S0C0 WH=D=ohTE;-00! oh1`a!6hU 0 (P00g0 00 = S000 0S000 0S000 "=" S000 >S0 00`U*=E;E; -LM@5#"!sR111 Eh 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMg.S@ 0`?C0CQCD0T T(0(0 0 mh F;4F; P P111< 1N P PP1N  -LLMß0sP@`,0 d!0 h dKh 녯hP#0S5UPUd0[pWTK8h R2b3c13d0<3 ,0S 0,dK0  @T@p0d0[Wǖ 0  0 0  B0 ~ǖ{ǖxǖD2 1l0 0nǖ|rh _U 0pWp p00  t0 {P@pp0Wl @ 0Eǖ5,# d[t0Qd K0 R QQd K00 Ðh0 d K S 0h0 B0 0ǖ 0ǖ 0ǖl B0l0 0ǖl 0ǖl0 0ǖzhPF;f9 Q00S Q -LM<P8S ySp S p  Wp!0S7 B `<` ` ``VW x1@ R4p@TT1 R P4\7 S 7\4S gV T)4)@)4)@)@)4)@)4)7<7547<P` W@0\Ġ @Tyrpp iS Sppp 0-0 0 $7PS00 7L@S ))),)))8))D)T1 0XB000 00CSص)))))080000808070:00;0<0<0: -LM7@SC \ ǀ 0 S057A-_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWPf9 -"L0PS1` QS1/A Vn00S^ ^i υpVL 1i R000^XQ-1i>0 R!1?0X7^XQ (1i>0X@!T@X^N0`W4 1i>0X@T@0!0i.S 01000ShF;Hg9|F; 0-<7L P|000 Rd0S 000S20S@N00d0 `0Q00R0S>S "=" S R)Ժ),))$)Ժ)T 1S1 RP 7S `g90 1 SR8h90 0000  p@-1 @^PT * ^0 0S0:W0!0CR  101 ^00S0 00p00d0bT00!R 0S00 000S10C1 ̫ -LM@'N@ h y -LM8@S08 -0L'0 S# 00CSꔽ)Ľ))Ľ)Ľ)Ľ))Ľ)Ľ)Ľ)Ľ)Ľ)Ľ)Ľ))     = 1802}. -L0$0 S 00CSh))|))))))))))))h) ` c|10#302}. -1L`pG  H0S 400c7  h1`VP- 1P000  0@  #$<0 P#  #(80!<4>0@"S 0 B0 0  0a0a40C0C -L M,  00 40 0 P= 0@pP`$#L4(P`'0@ x ̠ )pP`4@ p0 dP0 `S P:0 0S:,0M,2,240`,0 -1L`pH  H0S 400c8  0`V. 1P0 00#$<0    00 #  #(80!<00" 0@S 0 B0 0  0a0a40C0C -L M,  00 40 0 P= 0@pP`$#L4(P`'0@ x ̠ )pP`4@ p0 dP0 `S P:0 0S:,40,1,140`,&0 -LKP)`*< `KK @LB -K@LB @0@L28BS@ :P^P ZD,0 S 8,hh9F; -LM@"`P 4K, @2 \0@1 @QX2 O K%.K000T2 @X"00C\P D2 p*4K K8%K%K@8Kp`\L0\@o_`%KL$  @i_` 0'0| P`^? )p !4 P `"$' =t%K M_`" p(@ p K$< =KP)`*D `KKKD K⠑DK 4K<K D%.K@0P0P \DLD :TPT Z` 4KeL,0 PS 8,hh9F; -LMp0@W,0 0`0 儠KJPK@' @060#0@?T@@ X @e T' 嘑@  t@0\0#0@?T @@=  K G ||,0 S l,1  @4 TꄠK @K ) ^phF; -LM K  -LMp0@W,0 0`0 删KJPK@ @060#0@?T@@ X @i T' 唡@ @0\0#0@?T @@=  O K x|,0 S l,1  @8 TꈠK @K - ZphF; -LM K  -L$Mؐ`pA0K@0  0V,@ A0K@PpV ,0S t, @@K 0@]  0 PRA0[`F0VA0KPh G; -L8MP@0 T0 P P0@ L@ D @0 H0 P4  @` T K0<` 0@ P8@ G; -L8M†|`p 0TK@0  R!8087  P Z 7S 808 00 / P 80\ Pp IPp 7SU j?  TH Y80S 6Q3  #0 0)04z\ H0D ?0#l0L0@7T 0rX s < @W 7S Z 00PS1S  7P60 O80 H@ R $7S1Ss0X S 1 R 767X T7s 3D0,  1 R   G&76Ppp u808S S!7S" R8087SR0 1"0P B4T L0 .S  S@ *SR X 2S 0SSRT ,K,K oP0S PS0S@P h9 -LM@ PPp $7S ` 0SP 00SR0S JS0 RZ= 0SY8  R808R T60R 8087P7 0S T7U p00 0WP 0 PP8082S808 -L M L\808p`P@t D 0Ȑ ^ 8 Ȁ P@< -L,M@ `P $7S 00 S00 ppL0 PL W0e ST# P 909 W0PPp$4WD H0 @ 8 < 4 0  00S0.S S0P  S4P  P0Sp40S 4 0S00S 00 R808R T60R 808007HP10CSW< RL YP:D   0L 9094 80t00H03D #T7l l TǔL T7rrY0L z 90 90 mH90H9@0S   P`   09098082S8P d 0S @`d` p&\P>PT% T\ 똠,0 S ,ᘵt( h0 ^H|{ P0S`p nhtI;I;I;h9 -L,M0 0P0P00S80 4 9 P`  @K 0@ p`,8H P`0p`P D8Pab0c4@e R,pK 00S 00S P S( 0 RU 4Q  0R P05040 l@(d 0@ RD  `P0S P I;I;h9 -LTM4 78 S< y8PK P` 0@ p  `, P`H08p  `PHpL,\(d (P) 0@ p<`$А #LP`P  4 P:;<0S7*< 8 P/8@8`a0b c@$Pe0SD `",K0K 00S 00S2 S 0@ RV DpW 80 <Q  0R  PT 8`K p  0@ P`,TH8d0 @0pK pX@8p`K\  R d PD d0@,DH$ZP02}4 0 DH0 H 2$HP00@ H@P'Wd07 0H`4p40d  dRc dPKDH G0@FP`,DHd0 @0pKCpELp`K0 PDB < @ P.8'x4!,P`ApH0@P`~.`,2SN p`K  0@ P` pPK ,DHd0\`p`X P@< L.T8'@P 4x )P` 0 @@ ,5,04 oe0 6,0L@( @0@ad 04 Pd1I;I; -LM, 0P0P^0 6  0@ p,0KH P`pdP4p,80@ \.d( P'$x #L4`00P` P 0 0S,0p5 ͯ 0 0(0I;I; -LM 0PpSp`@0S i' 0R 0 40Q:a b04c0Q: 0  > R 0SH  @ 8          b      0S    4P cP 0S -LM2PS@ pP`\  &K!"[9 S 5 %2[ (LUD0R 5 [ 0(DxX+ 0Sx0|000  B @R0 00 5 006S606( l5 ڮ 8( 5 Ю I;RI;0J;dJ;J; -LM%@: 0S%  $ 00P h9 -LM`4@Kp)0 , 80 `XW@T#0# <0 !Pa T HP ,0 S , 8KP77 07  W@T 8K P<a( H8K P01 T p4T#K( |<Ew@r<:(@ j0 `d- ^8K ]P t t0T (@P@TP0PPJpWP@@yhJ;J;K;;K;$K;TK;xK;;K;K; -`LMPp @# 60 07ll0X0C4W B  t0R )TS  353576r0b0s c t0 d0 U?&0p 6 &1l0!>p  i?t 0 7x  hPx00x0T7Wx00x0xRV 0-@PL  #0760 {B0 W0CXu%#53&'b0r0c s d0D t060&U? 6( 0l01p !t01'!0RV -;LYM:, \@P` :\ :\ j:\: :\ `: ,0S ,g:eP`@l P7;7 7S $7S 7  T #  P 4`7 ; 7 98P`1p ȠDž \9i>0  R! 1?0X77$7S 7ST7X l R@9QT7,9\ $9\ 0X`8P`7@ 108%S84`|z8P`t!8  R 7j 7 ;g4`7d7 a ;L8\ A@8\ 88\T8ŤP`N 7!S F74`207岤P`; 7S8 52`4 ' 07 $7 S'  h' 02c0T'fH7\4 #<7\6傤P`  7S Pp x0  Pp`6\$7ST7l 7SX86QP`Pp T7P` 1S S S 00 15&P`70SK Kp 0HS  0 00SAP`ZpV0CZ002C R* r$ P7<7<}N.K7` P@F 0S  S00F0 0 0 Z0@0`0PZ0'RP Q44 @R\$4\ ,4\  4\ 4\=7@3PQ867#500#00/3\ 3\( 7S >1"s.  0᙮x3\ $l3\ d3\ 9 PpK! E$7S (3z P KP [OK8! $fT607P0K2\U *2\7 00`8p00P0SZP0p02D`V70'P` 02\w `J Pp 0|S:cK | ֶ`V0|00 Pp| 0S*Pp  0P`PK! 2P`P0[ S}zN@ ᶼP ['OK$7S 'R! 7   㞼_ \T#hii iiiK;ih9i i i8i i =K;i|i|ii !i ii5i i 6i(i i i|i8i| 0-"|72h'l7"2LŸp't7 2d' QP'2 2Q0t"002a VVw VrX"V80B@@10pS(700^ b1(GTTu1@7 ( !00A TI3T) T$!T80B``l10pS900 <1ITxOI) `12 @!@T T0! T(! T T T! T! TT T T ߻ ؗ( @V V  V  V V Vp  V|h  VyVX VtP Vq>*?*?*?*,=*hK;h9K;`K*+hx+h+hX,h,h8-h-h -LM'7@R'7RhP707 0-LP@T 00l0000000d TG 0tL; -TLQ`T>(Q)Q<10@cT@ 7 0  T7l UhOAKkN@0T'00lP  -5L`@TWG707l@k !NWp#p k g 7S7 #00#0!0z 6 6 7V) Rt003037  037Sr007  7( uLL; p-LM`lP1i>0l@T@'0@@R l0S@ 7S,#7@ # @ Z7@S 6 R @7 p #  P @z7P  # -L$MP5 `$  74#03( ($3wN @R707 7PSu PpB 1@S ^ S!YTPW0  Tpl|201 'R T T7W R ' 07 $0S $  7S7  7S7P '0S !000 07X"PWp 0 RpPP DpKllA 0  bPPDK0i>0  R! 0S1 \\ xV1i>0  R! @p \hpp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP 7TǐP@ S`` 0SF S p 0PQ Q 7S # PP PS00ST*U*$U*$U* 7SS# PPP00 'R# 00 'RPPV 0Sp= -LM@PAAP`p Q2  P 0iSS  0i鬞l(! 1`R1SP1Q0Q10  1 0005  (( 101((17L; -QLMp`s 011f  H0S 400cV  b `VM 1000@0pU000P21   㷷 ! @ⲷ# 㮷5 7S  PZ ᯠlPTl@0*!(0006S`6f060f5 S 0 B0 0  0f0f40C0C ik9j9L;M;Q0 7SP1>0 RP Y*(Y*LY*TY*P1>0 Rj9 0S 00S @S S`SSʠSS -LMpP` P? 0iSS;0@S)0&00S!xZ* [*xZ* [*Pp 01pTG<'000'pT( H"09009Ub W 00 0 Sf PP 8K Pp 01' j?  "[2R i@<  0U  "[ 1|  H0S 400cq Ti 0 d0 0U] 1000@ 0Y0 I <0 w00 V021  7S@]*\*$]*@]*$]*$]*x]*$]*Z*0#0 X2K  T P7 0@00W00 C2K  ?T#00 5#  12KU? "!,90,9D PS*  0e0e40C0C@e$M;- 7S S  l0  ˌ,40 0-0@0 LP@0 0-0@0PLUP#P ٵ@0 0-l0P @L 00 p0<0 '#3"$ @00@r000 -0@LM0l0^0@ 0-)^L@ * 0SQ*0S Q3R )0SQ 0S n 00 > P0  P 9S9S000@ g0 0 0 00 0@- 00  x0 p0B0 022 00 0 " 0^#40 i9*00 40 Ǒ R  R    .00  00 -SL$@K(@K MP` 0 0 P 00CPSb*b*b*,d*b*b*b*4d*b*b*b*b*b*b*b* ` e$ D D0D! \'00 Z0007! 0 1! *b* X*|)l* -LM@Q 0 S66 60C6Q 0 S66 60C6 -` V `PULp@0@ 0C^SPUU dV@PLPU<V@(hPPUO; p9k4f0 2 Q, _0@%Tt!t1 dRWTMPKV@T4hC(  @<T841 #2 &!\ ܔה, Ҕ\͔LO;O;O;O;;N;N;N;;; l0l 0` ᥪT0P HP0@T R 0RTph$==`qhD= -LxßP0@S0pH`\0 0R0H00 <p83,q4 T < X0S\0 S1P P .  bP%000 0 0 d 0 0(Sl1  @(Qb***********0*@*L****************************TU\*\*\*\**\***********@1E#U(0 0U"R 00S3 0)S 0tß0l3 h3!10S   CU00U0000$P0`00  00000C@@ @T@19p2 R T#U  10UR000 B  00P(K, P0,P 1 RP6&1 q,1 R1 001 000 ! 00 0Sz000qT@ҍGT@1 Rf 0 R1 U00( 0 RS U r R t0 QF `*qPB 00h  0S 05 X0 0rh=dth======*=== -3LM p, 001 CP  0S 2 @T H0Q 0% X0Q <@T@@K" 0< K;0K 080 @ R X0@@0X0@80S0C80yH0Y 0Nڢ 0PD0 `@` @QP Q TPU00U0S DQQ @e`@ Q> T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD$1 <1.Xg0 ,0S ,L0  00 0P  0 0@, T00T0Tz`hxuhX;uh -L M 0@p@A`0d` 0p0#!dP0 0d0  0ppg  -LMKX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`霂*xp0 pI``P PUVPOP#=== 0-LM PP@ 40P00 KPP彠0SL L@@808 劤P04010x=|* 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0\@| 00 T@ RL 0hJT:<0\ T0L0P0SSP@0== -L$MȀp0P4`K$0 * 4P0S L00P0 $0S $ 0@P  0pp6D0<0. 10 S 忱hX;dth=X; - 0L )P==rh - LMR 40 S 0 0 哱X; -(!XL"x H` P ތ hٌU H -L&!!Q#7011A!1 Ƞ&1 &0A0 x!0hp00 cT1(0000 c( & ! a c0#7%c!c1c X@0ဌ08 #HT 00 0 R 900T| ?A7c%c!c1cW XEن QfPfPfQfQfyQf&Hu9D="=Qf =Qf 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0 =/uD=QfPfQfQfEنQfQfPf"= 0-LM0P [[@[0[ P@0QfY; -L(M(`KD 4pK⊍4 ᆍ@$Ÿ$ 0@X Px Q eB!2b2c621b1c \ڼ0P*0 RP 04P:1!1!@P @@8hQ؈2[S@ ` B1 2P13[@S `,@"!@00Q@0 匎 刎 儎0廡0\ eB!2b2c621b1c1\ 0TNu9Zu9$Y;\vh=dthd=l==xuhvh$whqh,Y;vh0Y;4vh @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V   "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V ` R0@00@ K,$00C00f8#8#$0$  "4 408#8#$0$ ,0S , 0S00,00 @ T,  ,@ "48<#Z @"48<T#, `V}0@00 001Sm pP``0V0C0@  P`00C0V@ 8#8#$0$00 0 0 000  R000 @"@2@P- @dDFA 02 S`(1b1 R0000 0 0! 0 0 0!B W P 0P U  Ca`! h00h0V 0S0 0 0 0\!000x 00C0Q Q00P@P00 Y 00S0<0 0 0 0 0 0  00 00 T`\vh=hh)huh*h$wh - @LTp ` P R000@ "0U0C0 R000 0@Pt@dDFA 02 S`T1b1 R0pp00ph5`=\vhhh)h -LN`pJ0S000 R P00C0@ T h@300 P 80S0C8000hØ 00 00vh$whuhHvh p-LMt`0S pX@000S00ph(P000^0S0vh$whuh -LM|P0S ppp00/"?CQT`1@000?0S 00/"?CQ@T$wh==uh -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( -gP H %000P PD @ 0D"P00P00iP0iPT T|2 R8 PUT0 0gP, PE0S P T P 0 0H܇000  R H 0D0 P gP gTx D XPi4@K ệ2 [R3[Q0S 10[#0 210K[8K@  㢇10[0S% S 2[0<KA <0 咇20[020K@0iPpS20[3 [0Si t 〇dgP. 20[020K20[3 [0SX0L0@ 0gP H  gT= =$=uhd= p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 尖P@p4LvhHvh p-LM@0`+TP p/0D #10P%Qf= p-0LM$0 (K0 (K'K1KᗖPP+ 4 10 S 80S0C80p00 R0`V @T 00 Q @T`V80S0C80pږ⪂P80S0C80pǖXoh -PLP& P` 0@10 0 pD00 Pᮆ@PE0U :0U0*00=$Qf p-LM` 001PC@ c 0!0e 000e00 000p -LM1P `@,P 0P  l$(00(0oYP 0S8tX  0R $P 80S0C80ß000 00 0 ǒ\3  0#$(,"(DRD #0Pp 0#!DQD#p00C0< 0R 8#0 S0!0# P"(00(0 ",0S$00$0p ,00,0WN APA`+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T+T++T+T+T+T+T+T+T+T+T+T+T+T+T+T++T+T+T+T+T+T+T+T+T+T+P, , 00j1 R lP 40 80S0C80<+=+=+=+8?+T 0S p@T 3R ,0 S ,啄5U@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R< 2Q6 H0S <Q0 H0SQ P* U 5S@T 0 R @ TT0pT;p~ 1P7pv 000r 0RP@ 0 <0K; K0@K80 :@Q P P 80S0C80 ,4am4cm@0 zPE ؽ 0Z h0 S H00080P00Ei@iKJI===0Bi|Ci$+Ci -LMP@`p KPPJ 0 0bSE 9R09D0 001 0 0 0Q00`0 D001  B m 00C0F 0@P P 80S0C80< llyH&Ei@iCi$+ -LMP@`?p KPP <4<("4!<S ) 9S090Q9D00 01 000Q00`0 D001  B l 00C0x 0@P P 80S0C800 NlPlyռEi@iCi$+ -LkM PLT\`P@F n Tp p! ßD W pU`@ #t0D SD K1nK @P 0S o/K PP@ b@0a X Pl0L0Pd @0 0@0d rtPP  ! dd Ti piI᠀a0\0r U 1o@p l0L0D= SY `0`S6 000  10dP P P 80S0C80 Lkk81P@ x{0d@  @ dm0[ 0 " 000  QʐT0S0 000  QT0S909PDXۻ=DQ 7=0Bi@i$+Ci -LMU0SP`0  S(  04 ,0 0)0Spp4 p0VNP` 00SV 0  RcU0S S @ <4(<"4!<0<4(<"4!<  0 4#$0$ 0 0 :#40  0 R 30(,!$#, 9 2"0P<4(<"4 <0L<4<("4!<0U 0S_ SI 0S|0S8 S# 0S S /, Q<Z! ,  0bB"0S;0, Pe4 0`  !4 8<#` #8 0U 04^01t000 04 d0b!$(," "( 4 U 40!c 0"4 40Y\ gx g00(@/0 X0@0t 0 0 % 71!7㎺1@`Q/ 4 , gh =l=h= -LdMtp`l | 0,0 @Pp =1S9 6t0&(= r 0 Q1 !0npP\0 tp $ Z S2\ Z h hX0G0T1!Xt \ TL0\p G P0c3R Xx  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx R;!;xp0 aS0b0bS ^ tp0 0bSt1Sd   S(h tp tp00^ 0S7 J? dh `Xt ɃXh  r X00R00S*h00h0 0!0bSHD0ODuPp( xh 00SW  X: 0h h00c<  H0S Xژ\ 0(P \ 0Sz h 0 | 0 x0Se Mfx 0 0 @C t0 1R0B0X401 0,$,!$#, 0d,$,!$#,^ 5 T0x#Q7Q8ȟ 2Z`ZZ"("("4 40 0CS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 Pt0 0t0 1 0cS 01!S7 40!0000@ 0R p'0?0 {h400t1SW vST `^/d1l wRd!@00@0tpƟ 00 0tpZ1 0cS0Xt0 t^Rp,0 S |,k0t0mh7^ `(P `2QAQ6S06ót0`6$h||7 1!"4 400| l0 t00| m0%00 |@S;0 0H @` S!@( B"40 0l 0||00H ?0 o` hFY 1 0cS!R 0d0 0 8#8#$(,"8SX3TsTP0OP'(d00d0t00t0  00bS"l0p000l0p0ㅷPp8 Ÿh00S W0 0 h0 0)㬷1@ p0 S   <2P!LAd,T0K$ 8,#,$ 2d.TK 0$, d @pT@KSpK  44 VKRK5KGd@dp tp  T @ |1| 8<("4!<d P0 yl.S<h h  Y 0SV \ 04006:Zg40 㺦  * ft` ,00` Sp 7!2! 1%0 p6pp <h=I0Bigh==Y;F8Til= JY; -LMN? @0A9O?d 1\  Q xQx< 0?0yf&6 R06 密:==Y; 0-LM@PP 0@@y 0@qx0 h0Td0d\\0 ;Q<0< 0R@!0h,x4TiY;DiZ;lSi==LTi dhgh$+ Z; -LMx`PV|pV tP6 P # 0 0s 0 0 P p1 00 00@, Ic Ecl0P:0`0#$##   0 P0(@Q@ ^0+ 0 8 "8((<"8 8!("(!0QA"@A"ҵP` t1S S 0\ 0 00(0S1:0 0S(0gh -L4Mğ`VH , pPD  |t@0HH T L\L aPD W M0Y0@0 Y 00Y Y<(@@ @0 00 00 0 , 8$#,0 $#%,P V2  D2PD DQ("("4 4Y0< Y 2 ,0S |,h`000V0|@0( C"<0  04( u V$"40 |00V00|H 0< ]@!@ "4 40ᰁ@\T@l1$ \1 R;0V|H ( @@ f<0 L 0@L <Kb L b<K b(@I(0 0 0@ 0APpx 0Y@ Y<  .a( 0#2ShIZ;h=l=gh -LMD~PPL X],1@0JϠ @70wdq`@ `odV@^ hd 020 0(B)&QN?  P0O/t0|6ڀP ü&h0 `1d1X 00 t1H0H0$! !  s t DPDi=H+hu9+=:=?$eh= p-LM6pS0| 0@`@P0 <U Sph40 RP f| <at1S  | 8W|( RK0 : 0P!0\ d d|,;| (!  /00dDih Bi Di4TiLZ;- P y̌ Ƞ,8 0  ( "(4R! ,ȠhDi -LL@@0 9 Q+(0 0  hDi DiD=DiDi -LMh@ d0R\0\ 0Q00040@ @UH@Di/uD=Di Di0@-dd0`@S =0RHP00Q=0P(0$0/ b 0HTi`PKdK(0D@XK0808( h0Bi:==l=\Z;Fr=Ժ+LTi -@Lt0`0p h, N? , O?Ɍ LQUP1 Q 0r030r0P0,H0l <^*40  ^:000000Bi:=DTi = p-L M@t0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LPK` `0 ?08^phQ<00<<0 0Bi@Ti=HTi=p K`@X , 8 b0DZ S 0 B0 0  0e0e40C0C0-ኧ(0S9@s=hTiMЍ -LM QP`@p 0Q0T00SQ8+++ +,+ ++X++`++L+++ +++ + + + + +T pZ MXJp W2 CPph0 22  s t h0  p uh0  0S 0S$0S(0S 8pp Wl(0S=h0  0S  0S$0S(0S9p h0<<,80Ꮋ p000zrxh0   0o` 0oꃶ-h0  \»Xh0  QʻM-pKh0   0 po 0 o@vTi==$eh=L9Z; 0-LPG@X0h -L MQ@P`\ 0 \8 0*E @PiF=qh -X0L \<1  %( 00 0<=Ti --H0L Q 1(   00 0 =Ti -L M줟@+@K0 0 P + ["2S& S (00(0( 0S:"2`S0 S0 $(,<4<#: *0K寧0S0000 ڦ+ ["2S S( 0S:"2S S0 $(,<4<#:*K) K)0KP 0 $(,:0# # #8 0)[ 048!,!$ <0# #$# 00S 52 R 2pW @T Vo 0Sg @TpWd +[ i0, O\`?0@0c80 !<\ P!TP 8PtU"\@P P<?@1p@d Zp: T@P U \:,0 l oD ,{@0 SP,0 |D,0@k -L4M0!> ?P@Pe`!8P 'pmvmz0fk00 0#000c= h 0 "   b-p 0i0D  0#000c9` j 0 "   b* 0g{0| 0#0009  fk 0 "   - 0h0` 0#000c9p i 0 "   )`0j0  0#0009  g{ X0 "   , 0fk0 0#000=h 0 0| 0008pi 00 000=`j 00X 000c< g{ 00000: fk 0 0 000c9h 0 0 000c9pi 00, 000c=`j 00 000c9 g{ 000 00c= fk 0 0 000;h 0 0` 000c:pi 00 000;`j 00D 000c: g{ 00 000= fk 0 0 0008h 0 00 000c<pi 0' 0#00c<`j0&,  0#00= g{0(0#00c: fk0)X 0#00;h 0*0#00c:pi 0' 0#0 0=`j0&|P 0#00c9 g{0(0#0 0c= fk0)0#00c<h 0*` 0#009pi 0'P 0#00c=`j0&0 0#0 0= g{0(0#008 fk0) 0#009h 0*DP0#00:pt 4i 0'P 0#0 0 lPnpP  xlP : `j    -/LeM0p @ lK,0 =p0l p `b?!0@?PP@ ei7@Pn }7?0S:@P?0S: -Lp M0`,0 @4K  b!2@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,\=Th[;9 [; -@LMT $ 7@(2 0 餞9G-(M$$ $0 ```( 5j# "< "0  0#   D 0AiP i;,  0 0  ^   `00` 0 0Q%j3 0# Ƞa,0# ,e). @ @$ 0Q." p  aƠi! " 0 @ iˠ "! 00`@P?Q  ` $0 ` `@`P@` P0` 0$` 0  @P(Ѝ褝9 -RLMp+ >?A @` R,: (, /6,!P`(` pl?W `\ @pG0@?W@W( 60@(60@ -PLM, pX 0 @0K- M >}. Np >.~~΍.1@QS@@`aq  ␀!N01`$P~`Pa.(LQxh ,00)&$a9%G%ᨀ.,Qq匀円(nx%Th0vP.#^PLl G )ጫ7᎛ '(P!`"p`p`P , 0 0Ll\$1l(C|@厏 ='pp*C(`~P%`&`P`Pa0#@$^.T= }` 0`lppPCq(,ΠHD@l| 0q<`^ 0@N0lQpCpa`3` P``` P%00`&! "= p P `.M.  .0@~>. N~ ~0@TO^t^0@10  a0@N~ Q0@^  0@00 ^ߍĞ9 -RLM`pG @>0A! c RX:P 2!0@ R: @0S*H0P@ P p`i VHP  0@ `FRp @0 S*@0 VVP Q2!0@ R:@0S*H0P@ P72!0@ R:@0S*H0P@  -@LM, 0 0@K 408@_`pP`4%$\'&dts?s_`  0 @ #Ƞ8!(0p$HP``,4H[0@UP` !4%lT"$ K?K_`@8`p0!#^8'$Hxa ) ,0 p\P0\,@PPP~I-,p00@ ,oA,0l P8- Ppl3-, PP,`pPP+-0P0 -PL M0 , / ^0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o, -@LMT@ , ;1P,H0@ D9 -PL M0 , / 0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o,A-0PpP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0$ 0# 00#@$$Ǡ$ $,1t h!̒0( 0# 00#P%%Ǡ% %,1t h!̒0, 0# 00#@$$Ǡ$ $,1t h!̒00 0# 00#P%%Ǡ% %,1t h!̒04 0# 00#@$$Ǡ$ $,1t h!̒08 0# 00#P%%Ǡ% %,1t h!̒0< 0# 00#@$$Ǡ$ $,1d Ȟ0 0#@D 00#@$P%0A-D0P@pP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0< 0# 00#P%%Ǡ% %,1t h!̒08 0# 00#@$$Ǡ$ $,1t h!̒04 0# 00#P%%Ǡ% %,1t h!̒00 0# 00#@$$Ǡ$ $,1t h!̒0, 0# 00#P%%Ǡ% %,1t h!̒0( 0# 00#@$$Ǡ$ $,1t h!̒0$ 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1d Ȟ0 0# 00#@$P%0 v.ġ9H0@-@P!0\#0 0(S"Ƞ0 -L0 M( @KP"h0dp 0 8#x "W 0@2K,0 (0 p,KL,0 0("x(0W0p@d;08 (#H,0T108#xW -LM((KpPj@"h8  8 08 #8 "S80 02K40 00 80 4pK z400# 40 s0 0#080 40(0"(8 R00  8 80@ U400# 40 N0 0#008 0#H40T18 08#8S80  p-LMH`P&$H ph; (-"xPUL`@:08#XU@: (-"xPUL`@:08#XU@: -pL MW@)*0K0 8(<, 4$P`  0P `b0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@)*0K0 8(<, 4$P`  0P `g0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@2*0K0 0#0P0 8(<, 4$P`  0P `0P,`p%%<%(& &Ƞ&W0 P`@: -CL0 MX4 @CpC0K20K0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`0 0#0QHXpG@D0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`40 0#0QG-08@ <4@ `|Pe%L%ȠE q%0E吕aP@8 < 4f `D0`&! 0cqS%,,E%̠ 1%E0n 00#H*j apQ% 1%Ƞ % 0 0#0a L`& apQD% 1%ȠxxD % 0#0l0P* apQ,% 1%Ƞ  % 0n 00#T`&f apQC% 1%ȠC % 0 0#0aX* apQ% 1%Ƞt % 0#0l0\`& apQ,C% 1%Ƞ  C % 0n 00# `*j apQ% 1%Ƞ % 0 0#0a$d`& apQB% 1%ȠttB % 0#0l0(h* apQ(% 1%Ƞ % 0n 00#,l`&f apQA% %Ƞ %40A1!c \p*R0 p0 0crSl% 1%``A%$ ! 0#0`04t `&! bqR%1% %$ !0l00#8x *j bqR%@%%$1  0!0#0b|< `& arQ%1%h%$  0#!0`0**<*(*& &Ƞ&`0  9 9 9 9G-0@P`p8 Ƞ<̌ W4ČP`pሕՈU< |0 0crCpş$ 1$(dT $L!0#0l08x P%e bqBş$1$$$  0!0#0b4t `&! bqBğ$1$$$ 0l!00#0p P% bqBlğ$1$`$$  0#!0`0`&, l0 f 0crCğ$ 1$ $$ ! 00#0b(h P%! bqBß$1$$$ !0l00#$d `& bqBpß$1$d$$ ! 0#0`0 ` P%e bqBß$1$$$ ! 00#0b\ `&! bqBŸ$1$$$ !0l00#X P% bqBtŸ$1$h$$ ! 0#0`0T `&f bqB Ÿ$1$$$ ! 00#0bP P%! bqB$1$$$ !0l00# L `& bqBx$1$l$$ ! 0#0`0H P%e bqB$$1$$$ ! 00#0bD `&! bqB$1$$$ !0l00#@ P% arA|$1$p$$ ! 0#0`0`&&,&8&% %Ƞ% P0` 9 9 9 9G- R8M0 00 1 S`@Pp0 q 1ѷ< 1 R Ե@ 18 1 P յP 14 1 ^ ֵ` 10 1Z0 S$ Y N,,,,P,,,,P,,,,,000PTGTg#Ġ#, #<,!q 1,A.-Q0#Ga. "  "P0# "0# A !04 f"Ȇ",(1&)V0# !0#0#05 41*+|f !0#0#0# 0 Y 'H,,,,4,,,,,,,,,  F 10# 1Pe  0腟0#0" 1ş " '0 !! Z ` 1 !0 1 00 0Zj( 0 1 1 1Z8Ѝ   10#% 1  0E0#0 1  " 0T!" `弄 1'0# 1  0D0#0 1  " 0 `` 1 0#P 1  0@D0#0 1  " 0( (4)@S#,8,̠ a!ßC04p!A!P GPe 0=UUUU= 9P -L M@|q@*) *))* )**)333 *))* )*`)0PK@ဠ*) 0 , V   0,0 )*))$* )*x*!)*))(* )*T*"))0)$) ), **$ **, UUUU3333 -L MQ00 Sp`9 op4 0\ * @ 0 R,0\@:w`VY w 0!(K₂p 0 P` ,00 @000440 V Z  01 R Qw 0!"0P pQV== -p0LS`P, 0@S$*1B 0S0C000S 0 0S #== -LM0͎A0SM 0PUla0S00S5 PU0qU(U"l WP` @!"I † 0l㌐ 0 `d ` \  0 000 l $,`0P0  == -0LMpQ PP1P#U@``0SM1 0!01Qt 00== -`LVP p1p#W@P0S!10 !0 1\ 0@000  00@== -@LP0p T*` R 0ES0  0SᾍU  00 0 SQUQ ᨍ0BPU 00  P== -PL㳍 0S,t`tp@,*d0 "0000,0 R40Pq0Pi==== 0-@Lㅍ0HT0 TR8PT@R$00@J= == P0-LP P0S0 P *0@0) 0S& P:0P   0@ P000 00S 01t  ==4= -PLMP (0S$Q X\0041` pV)*1 00C0 090S  0@ /00P p$4 R 00040S $,K HP0@K#00== P0-L@ 㯌$PQ 40,$0D:$Q>:0hw0UiUi -LM`㔌Pp@T&  9PP 4`Fv 8P`F@8 $0v40$@MICPD4 0@740 8@700=UiUi8[;@[; -LMJdpd`P@0\T$@ \  ,00T T00==L[; -0L00( -LP@-0@ `R P0Tp0 t0 R0^@0S 0"t0 AQ0===4= -LM@ş8ş, $ ^P  6 "5^ 5^  ğ,0 S ,!P@ \4^ 4^P@  *0S,,,$,0,8,,,,,,@,H,,,,P,,,,,X,30 0StpK$PK$0S  0t0 p 0R0RR*hQ(DQ \3\#@P@d[DFA@04 S`(1d1 R D0D 0D  00D  qLD2"@P@d5DFA@04 S`ʐ1d1 R h0h0h00h  LhbA T]TS TN"T80BPP `Rh 00; ؊p  ?.!hP0|KS1 R  kP~p@L`K0D_ 0 0h0 0P0@00K\Lrh @T T  T  T T T  T  TT T T  0|xtpl0 hecic@fcX[;gchcP=hh)h*h4=+hx+h+hX,h,h8-h-h= =0=T=x==== -LM|4P\p@,P 0S \  cP 遍 $4@$X4$dPP 0L0 @0U0 Q00 0PSPP ` 0S 0$@S,@ 4<3  9P`, R  ,0 0,@0<  @010Y 0 S 0 000 00 000$  (0100 02(0 pP{ Yw 0 St 0,@  P`D0  ~ 0`0 00S ,@TD000[  0S*1 "0@ 0S P` @00㧉0@. zV `10S$0S!QQ U1 PL 00 !`0 P` `0 /0` `0 S Y 00 0 00 0c0S $3t p X l h \ ,==x h[; -8 0L0#Q ~00hwx -Ls - L0S`0S񟗈x,H,`,l,x,QR LXXpM 0 2 P0000P01  0 PQ6UڸP ~ `0L0A CP 0UVP`0\!P`0S`P 0^ !0 0AP  0UW 0@0PLP@PUZLJ P`S 0U  P`QRxQRuQRr,h[;- -LM$`P R0000 0 P0 @Pb@dDFA 02 SpT1b1 R0``00`$$Lhh)h -1L MQ@` +XaP R0p0I 00$K( KwP`$0 $ 00$0$ $p( $ (00(0$ ,00C,0$(0 ,C0 @P@dDFA 02 Sl1b1 R0pp00p᷇L% Lpdc`*h=hh)h PP 0SP R R RQ000000000 0 00  -LM0K0@鐇`P0LSp0 0# ]8W1  ^a0K4 $>A <   $ (P @0  p,h| -LM0`C$0S㼑G<0S @PG@dDFA@04 Spx1d1 R0``00` Lv@@dP%DFA@04 Spʄ1dA R<0 <000<0 <<LRꔠ匐@@dPDFA@04 Spʄ1dXA R$0 $000$0 $ᾆ$L,hh)h -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `daVPZ9W9p[;[;[;[; -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `d*VP#9 9[;[;\;,\;Q@-@  P 0 0RQJ PQ00P00S 0@1  -LMR`@p/Q,P  U$010^c^PT UP 0  nT 1@bPT8 8H\;`\;\;\; -LDM,ȟh h`, d Pl Pp@Zd l`  0p  <K d 0Z d <0K 1 0 l `q0V  0P 3 "R @+ RTd 00 R0 0#0Qh`0l 0`0  `eV00 Q030"S@VL5 ,0S <,)< KY\K<K h0Q0 0#0QV 4 R  0~ 0 , K h3h#p@PM@dDFA 02 S01b1 R0``00` W 00p 0 0WV40SM ,0  }W*4 `R> 0gCPQ0!0@Q0a005:c0PQ0C00",@0("@cPDFA@04 S`1d1 R ,0, 0,  00,  ὂl,* g,0  Egl!,@0d!@cP͂DFA@04 S`41d1 R ,0, 0,  00,  ጂl,ln, KL 0f?l H`.| @T Tl  Td  T T TL  TD  T T4 T, T*hhh)h+hx+h+hX,h,h8-h-h -QPLMPe u R̥ ĥ0X* 1S X:0S 0= 0X9 0UaA `C @R  @5 # P t 00CS,<,,,,,,,,,,,,,,, ,,(,0,8,@,D ?. !P0@ 0 P0U`(DD@DP 060#0 ?.P ?.&"(  ?.!@ b("(L0/>P 0j0#0 ?.P0 ?.&"(  ?.!@ b("(0/>P 0\0#0 ?.P0pm7@r~1 0 ?.! 0 ?.&"( 0\qXATql @0P  q 10A q(q&q$Al 00l P`d@ C P@0`  !l@0 S00v==*h== =0=T==8=x=$=@===x=== ==\=x=== - 2LM P0S 1SPC ̑` !00CS,,,,,,,,,,,,,,(,,,(,,(,,,,,,,,0 S%D1P@嚀@dDFA 02 Sp1b1 R0``00`\0aVl@PP  l lP @PP  l==hh)h -PLMPe $QY 0SV 1p WW*l0!R000`Q 0AT; 0 S @T4 0ST/ 00CS*,,,,,,,,,,, ,,,,, ,,,,,  0P4`V 0 eP0 000 == 0-L`M@0lPKSX0 th h0 h d ` \ X T P L H D 8 4 @  0 , $ t0Y2=|,,L,\; 0 0 -@Lpp`P0l S000 e 0S,+h -L` 0@ 0@bPjDFA 02p Sbl` 0 S0 0 000 (00hh)h -ML0 G -ML,0: -@LP$p`0l S00 0 ~U q0S j0ScPx+h -L`1 0@ 0@bP~DFA 02p Sbl` 0 S0 0 000 ~00hh)h  5 -LM@p~\`P0l S000 ~0 ("( QX,hH -L` 0@ 0@bP~DFA 02p Sbld 0 S0 0 000 L~00Hhh)h  6 -LM@pW~X`P0l S000 $~  @+h -L`w 0@ 0@bP/~DFA 02p Sbl` 0 S0 0 000 }00Zhh)h   -@Lp}T`P0l S00(0 }(/ _*h -LM 們倡p`1S,` V( 0@@cP}DFA 02 S`ʂ1bQ R0 0000 }00l0 A@bP}DFA 02 Sblp 0 S00!!  0  0! ^} 0hh)h  -LM@po}t`P0l S00z0 <}z!0Sx+h -zL`0@ 0@bP@}DFA 02p Sbl` 0 S0 0 000 |00khh)h -LM@  @hN p-LM`0@0  0A00 Q,PK 0M0 0#0Q 0S ph]; -RLMPḀ`0p!|0@S0 0Al0 |A @! Br0\0C  d 00ax+h -AL`0@ 0@bP|DFA 02p Sbl` 0 S0 0 000 ]|00hh)h (-"(Lw (-"(L (-"(Ls (-"(L (-"(L (-"(LQ0 0  -LMXK@p 00  `u0K`V Z8(ZX@ 80 4 0 Tp  WW W(W80B@@|0PS0 00 {0S0p 0 C 0ZL0 H  8 P70QZ P.T0SH H RXR$ WuWk Wf'W80B@@{0`S E 000P {E 0S L0 E0 00E P pHp 0R0- ` F0 @&@cP{DFA 02p SblƟ 0 S0FF  00 0 F 0 F  `o{F 0SZ S 0F l 1E &@W W% W% W W W% W% WW%W%W}D Q Q Q\%Q80B@@Q{0PS000  { 0S| Z 0`00 0SE 0q0G XI0G 0G 0 00G @$0P@c{DFA 02 S)ʂ1b\ RpGpG 0 00 01C 0C  z0K!b`↠K0!R 0 0pG l2 G   G000t @0l#@cPzDFA 02 Sʂ1b< RpGpG 0 00 01C 0C zpG l k lW Z"80B@QI  R"80B QAt"80B Q<  R  RP"80B Q2@"80B Q- R$"80BQ%"80BQ z!0 "el  L!@W= W! W8x! W5 W W`! W.X! W+WH!W&@!W#A T,T" T T80BPP5z0`S0 00 z0Sb 0@ 0 l @T Tx  Tp  T T TX  TP  TT@ T8 T--*hH=hh)h+hx+h+hX,h,h8-h-hL=l l6 -LMPp`@0@@T@000` 0@0T000@-@T`pP*000  000000 !@T:Q0@-P @00 PU@  0 000p@-^@P%*`0 13R0   "7! 4<4 4! >! b1! `` ^:p p-L M``0@P$K 0 Z0$ $0K  00 Q #ph^;  0 00 -LM`, p40 8p 0040 \   R<  8`?`  -<0`O8p+, !0d d @ 00S@T\4,D 0,PM80`<4/S8p84S0 0\>,8 (0 40,P,` 0 R h00h0 ,p00`P@0,p000 ,0+  < 8`x@< l0+`f,800S 0Sw00<0 +-^;,^;@^; -L,M ^0 4 8 <0 , D 0L P@  ?@0` j @-<0`O+ ,!0d  @ 00S@T@0 0 R00044 11(pY& ^ @0400,@K /@}P@,0<<< aT00@+P@@  OH  0<0dP`DP : 0 0 R h00h0 0D00 @_00 0P00 @d0,3X @_RX00S x* < ,00<00, <0H.,0 0^`@8<4 /S84S8@ @ R R<@T=_0 ,!#@  4S4S0@0|ŸH8 0 0P`E0> /0<0 R20 0 R h04h0 0Ġ /0 0Q00 @ d0, 3X O,0<,00<00, <H,0 0Q`@00T 0bR/\  L @00@0L  V*+@,P D\0  0]*)~0,0 @006+F@<@=@D_0d ,0!@  4St4Sp:0l00@0 08+0$Sh^;+-^;,^;@^;^;^;^;^; -LM  00 $5S% `dp X0P00C 0 O@_0 K a0X0A0 ?XY X`K0K "PK0K "P0S `0( 0 i0pS 0!0 Sv@TŸ 0PZ pW!` 0W `p80 W`0(0Y5 a0S. }0T0S# }p W`d 1X000 a d03!OX p80 W`||a000Q 0 T0(0Y }} 00@`K/P @zP0H00 x@A 00K/PzP0 @D`HW |;1-P=0 RT= -L M000 00 Pp 0, S j V@ 0,T@# V H#0S 0C0Ÿ 0P 0  T 0P@q0p` 0S  0 )v( 0Sh0 0S 0Sh0Po0`0 `) 0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S P 0S``l0P0S 0Sl0P0s  0S0l0P0ll00Sl0  ,0`@ 0PM(D)H#0S0__@L 4-_;0_;H_;h_;,^;x_; -L$M ,;@ @ @_0 ?p`0 0` ?>p`0 4` ~ 8 <0`P L (pL8/">C2"/P!@8H 0BPC'4?#@Q< 40C8$尤< L\D ,0  004, ` T@,P@1@#ZD P@1@0T@WL2H`"S 0 S0< SH3 R5@ PPL2H`"S 0 S0< SH3 RP@W L"00@ S@`PPL#00 SPL霜,@0PpL0 PL"‘\00`S04`S ࠡPP PL ‘\00@S04`S ࠡPP  - PL\`@pUP 1PDt0 0ZP8 0# T 1P.B@ N`,@1?` ?}VL3"0 S\\L#0 S\8 0…$`80 -LMPp  P,P ,@`VPUPa 0 P` ,@V,0`VP 0 PP`,0UPV -L$M P@L`8  T 0cSP 8 \q0 B0C0 R4 0 0 !d0 @0,@K/@QxP@,"H`Y<  3S \z1 0O ~0 T X \@ <0S00 0?`0 000S2@U \8040`WD< 00R 0?`0 000S2 \@\X L!400C40 g!40040T0Xà\녲!0 0 !Y0`00 0! $00C$0@0 80L\ 00C 000,y ,,y^U D= -LM PL 4 `P0 00V 0 0 !d0 0/,@K@wPk,"Hp0S 3S yQ8 00V "0O00V T08 VZ ` !40 S`VV? 0 0P5 ^A0 S0`0 002 ^0$0˅0j$0L 0QO40 00j 0 40Z0C j40!400400,哉$x,80S,Ay80 ,=f0 8 Z@00 S0`0 00208 ^$0j0˅$0L0O4 00 0 40040,x0 ,U D= -L MH@2@Q`0o`T p P0 0Pq (@80 P(e`@ZD  0l  B  0@L# "00C0\h1Q7 d@P, @1 RP20 0/ 0 R@P0 0` 00뀐00C0 0,RT000T00C000 0哢 P%0 0, X000800c@` Z"oP U T -LM0 `Pp 1S0 0 !0d0 0/,@K@(vP(,@!H0S 3S 4xh$% 0WP0SPU 0PG0UC0SPEUP3 Q,@UʼPT P@ l?>pP1 HX 0   R 0 S\\0 b0O`0 sP#U*( @,0 P80PU,zw8``0P#U D=_; -LM PpL@4 `P00 0 0 !d0 @0/,@K@uP, ,儒H Z8  3 S w 0S L2 V0O@ @ Z\0!00?0`0S1= 018 a^ Ϡ\0.aA00/ P  1@R\0/ `PN P1 Z\0`000?0a0`! P`E$"0Z\000/ 0 10  B  0@40L#0 00C Q0 ,v0g Z ?   0@L#2 020 0 $U D=`;_;_;`; -L4@408 `0/0 0 S2@00 @!>408 5^4@`00 0 1X8 048$0[ 0$0PL 0O<b 0 0 0@0P@ H5R40`0@0P08?.a 0S1 bPT  0 44 `RYA4`0  P00,pu4 8$0 4@0a$08LÚ0PO 0 0n 040F4    0@L# 000\4Q d@P@8 3 RPŚ2X 0/ X pR@0@P0 0` X@p0004<3 8R  0T0004T00P48 X X0000 0 \"r` 2@X44`0  P 4d2 R4`0   4040    0@L#<@"000\1QI dP @ ?41 8 RP2X 0K XD0 Q6   ? PK0OP@K h@p`_ ᖄPK 镖,)`P@K FP,% Xp`@_ ,?!ED倐D D00040 8R4 0Q4@T00UPŚ48 X X00000 0!((`;X`;p`;`;,^;U D=T`;`;`; -LM Pp,0 W*0 0 !d0 0,@K/@UrP@, ,!H`X4  3S _tx1 0O {L14AQ\000?00p S28 3 18X\000 /0100 W 0p5 p0@L#00 "0 Q00 ,s ? B L0S@ " B "0< !=S0 U D=`;a;La; -RLM`, p{ @?Q1 Q`000.,0Ae8崁/.  b  B020!vPp1 @R, `08P/.  b  B020!]P5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` XO, 0@ 8,0, @/>QU \= 909pa;a;a;a;G-M$P0il0h PQ00`  110 @$?p > 1^ࠡD T! 0  S \ pd@H? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1W10l1$5S!0SL\ P3Ѝ -LM P@P 0 ;00 _85 0 00 0 @ R@  PU00\pP@ ` VV V 0 4R@_ 0S:0S:0 @T00 T00SF  Rʰp0(`VP@Pd P@P  0S:0S: 0S @ P00/PgpP PxrV> 8%0@@0L 0`@V PU 00 /PCpP P0<@ (0  P0@ xK P`@ PP 0x0(    F 0S:<0S9*@5L 0`(0 @ xK 0PP# \ 00/PPr 00V<` 0d x0@1X O 0H<Y 0@P0`|0Kd KPP | 0` B| 1X`t KV A   pd G 00/@K@oPPR`G|0H Qa V p0S @00xK  PP6x`` d G 00/PPr d0X3O0 00 H<0dK@P @pPP ?Q00Sa 0 B  p"qqq tKPR0s @0t@K 0 ` T *0 0 /h00T`:Q00 V 0 0 ߡLD 0 jh00dh0   R0qd0G 00/@K@oP @`0KH spp 0 T q  1VD@P`K0! 0 @ 00 xK PPz x`\` @00/PPq d03XO0 0 P0`@K!a 'pLtpI0<H%0@Pp \>  @00/@K@nPP60 0)P00/q d0X3O 0 ]@ 00xK  wPPx`Xt` 00/PP_q d0X3O pK H<0@PoPP` 01X` X0 0  (0 &xK00 @  @PPXP [@@000x1( P U  o pS>00K L0 R-PK ?@K 00 KKK K0P00@Z0S:0Q R똄ia;a;- M Ѝ -LM`< Tp$ 80  000    0 08 00R00S 0K  0 R 0V 000O 0 R V0D  0 R 0W( 000O 0 R} W0  @ \0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RG `p 00 0 0$@x`0d CB_00 4@K@:mP@@0Qxo40 H 8P < T0$ @ 4n4n4/o,5Sʰ0 70W0   W 0000qV0]V 0000NT(b; -LNKgMTQ`U@|a &8 0BRS p 0S XQ0S R PP >K ᶙp`,0<4 DP 0 pSlq  0~K0``T\OX!QKlQTa45S:05XqS*NK P aS?K P0` 0PP 0 R 0^K000nK h Bq Lm000  0Lfn0K0K IlX850p1  0 R 0~K0l^K000P `P~K@ 00@.K@`Klq8Kt 0KPSo`t0尀 p0UOl0 t $x! t!t1 aR00X0pPK@/0Skt!L Rt! PC@KBZ 0S1( ? 0p0 \aQ  `!P 0S!0(0 0p0p`P U pհ000  0PRoK p 0S㰀1( ? 0p0 0 S0p (0P UP@K p 0S㰀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0^K000TaV8+0  XK@ 0 l`PtS/ PKt0 p0QO0@H K㰀t 0S t.Ka00h1dA0e@K0 RXtQt Z\!@ 0T PQ 0SG 1p0.Kh1dA0PE\0O T`S\Q5 0S `a.K1p0h1dA0( \QUlQ0 0S ^K000\aVAlQ0QT @aT pհlq^KT0`Q3/nK 0*| p尀Č| 0S ^K000 0 R |qg /0 00| 0) |ah00fh0K0`q WNKlP  p 0 S# 0S:0S*la LS>R-`0 .K a0000Q가 0S:0 K0x`a VkNKlP  0S" 0S:[0SX*la LS>R-`0 .K a00E00Q> 0S:0 6`!^K1( 0O' 0S!0(0 1p0p` U pl P01R/1 0S:0S :l0@>K 0S|a pdఀ|a lKS>0 lAL R-NK ?  K00@가 0S:0 1( >K`aSlQ~Kd @FP@tQ@K  0 K@ (|P1 qPpq R| P py 0 R 0 00l!NK00 |Qx p尀 P|Q b0t 1X t^K1X a0OOXqW0K0 ta0R00X0  p尀0^K000=l>KP @@A NKPp` S?K 0P0 PP 0 RX 0^K000Wl0@ &80S L1pqHgL1<@ LjLIk VlP j p 0 S# 0S:0S*l LS>R-`0 .K a00@00Q@가 0S:0 0.K00.K0MT 0( S/& 0S :0S:(0Sh0S 0S 0(pS   0 R 0 0f00` 0S:0 0TaS鰀Xq0S0TS똄iDb; -L4M0 L P 4 80 \P@ D t0@D@TD 8Y D0 0@p40/0DH@ k< 00 m3 ,00,0<0 <80&Q0 <0OX i<gmPP8 <0rH/ 0@ TT Tl#T80BPPc`Q@ 00 ec<0 H@3t0@T !t0@TT0$ @<iPPP @t D0@B4 T0cpa@DVVD Tp8QPDdaV1@P( L2L"@P@dLcDFA 02 S`1b1 R0@ @ @00 cL  P@v<00:00jd 0,KC" 00%L,0PPPP L  0R0d ",K P0P0LP0 ,0PL LH00 /0L <iv @ V @TG T  TB  T? T Tp  T8h  T5TX T0P T-<i`0m똄i*hhh)h+hx+h+hX,h,h8-h-h\b; -LM P@0KP`0 K 80  P 0 6R/= 0S(:0S$:0`0000 /,@K @GgP@,08 <`R,854H 0 80, ,Ji LRS>-0ȟ00` 0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġ\= 909800CS|o-o-ho-o-ho-ho-ho-ho-0S0 #Q00 #LQ0 R0S800CS0 Q ? 0` Kp O4 `KP05S`KX R 0 0 $0005<<  \07PP LH,X F,HL|OPl{PH\009004h Wch 4 x8hhd9Tb;c;b;E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎G-HMO<@C@C80@?K4,$@( @@\ 0Q: `$ ?(Pp 0O/ 0 @? 0O@<0o 8@Ǐ 4ɯ`0 ,0 (0  $@ 0 =0 5\#HЍT-80\%R0$Ğ4 0T -L M$0Qp `< =P@ҍ X 00#002 PP@р H|  0y 0Q X@tL$0ԑ:$0  -$0L Ppԁ  uP@`@0 S@`V tP@P D 幏0 0 㻒@ 咓M -LM, \0d Po740@ 8@_<@_,!o`, ,0T0C0,Ě,0YZ  ,0Z ,BMl ,D   Tc; p-LM80@SP0 0l0S  Es`V p  0I0S0 s -LMq@@ -RP` =S=T8 K8 4P , 0@  s8` $0 #=0T00S<K /<0P`ST    00S  `ْ @ =SP`c  -`;c; -LM4 Q8  8 `V4,0K`ß q@Tp0"h0娿 Ps,0p,002 0P@ ,DsT `;0 0 0$@"x.`0d CB_00 0@K@^P@ ,r0`8  |@x00 H 0`0xt1 4,0KP@A 0S@@l0P0S 0S1 P 0S@@l0P0S 0Sl0P0s ,0T $000\%0R ,08 0,5Sʰ 0p00t0 0S0l0P0궁l,r80080`8XilWi\g;=Vi,30pW _48_4P4 SHŐ 021HX%_40P040 D= p-L Mp@P0Td``  pH@`[< 80`@RZph PQf=lWic;d;Vi@-QM@ 00CS -$-4-D- P0 Ѝ@-@Ѝ $  ==T=P= -L4M0 8 04 H0 <  45R805 R8 P 08D0 ,0 \} 4H0 L L 0S404000@TPU}<0H P0 P0 T <885 0p T`b V `!@  ? SR`P &L  0SP 0S 0S4 $0 S$05 ,@K0 0@\D DQ&4 $0,@0pcWW `H@08 NPD ,^D8, 0SP4 D000^,0S,K0 0\ 0S0 T~ -L\M0 08  4 00PL 0UT0 p4@80S S d T8l  8 0l R0000  0Sx6d p6X 0S 0lS00S 0 Sl@ 0< S&4%R :05S:848 0P0R00S T 0l@0 S:0S* X 0S@ 0@ K0T0`0\0 0^P0 <l@P 8850  lX!RH PP0@P P 0Pl,KB0P8`Pkl0 Po 0 S 0S:0S* 0S l 0@ 04 R0000诈L 4凈, Z` @0P`<  P0  #Q 0S:0S:<@00e`HHX8 P`\0S<@H0 0Sf ,O]X00V0S8P0008PUlXP00S 0S 0 R? 0;080PX@T4y LZPV T0@0K@\0@8@l X b0P@88X0P\Q  0` 0;08 P1 R 0, $R0000 c,],\,0H Hr< S>0LR-pK`@K ? pK0 0@ @`K eI 0S:0> ?l  0S:0 0@K0 SR8  l ~TK 800l0 vd;=d; -LMp80S 0S U`lP@ 00300@TlP@ 0 1P0S+ U@Xl 0S!0sU ]PUl0`S YIU 0S00 00@ X T0S 0S x0S 00 00SP00300X003000aUYI\UlP` 0S[P  |00Sz $0w s 8d;hhDd; p-LMP`P@0$S@pVilWi -LM@h -L M@^ 0    Q -LLMTph h@` l T`@Pd   h04@l TXKU\PK  0P@\\ Q d@ 0(SE 0 1p0` 0S` 0S p WlXd  ,0 @PR 1h0 0S 1p p0R0S@00 1( ?R 1$ 0 1( 0 R 0 1000LS\0 @ 0`y V8 Z m[00h40/ E\00 J  H\`1@_000V00S Q dp$0W * l0^1 ,1 S 0FS\0 Z 4[d0( D@` 00dp$ W*l SH,!0 0Q d( #00X 600 l0 ,00,0]P@ Z/ [P0 1X@_nꘄi -LM00 T0, 01P<0 00 \b0 \8 D0 Dp@ L@  ɯRe <$0@' "p X Q@  g B@ 80SG@0l0`  c4 @ ,0bR 0 4 0 D0 , .@ 40 @ 8 S% <0D $@ PD 0 p0  0 0OW@ Rc",0'&4 Pe P 04P ,0 00SD8@ 0`0l0bc4  -,0 L 0T0 0 =HXiDXi@Xi-X0X  00P0\ P0^PHXiDXi -0LMxxpP@`0 0P 0T P0U  kP 阄iHXiDXi -hp@L `P壸0 0!R 0U R00 R 0@@0V HXiDXi0S R00  -LMP@`Q 0SN 0S 0S0 ,Q 0Sl 0T $0pP! 0 00 0 R0(p 0 p00 00000  0S 0-PL@^ 0P0k -LLM p\ 0&l  ` d  ,0 h \ 00X0 P8 T 0: S 0@` 7P@lp  T0$  00CS\ \\P@d 0RR<0 4 D0 @0 pQ 0 004 D0 Td0S1 4A^ / 0S 0Sc0S_`H ` 0SL 0@; DP \ 0\ @,P=,0K /00P@|`40S;;S48 @ ,0H @0S 2 R 4 R P  T0( R00000cCQD0Q 8 < 4 P T0( 0R  R 0L0 0L00 PRP ` \ 0HQ0㐠AH 0,Pid RRp0S 0S0d#70P00S\  \0` PP@+4P+ 0C R    0@$;D0P 0P ?0/;?00 T0+S  Th 喉060dQ 8 <P0QP 8 ;;S 8L@0a0W=\d;td;jhPi H0 S04 0000T (0 S000000 0S 0 S:0 S* c 0 RT0T0((    Q00Ŕ0000@000,Wld70Q00S0?00d R X d0R0P00S pQ\l ,0S# T0 K0P@ T R p0Sh 06000\00 V\  \Si\h ݈00 K60T0P@TQ p R h P0@6 0_ih ՄP0600` ;P@0S T0 K0P@ T \0R0  0;0h ᓈ06p0Sm 0` P@ ;;SL0`00S6 T0 K0P@ 0 ' `0^# 0Sp00^ 0 0 R00p  R hT\P Th F0600h\ 0 S:0 40S#@08 0r@0 @ D08 R08  00b4 <0  KP x%/; ;L@DK 0 `@僀P*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPP,P@@T0( R)0[*0[S""[0R0 0R@ R f@00T@ K0P@ @P T @Pe@..e;- -LM@ KP 0 0 0-@DP L@iP00 4 0 0 -( L0S 00*TQf 0-LMP@ KP  0S 0Sl0P0S eF0000 0- D0@L PP0s00\= p-LMP0 @B 0  P 0s 000Hp @_ 0S0( 0p00=e0@8@df@p\=0 0S00D d< X R  0S 000 p-L M0@ `Rp KK0 R= 0 00 0 R  00 0 O0 0 R  00 0( O\0P@ 0 0 R 0  00O0000 00 0 00 \  0@0 0 D= -LM`P@2 80SH-(-(-H-H-(-H-H-H-T0$ $PV 0Sh0d `0X 0S  0S 0pSt   0h  -LMp0P$K`0 R 0 00 0 R $00 $0 O\ 0 R $00 $0( O\@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST04 $  L 0S 00[D080T 00h/4[8$0\l0 00 $00\ $0\0@0  0 KKD= -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0$   0Sp00R 5P R 0Sd0X0 x3 R 0SD0D0d0X00H00D Q  0 R00#d#X R q T0$ } 0Pt0s4  00K R000080Sp mSf 40p0PT4,0S:00 S*(qI T0$ C  0S00p  P ḺP \0  0ᖀP(q00000(s00 000Pq T0$   0Bu E 00sT0$  S0s|0sgr 0Sd0X0?D 8#8S: 0Sd0X0#8#888d0X0  0S  d0X000d0X0+$6h -@P 0` R00p  LQp 2P,Q 80S  % 0 R00tP   0!:0 000000<  0  z O -L M`q@p  w 0 Sp00R PP   0St 0, ,0  0, S 0pShZR0 PP  00   0 R00tpp 0 R00p@@PP00 0PP( PPPa,0SZ000Z 0S 0;0, R 0S 0;00 0 0 R0, 0, t   0 R00pwP J00 o og 0Sp00Tc 0St00We 'P^W 0StppK 0Sp@@A4e;E p-LM080S 0 R00 d X R  0 R00 d X R `T aapa 0  0u` 㶡t 㱡 -$"LEM0`,0 8 Rpy T T0RpW  M|PcP1 RW 0Sd X 10S W  `T1 ,0S H,000000000 0P 0 0C000C00000v Iw DMOK A 0WP hHe; 0H1 HQ9 H1L 0RD0R `DH!0SH L 0S L10   R 0S 0R H!  0SH1  p00S@( HP$_L!_<_YD!000@!8zPD0 0C0 RD  00C0D!00008_0: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u g^KPpP1P 0S 0 0  p   0 R  0S00t000 Pp  Pp  0 P\ \2 ,0S ,0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000>uT1H 2 0Pp3TE|PpMOK 0TP 0EpW y  P10o0 0C000C00000000P?\T|  0S00t00t07h Aq HP- 0lQ0  PP>020 , B 00*  R0C 0,& 101,B(0Z"p @P;  $Y ,?B`;xf;f;f; -L M Pp``$c0V: ; , 6 $@K@?P$0$`H@3`0 S2  0,0 00D 00$A$A; f;`;`;`; -L M P`A \00\0SE(,6倢0 0 6,@K@?0S-,0(H`Ap Q ;  ' 0,&0 00 00 Q,& 10C1X0,GA< R,A; Y Wf;g;Hg; -RLp`$P@ $P`A0Qd 3P 0l1 P0PrL+P @P; ` `;dg;a;g; -0LM ; Q,^; -LM0   0 Q0p  0 Q0 Pʰ A0(PU /6xK>P`x00xA(0 q|K 0 P`  | p(0/006``A0x &|0X2Ox00x0<H7x0@`0Kd KP` 0` B 1XPtKU ` (  d H 6/xK>P`Qx`@K H0QQ U  @ 0 |K  08P`2 |PP d0H |0/06``aA 6X3O d0KH<@0@`?P`\@ 0Q x?x @xX@ t@KTpO:Q" +0\ ʌ0dKAP 6/PPAx 00: 00x2@0 @PW 04C0 00 0' 0QdE 6/x@K@=P`0Kx 0H xe?x? 6Tp:U=0! 0 _|K 0 P`0|P P00| p Q x6?/6```@ 6 3XO00<H#0@`xh?? 6/@K@=P`M0 6/@ 6X3O 0 |K  00P`|PXP tP 6/``]@0x &|0X2Ox pK H<x0@`x>P` `0| X 0X0 0 %a; -L M@^ 0    Q -LLMT@d ` d h T`@P儀ԡ 04Y@h pTXpKU\PK  0.P@}Q\ ) (!(0`1@  R`@0 P` V@h0S ,!$0(0Q ` 0 A1QXP\ p< U@o T4 X>00d 40 /?00 C  H\@Q0U0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pX>(0S0O@0`00$ `V*h SH,!0 0Q (003OX 0YpP0 ,00,0QAP@ l>/ #?Pꘄi@-0 : S l0@@0p-`P : S R0V@l0 u L0S d@0  dPpVu -LMPp@` R 0S 0S1ST0$ $$KP$  000 0 ooP 0S %Q 0 0 p -LM@TP$  0`K0" 00 T00 0 U00 \ 0@0D!0 000 00@(` 0@Dp,V0R$664@K @g;P@ 4{=000$@40 H:00 :70 3Y 4<4= D= -LMp`W k8 0BRSRD P6  K0 W 4V10FƑ& PK 0P    g g f<000 0%< 6P 0&r K 0P   Fg g0eH80<@ ,<@0Ɛ& CP@ @4 6#!B0 6(#1D `, 6< 4|K0 @ 4K1S01X40K!@TZ @ T 01@D T( 00 00K(< Y|K(< TK/Wl"0  S @ 6 #1 c< 6@34 a B8 00XPU+4K1S @TZ @ Tڰ0!(P@DU T  0\50#0`00000#0(06 @0K&4K"1KN4K1P  S0  0 0 X0V;: 5Q000 0T0(P0OTSU@0S (G @阄i -L,MH L 0 40 8 \@8 < @ p Pff&1@P U@ 4X@0 0/<00d ]D` 3 ,00,00 <80&Q0 0OX rm p>P@4H\-8F TT TX#T80BPP4 `R< 00 n48 &<@80&"!h! B9 :LP<@L 8@ 6#1PCU bpaPEVX@Up4 RP@oaV2< R) @2@"@<0@dPV4DFA 02 S`1b1 R0<<< 00 4H0L<〛00 :00 ;80&L0,K"0$PL@,0HL H  0R08&",K H @,0LT L H H0D 00H0 㥚< [ @TL T  TG  TD T Tp  T=h  T:TX T5P T2 :0P0{똄i*hhh)h+hx+h+hX,h,h8-h-hg; 0-@PLB/j  0000 劾000000 -LUM0 ,0 08`1 Q`0p h 0l t &`1 B@00PT`UK@e TW?KT1 @ P XA DA T T,#T80BPPj3pP0`0 :30S   0UK \a jjPd -D1P0c0Vx1 $*@TMKPd  ~`!>K0\ Pd l1ğS t@t Pl1 xU:h!1!@P3@dDFA 02 Sp;1b1 R0``00`20@{h!P0S:`!0S:PP R d1Spt0a0 d1 ,0S ,0) 0 $t  ~l 0t!p! i t`^ @TO Tt  TJl  TG T TT  T@L  T=T< T84 T5h*hhh)hg;+hx+h+hX,h,h8-h-h -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `\ih@h0@ PP<0 X@ \ h x  4T0$  00CS4` x<PPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 4A0S*p@L@ pP t t0 BOK|  @K þ KWP@`Q0 0R@`pd0S0@ 0Pp@d ` pཾ0V`0MKS >K>Kp @Pl!ᬾdg0P0@00S h0`P/VUh1 0e@ J H F D B @ > A?(K <hh;h;i; -L M@0K RK/P 0zg000Kb0K/P)000eg000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C S>.$>.L>.,>.L>.4>.L>.<>.L>.D>.L>.T>.00$/g0000000000 0  -L80 0>d0S,0 0S005050d0,T0$ 0008 PP eYiPXi\g;YiYiYiLXiD= p-LM`0\0 \@@TP (0&\Fp0  KP @p00 R Qd 0R >0F0pp 0000 d00- -LMpP ;pp@=-`+H)U 9,+p -L MP, 6Y pƕ ^0`/0-&,@0H,0S  , 6pV0Y0X00S q+ -0#LRL R0SR T0 S5S L`0 Qd0 Sj;4j;- 0\= p-LMPt0!` 0 wP@ 000Hq0(=08@>@p\=0   0 0S  -LM      A -L Mp0P(K`߰0\ 00 (00\ (0\0@0 H!0 0000@ 0:#:0 10 00 (0H00 ,( 0 40 0 <8 0  D  0100D0 d0@080S; ST04 $  L0T@$K48 8$0D= -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s" T0$  0R PM 000 0D0 100 0 0000D Q 0 0  qk T0$ T 0P"0sX 80SS PSI 0pUP(q; T0$ 5 0R ḔP \0 0ZP (q T0$  00000(s00 000Pq T0$  000sT0$  S0s0s -@P0 LRp` cP$ R 80S   8P    0:0000   <0 0   TO -Pq@p@`0  v`SL $P  QR0`00R@ 0S 0;0Q 0S 0;0TV P -@L80SpP` 0 00   U ;;; Pp0! B! -P p80LS`P T T0RGV  4WP:@1!R/ 00' !000 0P 0! B!=V  Z; P ZZZZZ;X; \ T0R0 0"0   P X VPD L 0T0 8!R 00T0 0 0d0  X nZ0: S ";H0 T P S0LP0 0L! !L L0 0Ph 0 DXhX DAZT` 0\Q ` R  R XEP RH: TLPA0 H HK o7P6H0P ST  0P0 P R P T0RL0R \P0L 0R T 0  . 0 R* T0R& P0S! P0S:T@:YL000X DUP L 0! B!L0Do:D:P0 0: S YTL P` R00 S T0! B!T I:P0Y 10C1 P@ 10C10 P 0P 000H,:00 0 0y DK  6DPY8: pL@P 0PT0 YTQ  :P RD:`Q00 S ?PP 0! B!P0P@000T 1@@K0C1T0    0 0 D 0SP.0[S L d#B"[X3R`  04  0 D 0S -T P `P P0!RBY ,4T0L 0R` R00 S T0P2!R !T000P0 PL P? ` R00 S T@0! B! 0eDX X0 =WH0P0X00S*X"0S TL Q 0 0 0 X DXTL 0\ 00 .RdDX X 0WX tX80S /X 9H9 "9D 900 0 0P 0DK 0 5 D W\j;e;e;|j;j;j;..j; -L+ -(0AL0$1@TPop 0S @TP \f0@S000@`p@ ㌢0S p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000 9 C[il;m; -LM @R)(0 Z$$ aV p@P0S@PUZ0`V$ Zc~|o@p00Cp0@T  P@ (08 ,=0  !!( 0 (  !!-ᙟ 8IP8012\n;dn; p-LM@`Pr 0!6V00o-0  @T  p - LKPh= -d0L@pT` W PU,0@RTMQf -L@@\p`#(^$PP 1Q  Q R \P^Z0P P U 0!R00R0SP UP 0-L MP@0K K/@@ @ @@P0  S -=0 , !( I(, !?'0 000QfQf -LMtŸŒ p, WP@` L2W D2W UV   ,0p} @ PjVqPU 0ZV PUAQ@ R0`0D PU 0Z PU1 00PP 0PP0HS 0  0$0`$U $1$!@P@dDFA 02 S1b1 R0``00`@z(y`U  0 00 000#004 0㔜Te&&Qf*h=hh)hpn;000 -L`\ 04 r R$0$0$0  !0 @P@dDFA 02 Sph1b1 R0``00`hcy˝0L0|n;hh)hM0Ѝ -LMp4, 00 (Z,00 p14  b2 0 `P<0 0 ^8 p0#20# W00 S @:0Pp`WZ z04, 08|  < p& 08 0 UP Z z0404 Z zTen; 0-LMPC P0 4 U 0 00h{@ {40 U 0 M0{n; -L℃M000 0R`00 X3 <01001P@0T,0 40ST (0! !!(0 0(0!!000 Ru V Jz",0VVp 0儢00 z  0R0p00 0zp,0S (0L0!!( 0C ( !!( ,00S}%W V  0Hc P000 z :00*W V yr W V y000rV y ,  0(P@ 0V,0  y000 :0 nV y0H00o/c @>0 <41041.]iin;n;n; -LLMD R * < @ 0   DKP 0@8P0SD0Q  S 40R0 0  (0S  8[yDKX000( L Q00RP b0SYP @ $0  0l ` #6P`1`!0CS00Lp Q   0Ka0  H 00@P 0V0R00S0 P PUPP U R 0 0,0cp @_0 P0Q  0! 0 fp XP@ĐKT D0 KZP0 1@ TZ0(^00S  0S 0(R00S0 8 0@000̠ ,00 @0K40 b 000P0@ ĐK 0 0 0 S  \ @P`1sS@ TZD0SX aDK PP P04 0R0 p 0p  0S W 0SEl000 0R0  D08 0 Œ@0P 8Bxp h0R  . P #80xD0"0  ! (( !T@101P` 0' RVV8wV 8p h0R000 000#0  ! (A( !0@ 0 cH0{00C0x 0&P : #D@P 400C400P0 !( 0&(  !#`0!!0( &( !! , !(0 A0(0!!#8wE U P`  ` 004 ``@Tg 6 <01001V&1010 40 000 40S  jD00 8 Œ@0P (00  ! (C( !8+wp h0R|꼙Q "(00  ! (C( !8 wD0嚙! (0 0  ! ((, ! !6 (0 0```%P 6 "@0!!0( H ( !!L(00!!( 0 ( !! 00 &0 & V ;(00  !( ( !!8v # 000H +P` @| 0@@% Q00V@@T+ | (0! !0 , !( (, !8MvV[ 2Bp h0RU 000 Ԙp 10 1 !101!0 (00  !( ( !@ ~!0@ 0 cH0 ᡘ0 <410418u 0000 ,00 P0K0@0@4 0lp000P0 0 0K PP PN, 0(ݖH=n;n;n;in;n;o; o;L\h]i 8000u840 4S000 u0@( 40PS(T;(0(0  0 00 $ 0 , !( (, ! 0@ 0HcP T@8kuT0  x0 00040 D08 0Q 000 !( 0 (  !@0ĐK p 0DK PP*^ 1S0ST01O aP 40S(0! D0@| "000D0 00DR\8 00@T (040S00Sv`@ p8t8tY Q-Lp@`: 01PPJT: T    -pL@P`t ht -LM` KP@3 P3 T *$pK PJT: $0T: $0T*D0S d$0#&R :0R *0a !b(0 P aiaio; -LM0 P 0 pWP @`4  P 0$  cR 540 W(@ 0 @t 8t 00U W 0 t "tP 0  CtP000  s9 -P`p@N@RN^``LP@s 0@s=- ^$  0>0>0 S  $ -L MRP`0>0Sp1x#  n0X< `80  40,K<  P8   W00 P00S 0~p Wz3XP8@e,T@! L 8 Pd0` @000 宓0 rP0000,d0 00K H0 0P8 R 0 r=9 -LM1` 0 Pop@  @0s `@^ K0 n @`P `@@dP0pCQfd^ipi'=lo; -LM>\0ǠȠŇ@`P'0 ` p P`:P000U 0 0 (00 05P( PP o;o;p; -P`LMY'p  \P@ (0%Ơ  0!!( 0 ( !!@:P`YXX"X -PLM`@ * pKt :PdJT: 0 #Q:b 0QQc05$ 50P ."噻piai,p; -.L$M 80 0 8 0(0K#̌4 @# 40`P `@@PZ8` ,4\T \1,0  bp 0^`/ P  04q @T( 0!!( 0 ( !!40 S0 08 @:pj,0 0Vx,898 \0 h p0S &,0 0M,p=Pp;pi]i 0.  0; -L M0@p` P000 0 qP0000 . .$0K PP t0 $P Rq9 -L$M0(K!Ÿ@00 P0 p`@ PPl1, X004  c`p P P@0 ! (0 V 0!!( 0 ( !!4!0㚑XV00S,,4` `~@@@@T 0!!( 0 ( !!8 044@:ʌ`4 pH\0@0L Q &,4p  a0u>d^i'=\p;hp;itp; p-LM΁T00K! 0@`P `@7Ppd^i' -LMPN4A@Tp`0l,K, T0   \ 0,0d^i'p;0 -L`@P/T@@0p*<@ p-LM@P`*ph -`L0S 0 !,B$ R; 00S000@T `p`P 00@0 T0,  S(<@0hl^ie=^i^i8.0 kT.p; -LM⼀弐张p@T 0R 0【@ 0TP`P @TPPU  0P00~0S ^i^i^i=p; -LMPt`tp@0Td \U G]D 0S‘0 0C 0^i^i4;^i -LM@i  0@00h8^i^i -LM`pSTP0 S@00   0l@@+h 0-@PL0p4 0x P(,hPlPP n|PtP0p; -LM@p`0 P000| ʏ0 nP000(0K 0 (PSo9p00p0 -p 0 BRL`p 04 0 @P@dDFA 02b SpD 0 S0``00`hmhh)h -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P 0R4 $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P 0Z0PS 0h0 p-LMP@ `0QV php p-LM00PU* `Pp@T P10P1pw0T0pP  X0,P0 0tt? @ၔP `uX0 P L@TP80@$`ed^i]i,g=p;=_i`ip; -LM@T0<<hU((p  P1p@0CP1h$`i_id^i]i0T  $ 0D0 >-$0  CHL0"& -$0  CHL0"&  -HH!LM@  R0ԑ00đ00 R0102010001h]i=NN -L$M0 0 4 S@P` 0QT, K"P`>,0 $@0\A $0 S:1\7*Z`!>=10K0  0 @DP $00 >=1Q1^:40`, R ,00C,0,(0,|Z ``0K  0 0,0 @p` -L$M`4 :#:S$@>0. Q< "&0@ PD  H Y0 KeP 0D0 8 0@PL@  1 0<S-*$<0Q*0 S^ 0S[$04 <S1$ (0 $Q0V)0K*)K juVp:00L00 S  0<S:HY4@ DL V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )Kjp`uV:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (X 0WPU`pW >0~pW  0h:#:S 0Q0S:SQ::K q   `PS8 6 $0 0&P 0SR  R ,0( 0C,0  ,z{  0 ` 0`K ?P000$=P r ,0 0R,0 $ 80SS SPT P: QS@@S. 0   000  : 0K 0 &PH 10S     0@ |0 弸P80 J,0( 0C,0 : M,z VʥU]  R  /$0R+* A & -LM`P @75 0S2 *S"*`R 0T)@PbT >0N@T 0UT$p  00 V W( KP(0 $ @D PWX -LM` P  0RL ``R >0. RB 0V?X<:SV8:$@0p P000 x0 WP0000 0P (0K 0 (PX"X0 X9 -LM0S *"*R 0Q bQ >0Q 0\ $ 0@-@ *"*R  P b.P  P \ $@ -L *"*R 0Q& bQ >0Q 0\^ =/=/=/=/=/=/=/ 0 $$ 0 f$ 0 0-LM*"*R 0\.@b\ >0\$ 0T!0 H,&R$P 4d 6R:`0S*#0  0P 00]i -LM ʠ,ʠ\ 0R lR >0. R 0^ $ 0P  -0LS    $0` P P #  -L $ -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < YP@<R0Q6 `0 @000d"0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c8冞4?d^i^i = 0R^PA0 pW 0gS*@`0S:>0 N@ T *$PK0S J $T:嶨|DPh5*DD@10>0>0 0(=4g8gu;_ipi v;Dv; -LM␢0^@xRxŸ@0ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UTe 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0U =d^iaitv;v; 0-LP@HP@ T0 -LM@P\# ^/T%*p`V \ 0S\\ 1`1 @0 0X͛T 0@P<04m(彛]iv;v; =aiai w;Dw;w;w;w; -2L M0Z ! 0CZ pWpWad1Ό 00 `PP00 T Z !0Z00G Z, `Ph0dp3qPU,  Q 0 0 00   #&h:` !0 0h `01 P#&:h` P!UDF Z,b<0X ,00 oon =aid^i= U00R0S 0̠ W0U0V00S (0T 0 TV U0P0UA  V z 0!6 P0 U00R0S  0 0  0 0 -LMp0PU`% \ \ XJ (0C(0   0  !( ( !Ɵ10PU0  $@0!!( 0C ( !! ȟ縟0 !( 0 (  ! m(0  0   0!6 x000 `0 0$A0 0 0mn/^i -LM800Cf!  , b p 4Y00P#:0#USHPU@0Y0 0 0!!( 0 ( !!PU@Z 00 dP咏,6(0 @ Y00 S ?/0 !( 0 (  !0 !( 0@ (  !HPUih$P,@q/`q/`q/`q/`q/Hq/`q/`q/`q/`q/`q/`q/`q/`q/`q/`q/Pq/`q/`q/`q/`q/`q/Xq/`q/`q/`q/`q/`q/`q/`q/`q/`q/`q/`q/`q/hq/pq/ -L`XPX0L pQH@ Hl 0,5khKc0 Ad^iix; ]i=pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0]iVUUU p-0LM 0`PL 1 `@ 0j1 0V1`0 t @ ?CSD00D SD0\ ,00R0SWlꘄid^i]iy;^iVUUU ]i -ܐLMp 0`S' PS00U 008 0B6C0@``TP,0X@"l`0l$J j0^i]i ]i^i ; -LM pW     K W̠  pVl6@0@0S  \  R  Q 1 pW V 10 1 D0u(6 RcS 400C40   !!(0 6(0 !!(01001 PpURP%$10$1( ,şp00p0 1R0100T0@ 0S h p0S  4l h0R 0  !!( 0 (  !!\Tb0X00 \ P0S P0KU q 00 PPP X W \0KQ0  @|SX41 `041P0P@ 0 K0KPXPP`P Q Wp  (0H@0!!( 0 ( !!(  R 004   RM (0J@ F0K$ V  V0!!( 0 ( !!j08! W8!  (0  0a } th0K @0 u 0@0!6 X K P 0  !!( 0 (  !!@@ 7  . 0 !6&' 0P  0!6(0@@(H  D@01001,P(10(15,10,1]i -RLM101*@*@0T1A d0Sh5P1d0S@D 0 ^c@dlh0Pk 2@T YX `(  Z @ YX0S400C40 !!(0 6(0!!( pY 0P& Xm<1H0<1 0!6 P 60!!( 0 ( !!I& p0!!( 0 ( !!( Ip T00R00 S n8x,Pti101]]i^i^i^i -LM @00 8 u밡4 ( 0 S< * TP'*0%Q :c 01cQq*`, @(0Z U:<Q0 < R@0RD 0Sii4@<0S<0(0#40 0Q!0000 00C0(  $00C$00(000008, Q 8 , 0 0000 @@8 < ]iai^id^i -`LM Vj3PP >0^P%&@< k 0<S V# R 0SS:눒0 ( 0Sa 8 4 { PxL$&R:0Ra03, 5:| 0 &R:0R03:0 S @,< 10lp1Q01c1(  P8 0*R0#  R 8 Q, Q\ , 1`@AdAP(0#40!Q0!0000 00C0(  $00C$0, 0 (0```, 00 P,0P0S ,0 4 0 < R@0RD 0S<qh0H4 0]iaid^i^i -L3@T> aqPQ0000 0!!( 0(( !! , !(0 8(0!!00|00w0@r0$ 0R@0$0 D @T md^i]i$= -@0LM@T 0( T  嬐@8=y; p-LB MLP@  , `  0`\TP`PXL `0`0<La`Pa 0`xp\` 0`8$ a`($a! 1`<0!,148!t0dx |0htld0dp]i(y;@y;ty;y;y;z;Tz;z;z;z;{;X{;{;{;{;(|;`|;|;|;|;d^i }; 0- LM0PS0P 0PdP0P!\0PPPՁx@Tp 0@ \ PhP L0 P`0hN0~h^iPg]i e(};X};Lgai`};h};bip}; -LMx`Vp 0W- `V0pQ`00 0S 0  00 00 `0D4p H$ Q0Dd00d00S 0  00`V 0S0 @P|@dDFA 02 ST1b1 R000 >\BPg]ihh)h@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0Pg]i -X0LM\  0R \ @ TT000@dBPg p-d0ML` @P0 K@ @P0,d(4p姍Lg};-X0^ P ($\,40\DP ^Pg -EMLPM0,0 |$ pkC0S S KP@,P `V FK@0D @P4 L$ p t H P@dd00C@S񟗕t/̎/\/\//\/ /80S|0# @VC3 ,0S ,rpp,PP@ @ \D.A P\)A #&e00@d80S|00 0080S+  x\ ABK@$@0&aPP@ 80S \A\AKK@0 `KPP@ 0 K@\ p@PP@  RTy @uB~KpGpGG>K0C+`P@E iT1` iP@`0SHBKAG>KA0C+`P< 1` Y( PU! WpG 4 O#J6; 0q^P@An3$i^P`@+DTU WpG Y|@<0@d |4 h<=d#f};};8hl~;};Pg]i -L|Mܒ@0XpP 0 0SP@80S S @0X 00 Q%$ H2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !ᄍ0P C@\0PP@0 0R20X  !0H!000dh00h0$!T0,0 $4>0CFT0 0P`d廋0 P 0K0 P@rp KT$;, PP@dT0 4P$Lx8heD=};]i4kh};~;4~;P~;x~; p-LM0@( +($00`P P000p(0; (`P $$4RPU@80S# 0@ P 00 yt$h00bh0@CP iL0(,$0㋀0~\?pI@ 68h]iLg~; -L M @ 6@A錠$/ -L M@ 0@A錠$/ -LMXp$K4#&:@]P`! ($@Đ@b0O&#J86$;\ @ \?@P0Oi0 0+400 *P i Ί~; -L,M< @@ `d各D @D< 0RL 0 @_<00H@ 夛H 億 <L$@D? 8 Mc4K 8K,0KOP40s Z<Ld  ?b80P@f"pd`TKP@ 0K0 @Dl`,X0L 2Wp`0"H0V@0, x$ 0^P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8妈  e$0 0e#&Bt;p@-$0Q:0.a6?!1c"QPo*0 800 !F &V:Up -L K`P3T P >4K40[S2 Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P [P 0S \00\0u]FK K[PpQ|{L5T <5T5` (K``S P K0[ pS (K@K K 1 0 1\Ky[Pp 0P WY [\00CS\0H4T? !<4T 44T8 r 10aR001#0p 10bP001#0003T 3TU @lS1.WmUy @`S1 q8#0000q#0000O|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S 1 00SP 5#$0$  R 5R00%"48<#P g|1T @1D1^L1T\1T* 1VL1T T:@10SPW  0fn 1T3sze HaWu 0Q0 T 0Q0Q*00Q 0hliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i |;;Ri Ii Qi Si Ti D=i Gi Mi >i´;Ni0WiHPi Oi Ji(Ki -9LAMpWP0, ` 1 & 5 -0S S/cH0SVG Q@ HP`PP ,蜠K E 0[S -0S h@ 0 SR8 RV5 H0S |0SH|0[Sk q8(0000q(00 00 0PP  Ld00d 7P 0 0Y0  ǟ,0 S ,\pP0005S Y eP d0 SKQ5$#Ġ0Č$7K7K4x@Kl p0 lK0.KK0KtP P 0S0 0F0$ dKQ\K0HKd0KcKQ|Ɵ@K.44HKHK GK3K0P eP@  WP 80S0C80ž@T 80S0C80ŝ .KaPL 00S 00$105 H0Kd Ph eQ|şP.DD0HK CKH0KGK0P ?eP@7  ]WP 80S0C80A@T( 80S0C80 .K P 0S0 00$10Cx4 R*) i(0  hxzeGOK@QHK dK  ,ğ(P0Q Q =gP  ae .KP 00S 00$3 R /  (0xx@e^@K@PXß HK( dK0 gP  I 'e=2 R (0 Y hK PP 000 ` hP0 82 R 0L HxPa 1 R0 1 0 5x .xCVD  +P`7q jP00( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`C U 0 R w0 R 0[S0[0S[Q5#$0$)K%"48<#Q !PSheD=;9|946h 6hl9;<;;܃;i;L; p-LM@ PQ0 `0S R Q0000S ph hP0`00 0(0 `}w꜄; p-LM@P} R0000 0P @`U00 0S S @0S SS00Mx0S0@ R \00C\0 0@ 0 Y 0S0C 0 phd 0wꈂi;; 0- LQP 0 @R T0h( c -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,Y0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`KxO  S K~SU00  3  R0TK\0KhP 0@ X8 !xK `SU0h0  d  P` 0@QP@0pS0S 12XKOKN0)v2Xq  SK /S0T1 `V OK0 S `VT\ ST< PU p ` 0S0C 0 00 R 0PV PpP.b0ST PU p ` 0S0C 0 00 0@0S00PVPpP btԳg|;@-|0\ 0S \ Q @ 0 0R 0 0^@0 0Գg p-LMp`@PT 0S @T 6(@3M0 0P0 S00@@ pԳg -p0LM@T 0S @T P P R0600 h)Գg -LIMp`0,0 00 P 0SvP,6 Y(P`g 0 0 PU 0SPU6( k100,0 S ,lW0SU P 0 0 0R 0OK`0`0LMK@0K<0A1T (K 000S: 5 R0600 ( 0S0C 0 #!aS/K 700SP` V LP 00 0 `h;1i -LJMp0P 0  0`0CS 0  0S V: R000  R 0CS  NK3LJK00<0 K 0-K 6+(`h;2i -pL@P 6 '`V70 0 @T6@ ( -LM@P6' P RP0S0S 00S0 0- @LTP 0S@T00S KP@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\eTgte -LM0@S S  KPP P 0P P P0P P\9 -LM@PPP  0-P0L@T P0 bKP0@T00鈂i-P* 003P: 00 ? >-RALQBp`Lr ,KPUe 0 S\D@ @\P0 S h9;$; -L M`4 X, 0 2PU8 S@OT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZr0XohuiiHe8; -LM{, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP:,0SW y  Pp0He -LM@ @0T0  0 R @T0K J%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* PXohe 0- LP  $ @/I $(I $!I90 -LM@9 % % h% -LpMpxPK0@X 0 H<x0 p`KH} \M0 00   00#0 Q  Sh 6h46hp; p-LM P\ 0S \pQ  R X00G\`@M \K GP @P ;PTT HP  HP T# T 00#0  p  HP00 0  00  0 00   L%PP ʐPPT@#ee -LM@pPPT T ~PD P1@T T sP, @T:Pa0S( o0S 0 @ `( PpP@ P`po(p0 h`0S h(0( o@`0S(0( < `0S(   Xohe;;;;@;h; -LMtP0夀K@(x,0 G  G5%#000K$2 8K4 KK 0 n qT`K@@0  \0K[ K@ 0@ 4@  GPI@8P 5X0S0 000AK`GQ @K@KKKK 1 !0 1\ڸ0[00K [ K  LOP ,0 S , R ZOP/P t0 R0 To KP ,0 R  oh9;e;; -L|MPK0`x@(p$0 AG FLKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$Q80 0\0nh9\9;e0; -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ pF [000[S  A0BS 000S |@KXFK  [PK;F00l0 0 %"4 4  0 K$0 S $;Qlh; p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S Qp!nX0S 58J0 R (  x0 R gPSH,KrPPhe;Ȉ;؈;e\9 -L0MԢ0p(0 8 PU 0` RP U PU `0S6 VPDPKXB8F>0S( *>P'WZ'08 HQ 1 0@80zHP1>0  0BR >P E,0K8 -P<080  , 0R0% ~*0eܳgسgvig4ecici0eciPviviY; -PLUp `2X !@@B( B0 :Z P$4D 00b0- 00C0cici0 0   00 80<808 8<<80808 < -LM㹲㵲0aS008PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0Sひ00W oT 0@<bgcivici0evi -造Lf0S ;`P00680S Hp`80@@80SL00m!gcivi -Lw+(0V 0 V0`epeeeQ0-4 $Q Q(0 `0P@ 0RH/0d/0l/0t/0|/0 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  P @0 S00 0de; -4L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) FP,0:S @0 40 P0MS1~  H0S 400cn 0 XX 10000 00SZ:XN p4 A A R= R1  R) R < 4( <"4)<(#,(` ## 0P `@0P`(`q 00S S00000S 00S S0 0 0 00S1 Rtt!d0c0S: 00 B00 0  0h0h40C0CMcq1P@ / 0R0% :P 0 SR0M0P@ 00K ܘP 0 0R0% * V UV (Pmcdie;ydidi liY; -L$M8 4 8 p0Qg ! 0@40X@0  0 S@@%` :V :4 0XPP04,!!-0@0S ʀS S cS( ; R4 0P804K @@ @40 0lS0Dc4P 1  0@Y 6060470@70L704:P@ 40S 1 0@4 444 S S4P 1 ( 0@Y YY4P 1 0@Y Y4x4u40S 1 0 0@4eS>ʂS400S 1 @0@YX X(S 40S 1 x 0@4(0P<  P);4L)<4 Ւ840S1 p p8^400S 1 0@X400S 1 8 0@Y> 0'4P4< 4 < P 0W < 1 0 SP*<0P< C 1<:)01<@<14@01\@@( > ><0 0 0g(00 4<(P<0~ S00  ƟA.L` BP`0@<`G4PuJ4@4 <@ 0<  S :00K< P<  0 0R0% *wS ʇSi FS" Sv400S 1 h 0@Y'XF%4 0HP<  1 h4- +400S 1 ` 0@YX%%4 0'P<   7F4 7400S 1 P 0@YeX|$4 0P<   =$4 =400S 1 X 0@YCX#4 0P<   44 4S 0CS30S X Xt#40ÑP< < <Q Dß `LP`0@<(`h Y40ʐP< 1<< p0g̠  H0S2 <03p2( @ Z = =0K94X =4 <1@:)014PP<4増<4 400s0 (0P40@ p00g4CYX[400S 1 H 0@YX:X!4 0<P<   <[4 <1 R!4`P0@0S 1  0@4@) 0`0P@ /,0K 㑕P`4  , 0R0%` *H `P8)`die܉;liʚ;0li8lie 6h46h(li; liY; -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,C 0K%Pp  0R0% * 0 S0% :X dKN80\ d0Kc K\@Kl  dK0L -PS@@KHK180 H0KGK< HK 00 P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 Rӏf_\@K  @< 0K0 ㌔Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KgPp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0K3Pp  0R0% *+ 0K!Pp@  0R0%@ *<V0K0 Pp  00R0% *$0P@ \ ^h li4;tieeH;Y; -L M@0(  $( ,<4<,4"|P@PU110SPHDPK70 C0KD K<`K0SG  P, 40" L0P0SS<1 R \0R:1  R' \0R$*W*0P@ PpP 80S0C80ڔ0@T @T (0S `(`AK\0W00S0%" Kheeetiet; -%LDM0PTP ,0 0 S80\0 `P dP @p` [:X HK@h@ 60@K hG0KHK:HKP@0[S mUj45 ,0S $,A?0[0S 0D0fCT#HK0HK0O0O00SY 0S ST Y @0K>@ [R R h@K t6H0KPd0 T T T񟗊K0K0,N08N0<0\0 きPP5 1:)0100႔\ 40R0 R㡍1 \00 0( m:0(` g:TL0L0(M0M00000s00x00004XK X0 L:00 00880"000` PU 0S0 00 M00!800 000c0  H0S 0T 8 40@ 08 0b`0< 0@\ `0 s< \ pT Kd08 P\ e;b1 V1 ?0[0S S?1< 0S5#$0$#K4?0[0S.Y ` 3  1  HPP 0S 0S 0 0R0%0 0":d0 d R  0 dP ?P  P0K Ppd  P 0R0%0 *0L0K Pp L 0R0% *\h; 6h46heY; -RL MP`[@EPUX 0T01 @P,  H0S4 @0 ,P V Y pz*0.Sp Q:W 0 p,0 UP* YN* Qp *0S .S  Yp*0S .S0, 0SN*0G>SKpA @a0@RSD0SA La0LRS00L S:W@A @a0@RS `A@0@ \-P+^pG`ĔĄPPW Y *0.S,0U* Q:0 0, S*00S0C00  00 S000C00 00c 0Xl000 , v0 P`  8o1S -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S C4P0pi0\0jS\ 0jSg %4P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P >P P  0   P  000P 3P040 Xoh -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K7  700S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 XohD= -#L4M0P,0 0pT0 Pp 0R0% :Z. HK20H0KT0 0G Kc HKX0 )@T9 h0 @@TW1 h 20S'ᇌ@HKLP0 ᑜP᳊PP x2 ,0S p,T=饊@L⋛@0S  P KI ᑊ2P@ r0:S,0S00S40S80S T , 2P0S 0S$0S(0S X 2PQ 0"0 # W $!0㊊P h 00S! @P0LHK P  ;PP0P0 pi3@L@0S   P K L0K PP7 L 0R0% 0*Yh(i;8viʚ;Y; -((LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0 Z6 V6K1P` K`KPKK6 K( 0K@K1K`KPK   0 6@T 0  1P0 @T0[Sq RF  6` 0: 0000@S1`6   0:( @@ 401K<1 0@yP Q 1 0@Q 1 0C0@\ 񟗗Ha0a0a0 b0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0a0$b0|K0 WD0[0S1@  TȠ |08P*^TPK(@L0(  00@S*%PL ( }4@0 R 4@40(0@Whi$e;e;;;Y -LM@P7`4p1 @0 XgL; -&LAM0p,0 `@0PK ;4Z - L6 R @6 R 0R0%P s:Ui  K$4K 40[SU 0[SI 0[S 5 Rş@0 蒇5 ,0S ,7:K| AW0[0S0S @5 R K0 0.WH@Ks/0@K KG0KHK3 SCP` 0P 0S 4 R80S0C80űCK KKU W@K }/P80S0C80ž0[`S 0[@S KK j/P00  3 R K KK)NK(H( 1 Pz!R0 ! 僑Q Y0 00 S T3 R` KHK@ KKY0PI 0PVO !@! 0K@j& !R3삟! hH20SPAdPK@K.`K..0KxK c0KdK0K0KKK03\KK ,3KK (3FK !0@aCP@K.KK0 0KK3 OHB1 R K KK EV0[0S@@RT1 R K KKdB= 1 R K@ KKw 0 !V0 R K KKi0[0S5#$0$.K0[0S5#$0$-K0P@ E?K P p P  0R0%P {*LUheleetid;|;;;P;;eeDu0;;X;; liY; -P&L0R@V-!0 0P0` c 000 ƆPU;0Sn 0Sd 0SZ 0SP !@( B("("48

 @ 0T  # 0@05S1#=#=`FNuivivipvii`iiiie8vi00S8 00S S. 0 00S%X `0S ̠ 1<<1P 1 0@5S!`P0@P 1 X 0@3`" P 0SP0S 50S00S 0SP@ T  P@P 0S  j  Rhj1P AP 0S1X0P@ 0S5 RT0  / 0,LKLK  $h@viD;Xvigh`viHvi=xvi(eviP;@0-` uut|t8#8#$(,""( R KV P`pp+ |K ! P`  K !P`  K !P`  K ! P` 46D  R-LPp`sP@ U V P  !@Ct1`t7 -LMpWZ 1P  H0S> @ Z4sPP. t1`+ U'   0@rtP0 0 000<4(<"4!< (K= 0  0007OtP40@ @0 0bS0 0@ʴ @00c<usP @0 0p p-(RLMP`'0@S @0S10  0b<S 0 0 0 pFsP  0 0 7p( B(04tP -LMP@Pp ,  ` P 40V80S0C80O00P0 0 /P& U0@15SQ CSd0PUh$|@0  X00 ?0#3 01Ԃi=XoheMb -L M0`S, P@ pF PC V 40 40T 40 }PqTZ!1  ,  0  0※ 0 @@.pY (_5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@^00@!@10 r!01 !1 0 g! P@ H0pkPApPp\0S @40b@0 \@PZ  P@` 80< 0CR80E;=MbeeX0GS S S5SS ʇSS S p-LM@!`\ XP P p^p3000  00  00pQ 0 0S X/W^pPU➺( (/ pX;; -SLMpP@` R00Q00S3R`U-  P$ W W *`X + c0X0P00S` U l`   -L Mp, z0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4hz00 0D D 001100 %!괂i -LM, 4 0 mz, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 < z8<m @ P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  u08#Xd ,e; -LM\0@,0 `p XKw  hKs  0R60帐 0 弐 Đ 0% P@ i:T_ `xK ^ 0S@ u0S.0Sş@0 \,0 S |,xXKh ,0S hK H y,(50S xK$ o,P @(0a,X0ST0SP0SL0S&[4R t0S I,d0S`0S\0[Sx0[S S pG@K ZP R010 0S  0S 0S 0Y0R00Sh0[ xKSppP`z K0P@BY Y0 00 S 8s0S[ xK⇸ Y0@4+PXK mPL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-hŸXK%P"Ġ0 0Č2 XKx KKX0ST0SP0SL0SXK) +H@KxK@K0 H0KGKP@ 40  00 R T"Ve зP` 0  p0S 0 R Y+w0[0S5#$0$'Kp0S0P@ 0K H`PĀ@  0R0%@ *H*heetiԓ;;;;,;d;;|9Ԕ;;8;d; liY; -LMPK 0 , X0S Y0 00@@ZP d00S#X U 0S @00 0 pp    0@00 :0` d`K0HK@#  0U H0Kc KG Kd0K\PK  0S^ R 0(S@@K i 0KKP @@K ](` x0(0     0 P Ru Ri  RI 0@#$(,""( :( @@R $ 0^0K K@@Z 1`P 0@ 0@@@0 \ 80S0C801 ,0S ,7   P Y@ 0 @@ 0P 0|1 0 Y @ @  00S S0 0 0 00S,1 R P 80S0C80LZᕶ0 *TD  qPM=@@@K:G5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 Y1@YhghPhi;e; -LplM0@,0 `P<K r0S㈠ # X6 RLƟ@0 Y 6 ,0S , +@( P(0 ) 0R0%@ Z:TP LPK < 048L[<# #3 0P| 0  2 P$ \ Q <0[S  `Ft@K Pl  R010 ȵP 0ڵ F)Z Y0  00S t4 R ĵ Y0@`,){ P` HPU 0@T 1S?Y Z00RX Y Q$ 0 S!|P40@040 @R 0 ` @ <0T# 0 01(#(30Z  0SgQJZ\T\00Z00S?Z |!0 R00S| @u@<P  uX2 R<K 0S 0 S  1" 0 _Z\ 1!0Z Y00Y  11S/ !x1p!0 ;%Y  P1 R $[(0 R S(0 R ܴ H(K0[0S S5#$0$$KK0[0S0P@ x0K 5]P p @ x 0R0%@ *8'heti;;(;P;=ee;;; liY; -LM  PK ,  GY0 00@@W0P0 d00SX 0S  @00 0d@Kpp0\`K00 :0` 0 HKHKdKP cKGKQRS 5,#04%KKT P0 X @ _PK VK 0K P @K  I(`w0(0P 0A R R  R 0Sx 0Sl  ^R N0@#$(,"̠*"(** :( @@/ 40K K0@@Y 1`P 0@ 0@@0 \ 80S0C80ڜ1 ,0S ,  Y@ 0 @@ 0P 0`1 0 Y @@ Y0 R0000  @ 00S Sv0 0 0r 00Sl0 R P 80S0C80$Wm0 `&1 <1 K吐 KV1V렀hghXhi;e(;X0GS S Ss5SS ʇSS,0 P 0SP᜸g 0- @ PL0h 8,1 6 -LMŸP@Q2  0 n 䁟0S00 0Sl 5Pp8| P`H 8 hl1 p ` `R0 0U0 0 p @ppp 0S] 1MiT0B03 0 0 0Ba0⯲ 0( x&0⦲ `P\0(0i &0⛲ <P00(0(%eg@ee=Mbh;;;;; 0-|0L PR0@P@ X R 0<00  0| 0 0 CS 0heg p-LMPrU`r P@k bU !0SF 0R20 S0 S R&0`!00S R0 <10  0| 0S0C 0 phqrq0 0( %; 0 0 0Ba|0 R ( tf%0 \PX0(0[%0 84Q%;eegH;=Mbx;;;ܘ;; p-L MP0`@T6 Ʊ 0( *%0000Ჱ 0( |% ( l% R 0T00  0| _ 0S C pphph$<;l;;;g -LM00 0 0 @0@ @@ -PLM@ -|0 0R h0 R] 0P (0h$Q 0Shy000 o$ee;D; -PLM@ R000h_Y$d; -LpLM0P,0 `@ <KJT2 l Rl@2 Rh 0S# (2 RŸ@0 T1 ,0S ,]P @(0`$<0S80S40S00S5 0R0% A:P7 d@KH kP%` R 0 l 僡 Y0 00 S 0 R <K⾰Y0 J'$@ <Kl  0@0 R $0P@ h0K YPp h 0R0% *(#h,eeeti;;̚; ; liY; -LpM0@,0 `1PK 6 R 0 0S# 6 RƟ@0 TdƟ,0 S `, JPG @(0,#0[S 6 R K5 #0[0S 0R0%` Y:VO @KPE P= 0 4 TPK8( LKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !Ey0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF K⣯Y0 D #<0K@ @90 $(,<4<!4"L T:0S\  \ SP1:PT0@S 2 R j 0P"2 R ] 0" R 0S " R0S\ 0SX SR 0 SB K`0 K0KKX0h [0  /h K0h [2 00h0K1\K 0$(,<40~n0`pfVPP 0f0V@0*` VT( K,0K JTZ:0 P, 0L00 =pi -LP; -Ll;00-@P 6 0 -0LPF -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS 1(1(1(1(1(1(1(1(1(1(1(1(1(1(1\1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(11(11(1,1(1(1(1(1(11(1(1(11111(1(1(1̃1܃11(1(1(1(1(1(1(111<1H1T1h1t1|1(1(111Ą1̄1Ԅ11(1(111(11(141<1x1 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P 99 ;; ;7;;;(;<<,;v<"<<;  `Sl h0 $$ à 0 < 0 $00鴨;;P9;; -pL`@Pu$ T 4 Z DU pP@TXD4(4Pꬨ;;;;;; -L0 Z\@`%Z' !00St 0t  rW\PD  e/;;<;;;K; -O8@LMpOSP!b$ $00S 0 hdX@@  f;@;<;;Ȩ;;K; -@$40$&S !PL$pdxl dVHШ;ب;;<;;;K;;];; )9 -LMp<`@PL 8P$1( <0D $00H P dKDP8\00S 0@00LMn<`p4 KP@B 40 R08 &8 P00U* Vؠ 0. J   0Z UJjF:804 0S80 d~@X00K@, KP00L00  =ipi4;>0 >0 uJ=M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p$0 0 0c@0 < 唒W`D h 0x"Y, K00K 6, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 K/ypi  0-LMP 0 .@K PP@ PsP*80 0\ @8:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WH꜃i0i -LM`0VPp R a :VP@bT@!W W `d L 0D@WH꜃i0i 0-h@Ld0LP 0T0P XT ,0R 0X0S0hzꘄiiDP; -LMP`PV r @0S  2S @2S2S lphUdR0JS X1X1X1X11l1111\0  @\0;\0@6\0 P11`VAA0S 1 R$ 1 ?#+0AB%@ Z 11@T !mt h81\ ?# $1H1@Q1@!+B%0@ P\0\0 0X u" 0|  cm9i܌;H:;;;İ;а;ذ;;,i$iii4i9@i;9;:4;h;PH  ZQzZ ZX H0H0H  D0 @< 0qH  R 0 H80 \0040 < @00 ,0 08, 40.0.08S  0S00, 0X 00 H @< 0;0 080  <0@4 00 , H 0R6BS`$dZ080  @< 0@80K0@< 0 P ꜃i]iiT9hi=dg;@;p;; p-LM( \@SP`8 0 ~ z (urni$d4a00S8@< D WHxTh dMH TH LDܴ;;T9; ;;;,;T;|;;;ĵ;ص;;;;(; -LM \@P`p  0 P`0<1 0-LM0S@ Xǟ#&R:0R*0a00  01c@W2 0D0 HQ`  D0 `6W  T  8 5S55SSH0 SL0L0S S L6!XD0`0ó D0` &U  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`}TU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 5S55SSH0 SL0L0S S 4!ATD0`0ó D0` U  D0`00D0  300S p3 0 P3@q 0Sn ,3Ph ?P8 ]  "U 48   0 `!D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 5S55SSH0 SL0L0S S 1!aVD0`0ó D0` x!U:  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D8 0@ 0S 0P O0 |eg)*(":1"(Q 001 0R8iaipiHi9ii\i@gh;; -L0@ >#& R7:0R4*0l$0  01c!R <\ 0P \0T\ 0 D00D0   $0 2R @ ` #& R :0R*0l(0  01c!R <\ 0P \0T\ D00D0  aii -,0L ^  08ꘄii -!*(L":M1Q"( 001 0R  0d* " !Q:0Q*0b !b0 P 0ai -LM$0"*01\06S0:0@<,?$i8gpii 0-0 L"*("1"(P  \@! 0 SP!0!;   @00鐃ipii@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000萃i@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pCP ` `000@0  0@0$0)$8ipi8g,g; -3堓LMp00P 0, 0 p0S P U:YZ @:4s4C<,c00#S 0" "0 "0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@Z4Ÿ4 0,,P0 "R@cŸP 0$T D@ 0@0!@I0 @0!@;< hPJT:k/o`P@) E1? P 0 01  @`P 1 000R ;P= 9W 0pĀ иgpiiigi$g g(g`ii$ig g8g,g4gض;=8g(gP10^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEPxH0H 000 <0040 000 000 $0 f븸;;,i iU#&R!:0R*0a !bA 0 T L8%5HL<@T V 0 *$@T@0L ^| P0U@`H@ $@K,0$ {$ 00vZUzjTepi0; p-LM`00l H0N@0d0>0^P x0,0 .L 0L0H ppiTe8;40 ( 40(S"4Se40 ( 40(S"4Se 0e -0LM @R 00 S84yX 6B? S p0  "!  PLX4C<t<0`e=@D;`T;x;; -L$M]P_#g0̧ 0088 K<0K2x<8P.@ ǟ@eǟ$F@||ǟPPp@0A \\<0 L0b#6DG00 )P@ 9#9S*00 S0)\:00 0C000 0b1,0 PUZ0Q I$IT p0 C\Dft:0 0C0d6*0 C\0Vd:040C *0 0L0b1\0uM:0 0C05*0 L0b1\08:0 0C05*l0 L0b1\0#:0 0C005*0 L0b1\0:0 0C04*qğ0 @0a1^0:4L*\0P$SHA `P KPUE `Z0>02 aH2"& 0B0  0 1!<!)1$p!1 1!1 UJ! 0 |K ,"X1 00 4D0<0@0 #~p0C ^:00C0\L0 0b10 @_긻;hi|i̻;$f;ie tii;ii<;hiiiiiixiS  400S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@Pk0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` pD``$U-Kz4K 0 3KP `p,@K -L M0pK@` $!$P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p60S hPu,0P# P 0`V U004P< (0;4P00@ @0$0 0SV hu9P 0,0h -0$ `L@(X `, ,0P+92|:2:2:2:2PU e/0p 8/U 00SXp 08 0 0,0P#|;; -Lp` PP Y@  ؾ` 0$0  00 @0 000P 0ҕ20•U@ pP /#U`3.  -LM,0@S$;2P<2;2;2<20<2P<2`<2|<200Cs0 0 00, 0S P9p  ,0S 갾; -LM0@0S S T@D 0\\ qP0@DSSa`t0L\h; - `L$0p04@S0P0p0CS0ԕ PK=2=2>2>2>2?24?2x?2=2>2>2?2=2?2$0( R0(0P 0  0@0PS 0 x$R l1Rd1Rh:Q   )?P 0!16U<6U"*6U 6UP6U Q QY00 "  d 0@FP0 00 00096U 5U 5U㲀"U@ R0`0 "0HS"5%@P"@dDFA 02 Sh1b1 R0``00`y" 0P0S1 0" 0#$0$   BR !4$@P@dDFs"A 02 S`1b1 R0``00`7"I㥉0 0bJ10000 2 0,$,!$#, \@Z`s0S4"tCP R0`04 "g  0@@@P02 <4(<"4!<002 0#$0$ 0 S0S0002@2@dP㤈`|2U t2U 6 <@0D,S? 0\PKP@PZ0[Y [$ R !lZP@ 0P@;`@K P 0 P0"  6[#$0$&K N0U 0,10S}U~{0Ux 1Ut 00U0m0Uj 00Ue 0hf Q@c Q <c@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc cc+hhh)hddQQ` -LMpe,0 Pၬ?!؁@Q0`0h  !q d0( 008,!2040 1 K `  00P @ 07K? 40<47O $P%0 0bP 0 P6Y *(0 ("4400$ 0 ,0\ o:@ 㬫 y`+hQ .P@/  T T 0PT  o p@` 0H @0 Ppx`P0  V@0P .qffh:;2|fH:=2L:<< -܀L0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UTQ0k(套44e2eeTe= - 8L8#Č M R00 `,Y, P@| 0 0 Ḡ忻PppPU7 1'Xp ,0 S0 90  S0 90 0P0U0!1 010嚻 -Y 8Y 2 RPp0! X-. 1X0-.1 Pp XpP101"~P1p01 0 -o1ᴴf - 0!4LM#$`p↴P@A 01PP7 V0 70  V0 700(PUP0 11 011 VQt H 1<1-B_f -D@!88#L!2P``00l0 $@Th@ $0l$0徑' `hPX0(p$0wp Kh0D < RP0 @@P`p@K  0@  x d`2 pK?0S@ pK?0S@ pK?0S@ <K"ht 00`uyKwpyK"<"1vT!0xp@ py[$L@ "Ġ.<K[  ,2U" 2U T 0,0  0y,  e|@ 0e/ޥz}1<1 2U 2U 0 e/ǥ 0FP,  o1UC 1U 1U0 0 "   QnD10S 0 0@AP, 000 , ޵P, 0U 000/m&4400 0 P, 0S0q U 0S00000N@0UO 0D0AfQpd Q@mdtd@Asd edArdAmqdhdk~gdT2Q` p-L,M`@0P0 ͠< V@D QT L@KP$ 0PLP<K  0S Np5hd< -L P01 0! 0S 0 0@K Z 0 K * 0fP 0 0@K 9(P@@T0` 50K01#5#(0  * 0P f -LM,pP80 ,88 #$"P00`r0P< m <  @(  PPf  4@ ?U„p0@@ 0 @ P`X@/RQ@pP34`K @0'2K@#Ġ *0'H'T40K-K,K1@K0PK/pK0@:00<0 0 |  0 `008 $( ,<0 ,0P00gfg'R \ 0L_S BR\00 -L\MPp, K0D ! H L M 0SF 0  ,0S40S< 0 0 S . S ) S 0S0#P3 0 X0㚞LKS0R? Q@0  S S  S S S0S yP@ 400S3 Sj `8` 1" R 4K@80K@  @```(8\ 0?0S8 @4K P<0K@  P@@@<^ 0?0S @@Tq $zm  L  40H S0 D0 0 440  0 D H0@ 048D  04L0  0H @ 4K P00K@  P@@@0^ 0?0S0P (` K0@P`P Kh  #DP T@%h0IP 0P( P NAP APU Pj #P\ HP  JP  -V .V (0FS-0FS-V ,@F0Sk0S\W <@K P. 0Ch0 @0C8@ P0>~ 0p`g#PP 0g0V0@ p XWT( K,0K jVJZ04 P, 0L00 =pi p-PLMn@P^P^`0PPfS p_0 ph=0 0-LMP QH0:Q *^ lP*4@D P0 -L< -L0< -L M`Q9:#V6*0S`02* c 0>0~N0@pdPP *"*0 T *` 㾿V\$ K(0K JTZ:8z P( 0L00 =pi 0-@@0N@P@@eLο\0 0hppi= -L{X< -Lu< -PLp `, ,@ ,?@i<@<E.h -T0L M @KR>000S  0S ED=i<00  -LM0@S00?0 S  -40L R 0P p-LM@P400  `V` 0  ph`fb0@004 0\040 \0@40 \ph<<< p-0LMx @0t0D L0l l0P T0d d0@`(PKX \0H`< <<@0 0( $@ ܕp333333@3D<2  `2b  `,b -LM`{dP{004 ,@nPU 0;P0 P0~n0p`foPP 0f0V@0*` 㤱VT( K,0K JTZ:0`逶 P, 0L00 =pi -L{< p-PLMn@JP^P^`0PPfS p饱0 phI= -LV<000s0f p-LM@4P 0 0   0S`T phnB04 `0S 8 p ph\ <@R!4<R R | 0\q 0 Q  -LdM43l0 | h5| , [ h0W^40h%0 02  PZ.XK  @0S S P@0'\00xhG=h>`2`0S0414!|D2  p70p702  p7@0p7p7[@D 2"@w>H_00%0Pبx@K "!h 0/x0Kl K>P |Ũ100|0@0}0t81p! 0rP  L( 1 ,0S 4,囊|$夨!0`!wΊ_0@@%0菨P0`@#Hh P 8`p@w>0P|0%|llh=8 ;h<|<<,f=;3-3<:8<(< -@LU`$P P00$ ;004P$ +$P؀0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UQ0(-re-3eeTe= -LMD@!88#,!᥏Pp ӳ >(<zpǗP` @0  R1V0)0.000@.000000.0 00<0X1H `u\!;hPP P <ߥ80  m雅Uq@<= -LCM⠁ X1deIK$ @0 `1PS +3,3,3,3,3+300 ;004 0 <0 A&0l50l5E $0S $Ԉ> @7S֦Y?0Q  h <h9D@0 |@ѓ7S07 \带X0  .<宦00 ,p(p$php40 47 ῍v|<, ,, eW@ ,0e/X|1V 0e/ ׀H1V6 :<10S  0psP, p70p7 , P, h% 0S0000V p70p7[0  $44000 |{, 00 "   0,0 0S00p7fmdedAsd rdAhdk~gd'3 - 88@L#D M$`lP, " , 0*0  0 ,00ŽI(`唠PPd@ pFQX,*0% ,`uPP@PP@ f -LxCEMpC\, 01 p 8 8<#D0$40PP h%` 0 S4 4(@g~Po~$8 0 {Y4! 081 ` 0@W V X,0 S L,4A< 0@@0 \41b 0 h5 8^WaO~N0p'S000000@000408( S0!hX0`U\PG P@ `1SL8383838383٣0 S 00ѣ   P`0R P 0$ $ 00ggfgg -@0L R 000 0S 0S 0ggg -4L,\ \ gg 0- 0P @@ @  @ @RL h0T d`  0h@0R  Q 00# 0Q 0 000 (-"H 8TLpP#h1 '0T 0S \0 0 : S 0Tl0S 0 R00ڄ\ :@@0T\ 9\ : P= -LMQ4 P @pZ TS R0R 1`T R 04Kp0; S, # Rr Re R   T PPM P `@0`0VA` Ƞ ;,H ; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A1d2,R0X0 R00(2T; 002R 1R R;00A Rx!t!1T ʜ1T`!  0yXx1TU@\!0@}y@! 0 H604 0 4 04 04 04 04 @04 04 <4 <4 90`K 0<0 0! y# -p!LM04 S\q1Tq080 0K  ~s8P`@`V@DPEAJ3[ S"[00b0cS hs 0KasX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3ff 4S @08#<@8oS: S>; S P 0 R0,Rh : -LM@Q Xj3tj3j3j3j3<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S M !< p-LM0`PP@ SIP 4I0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ a 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S= !<$"<0Q 0`c Q- LjX"<\0`0_꘻;Q p-LMX@PT 0S1P!00 S P0 MpH0`0CS0000 R000S0Stt 02c1jPD04 1Z00_lex3Te=h" 1q@ 0000)L qlU`P ` 4L80 P?#<0<0cS @0Zl UP\hP全0S0S 04 o2Y00 akPEx0S P?#<0<0cS 00x  ,lH U`HP `x t0Sy P?#<0< 0cS 00t  lD0U`DP `t0cp0SD P?#<0< 0cS 00p  kU`P `p@/l0S P?#<0<0cS 00l  L kL@ U` P `l - (L(" P` 0AT P0S XpW4P`+P`Xpf -\0LM (("QX@ T 0`\ X0{f -0! | LX\ ` -p0LM Ƞ Ƞ,A0S 0X00c0 0CS0j f@-$ @.MЍ@f 0-LMP@@ 0@0CS00 -LMPI(1Q: 1Q?1Q< 1Q0 0Q 0`\00pXP 41` Q 80P 0Q p0QXP 41 PXQ 00S00 |f}fvt~f-00 Ƞ Ƞ,1X0S&f -LcMq0P@$0 40@@R00}/#\B1熒TTT }0P0 $0S h$gtXpTa0S0D!0000iK1 ;0@00 `0`2SU@4 0kP$@X0S 008 R 0  0S0 00C0yteC00X 80P0H' 8"0P0h$f"<"<"<;`e="< 3"<#< p-LM0P\^ @L p0p@BQ```P`` `0 ^ pPBP (夐$墐 f'<3Lfi3f<#T0 $K$\ $l3^ -LMȠ,Ƞ @0 pP@U7`\ 0$  $\@T0 $K}$\ $p3 -DLM08 2c1@\0@Sh=$<$<:^ -LM@` 04 P*0S 0P: -LMP`p1@T 0SR (@T0e t9P@E 0 P` p0  0,P/ 04P00 0 P 0P@ 8 0e90S: 0S:(Q,0,0, 00C0Blfpf -LM@^4 40((0S0,@, 000h(lfpf -LM@R@\dbp ]P 0`$02P@T 0 R1 @T$0K@ BP`#$0$@$0 @00@S00  Q@ @00  Q 0 0 0Ttf -LM$0S h 0@0$ 0S00 @ htf P-0L 0 < g|: -LM0K0K㸐@`BT/K -Kp4K0.@K)K+PK*K,`K@P4\ 0 @)K*@KP4 0  -LCMT0Q0@`O P51!sJKKK1 (B(0P&,1?0@CP I_KPE00 $("8  00X00",S ?00^0 0JKKK 0xP,1S QK% Q&0Q41!P0 S0 S0 0 SR 000 S P-L@<`p1 SP"U 0S 04 (W 0S 0 4p m  mb a TP Nppp%<= -LMB4 , @pT0 P0D01&< -LCMXK_K@K `0, 0 $!0  Pӄ _01pVg 

h܌;'<'<3(<<(1!B bQ\^P` VZ U5` V 4\p0 ?>1!B bQ 0h B0P` V0x t |0CKh ythKVK| 0  Q 0 ,0S ,4[h<+(P P0T0@   00 PU@@ (Pi P0T0@   00 PU{(<Duu@@ 'P E 00@p,< 0-L@PIP 00h -PpL`pf '`Vh pC!dT! lcd@pClPlfZ(pCht,< -L,M` P @$Rp0S  0 R 0$S0S0 R 0S 0 $t0S00S0 0S000H0 P z0P  HY00Q00SH Y00R00SL0 oH Y00RQa 0%S0S00S0 0SL 0^^$@ ^ 80BS03<3P3\3l3^t30 ^t30 ^  0B K D0KDK0,0 CK< 8 4@ 0 0H0Sx300x3t3@0t3t30t3`rt30t3049tK(5tL0t^,<-<(- 4 -L MR@1 ,0K F p (0  B`2RP1P! ,J,0(0S,0$0%e,0%V XpZ, 40 0404 00PRᒺ0c404 00R2,VJ,0 0,00@-8P@ \0Q0"#000"#b!1C00 00Mb<( ,00$4G-M(p,`\P@Q ^Ѝ 0S 0S 0S 00Z0S 0 48S05 0 48S0Q0 00$8 S055 5 5 48S00 RE-PP@`pQ P 0S 0S 0S 00V0S0 48S 0 48WQ0 48S X -LMP`pP(K 0,@K@I,\/ 0@ T(S :0 P,000 P(0 0@zP0, T@ -S``LM0pPP 0@ T S0 0 0i @ 0P@ T 0 -LM`4 ,0 \tp0 8  D0S <  1S 8 R t rl3!b1<0S "rl3!b1x3@p@ 2T00s@$8Q t rl3!b1< R "rl3!b14l3!`1  044 W<0, 0Q,PTP0AS4X4|4|4|4(4(444Q0% S pl 0D GPDT0 4 @ Rl\ \1\!T000S\0 \ 1!T 0@P 0 TT  0@Q 0\ 0S S@0S4\d0d \ \0Q.#L0#/#\/##l###$###\###D#1#0#/#/# -L M"00pAd"@,T(0K(K0, K%K#`K"0K!@K+PK*K'K&@K$pK,KC -LM 0@S  P P 0S 0S -L`@pP $k 040 0   8k8 P.KP(@ H0kPPd0PU0 h@hPd0t@Uk0<0.0S9 }` 0R& 00 P `0 0S`0: `l0 P h0d 0Rh0 50d0,$ `l0 P h00h0 # 0-@L0< R0S02`0PS0hd0S0d0| -L M0`<@\  $0K vT$PP' 0"Q1 @T 0S 0S $\ \0 pW 0p W$$0@S$0 P#: p-LM0@<0S hP`0U l`l 0S`l0h00Ch0 R $0S PU`0Sd0pphp p-LM\`2 ,2 0 p\6\- \00 p\0SPU0P000 0 " 0S R00 00 $Ap20 0 K@T00DS,2424h2424PU0P 00R20 0΅PU2 00 P 0R0ޅ 0΅20 00 0TPU2 $20  P0$(0!P:00p| f-0S S s 0S0S s0S sP   R 0B30 R  f P0-L@ Td @0S @P80P4 4 d0S000hd/1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S  P 0S0  0S   -LBM p0004p`P@0 XT 0@0X0 @T@0s 3@R{ CKA A Bf08 ,1R6 #P111s- Q 01O1S,0 0 Y$0 (P @ - F-d00] ,K094| 1<0 S0SS!0@S40104t2<ĔiS,:$f;@:R34:: -QLM@CϠ m? R  0S T @ hz Q0- L@P Q 0|1Sm?@5 p-LM1 S@P\`|P50p4`N뺱 0 2<Ĕi -0 RL`p@ @*PX@ P 0p000 @WP:!1*E? R 1S 1S 1S m$>FO -\ ,m,>FO, ,00Bap4=Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!Pt+P @T*0P\?@T:@T*0\%@T:L0W 1S c LK)q@TP LK0|  @hTQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c a) 00@W0@m004\:M00HgLg2< 0-LM00P@K4U 44 0000 00CHg 0 Ĕi -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P40RφL P40Uφ0 P,3 D0s; 4DH0AP60叼00Lዼ0LP0P SP PP@嬻H@婻딐HꉼPꆼLT`pH@@P 00 p卼PH0 0 p冼L峻00@刻00@0.{Tf=4H0 HP P= iG>0S4 P 0 S00S=  X0S 0@Tf 00S> 00S<  i\GPJ a > < : 8 6S(0Y0 00S PS 00.Dޱ0D08<ر0<0f -P1LM (("QL0p SE0咲P> _P`7 H00H0  R@1J#T ,K,@ < >@0S ,P,0S:0 S:#S@wH00CSH0 pS S<d f\9< -@1LM (("AL0`SA08Pp: PP3 H00H0  R*#R$ 9H00CSH02 $mX >hD$K P艷P0 S:#S$0 P P< fd9< -L0 6 8 圱; 040 2@ K<KP 吀 0 p PP0 Ữ6] <0[; [4S\00\0\0UQ<0K 0SE444442< K0 0@ 00 @ @ 0`VPVZ !1K"<\0X 0=BP  0S P0U00S`01,1(1$10[S\00\0\0P崠Kx`KP0[!S㴀 唐  A"20 00  0  0 @ "\0X<P鰷 tq=0b0`k=ꤷ Lꟷ <. ᒹ0S8  hg<0` {<.<8<f 0-@<PPL0  0"P Q- L Q <0@S B# -LM?@p0BTCd$K% K$K#K!PK`KKK"pK 0K8@P %[ 44= p-AMLAO0P `0f P 0 C400\\  啩¨P202p霰 ]6h|p'X4;< -LM@? R#? R 5+Q P 5;5Q 0S110C1<P5 ;%5 -? LRP0p!5@@ !]o @Tڴ5 H d 7P9 7P3 H M F ob2S 5%N@05% +%ṁ} XDT0mDP m駁(5 ;<44=;< p-LM@? =lXPP? 3lOPP? τ%ld @冧oPP ̠ ` P娨էp鴯 4u5p魯 ꩯ d4P4;<<<8<< 0-? LR!^? ( R $@T Ic0@Ta0 0-@L!NPa000,  0 -P?pLP@`w?1TZ1TD*1T4 1T ` %# = S =@S @ 8C8`2%2  f 2 [ @ o5050 R0l 04P`5@`0l0T `0TT0P\բڠD0T!.0`2i 1i i i 5i i 6i( p-L Mt0@0t0P`4㱀O0 K`  1Swp8,: -LM@h -00%P-@%LU  %PSP:P!`PpPP`PpP P ? ercb_rcbӧP qP02s 44m .4꽧P [P02] x4W d4ꧧP EPRH , 4B 4X<◯@"\RT3@/2SዥP@ x$1aPb3!T p/p  `1P0< P" 0S;9$30@TTP 0 S00Sd" 0@To} υ08q?0j  M1/0@  0`K0`K0`X υ0Q!?@@/1   X0PT10p|!5x1 t!0p1!n h!40d18  <0 L!L1p 0\$ R "0" k0  |P 㦡@00Sh"x00S`"s ip0阻;4: 5|=<5=<P? .RPZ -PLM@+ ? 0pR&!^ m" 5{[#R   \ X0 iz,0 00 0S #1S Zh 5= -LMp00P$K1 m< P2 @1T2K2[@@02KL 0 0&_0@P  P p  @ 0S2020K2Ks @ 0 ^@' 5 -LM@3S 5+Q P 5;5Q 0S110C1<P5 ;%5 G -LM`zp/7P0x H7P} /0@d 1/0 4r?  P2 R95  0\7&>T? PP rx @3.iz?T'> ڟPP ax Ol$  P@m% ]@ %5;5y  } 0i} /0` @D `0 @ , 0E@x,-(><D><\5h 5=>< -X2LMQP@`pr42Q\*,2QH $2Q p%9 = S# =@S @ 8C8|23%|2  0 K [ 0[40 |2 X 0 K [ 0[40 p@ l505%@ 0 R0Se 0"4Pp5@pX0}x0Q l0Q-Pڜ0P\0S\<0Q!. 0Cp{2i 1i i i  5i i 6i( p-L Mt0@0t0xP`.-:y M0 K`唠 1Sypk>< -@Lb00%P- %U lPRpP9tP `PpPP`PpPP03r,\br&\bnP t P0t2x ,x ,XP pP0p2x x,x d,BP lPlRx ,,ݦx ,><><?<(?54< -LMp`РP@ %ڠ .0Shr\\ ἀϠP开0\@ i鮕.i$.<8<h058h= -@LpP2`Shpf0P0S 5@ 00p0P2Q Q? p-LM@R40+P`  0 @pOSP@ S1+(  $S7p$;< ?0-LP $@7P  0S 0|P7  HP7  -LMO0 S  T `P7  ,P7  -LM@0p(0 0`S0P 5@ R, R00RPPU 202*PV <̠DA   @Kx<חT"0$R(0K ( R  0 4(0 U(0 Sl00l0h00h0( P o 07Pl00l0 <P R o $65l;< -P?`LVp0@ o5X;e5 XXmot00t0 L#X @hp00p0 R 1S >;< p-AMLAO0P `0S P  0/"-C4? 0@ @\X  塖ΕP202p騝 i#Yp85@A< -LM@? R5+Q P 5;5Q 0S110C1<P5 ;%5 -L M0p5P@` 6o@υ 0@ / 005  00 @ 7Pp v7P <2S %@ %5;5in P  ";<;< p-LM@#> ?吔PP = 凔oPP ̠< L Pp "p $65<<8<< -P?LP@p`jn1T[1TE*1T5 1T ` n%$ = S =@S @ 8C8`H2N%H2  ?  bH2 ?  @ [505.0 R0;Z 0 4P`5@`0h40T(0P\եڣ2i 1i i i i  -LMP0/@|To t00t0%"1n0 K p匕 @1Sm,: -0 5P=5U@<LPP@P7DPt`PpPlP``PpPXPXr)Q`blr#QtbkP D P0D2  ! !UP @P0@2 x! d!?P <ݓP R5+Q P 5;5Q 0S110C1<P5 ;%5 - !LM'NPp `0O?  P  L||  ǒ0S2020K# p ='|R5 -0 5P=5U@DLPPLP7Pd`PpP\P|`PpPtPptrN|bj\rNdbޒP |P02~ ?x 9ȒP LfP0L2h x)b d#겒P DPPDRS ,M `B`LP@pDk 1T51T&*0T 0T p j @ p>@ X50530 R0V0}4Pp040T(0P\2i 1i i i i -%> Rt00t0,: -LM0`5P@ j2s 2SC 7P< 7P@4 =<? ,Pp tiXj?<? Pp O0D  p偑宐%@ %5;5Lp8?"΅P? P2Pp p ;<8<<<<tP5;PU`0p ;i5V;U5 VV t00t0Y V hLΐ(K 0| P(0St0p000t0p01S h  -RLM R0K R 嗐 JAq- $0A0 0!q "f -LM 0S4 0 0尒P 00p6: -LMP`^p@ 8h ἙP@#?@"Rr2/@3S0 KqP@000400 s4 ?080@0<0 `Tk80se <0sb @0s_ lh,`K 0P@JM   tPr1tp!51 !01o !4018  <0 !1p  0@G$ R "0"% P0 2g Č g024⁏P  0S 0S 0@T0S@0S80S0S<`LC< C$ 64`0@  (hTph#h'Q Q -LM┡2 S`( tp5 U  <5   (0S (0K )[ 0)KHRU@ P5<5  0 D0S ?0 00U@P5 hC< p-LM2`SP4"8 "4D0 hP&4<H0 aPOD0|  `̌20CS2pᰒГ ,`ɓ pf5<<8<< p-LM@R40+P`  0 J @pHP@ MH1+(  `H7pZ;< *>0-LP $@7P  0S 00DP(7  PM7  -LM*N0 S   0%P(7  P.7  -LM@2S"2S 5+Q P 5;5Q 0S110C1<P5 ;%5 p-!L!M*^0@ `0I @;\< l1L0 H   2022@0CS2T20 2p 80Æ 귑 Y<e5C< -PLbpVt@ d5X;e5 XXmcdt00t0岒 tsX 2H02%20CS2|p00p0 G 1S B;< -LMPp2S@t` RA R00R``V h0l0h02P(T AD0  @R202|20CS252D02ы20CS2(Gh 0h`,0K r 04 C, x00x0 R l00l0 @h00h0, ` c U7Pl00l0 <P  B c f5l;< -`L2PS@pkc1TN1T:*1T* 1T p c5 - R @R @ pf y^ @ g5050 RtVO t(4Pp5@ 3tl0T `0TT0P\ծڬD0T/0Op2i 1i i i 5i i 6i( p-L Mt0@0t0P`8Dc*N0 K`垊 1S cp ,:t -5@=P5LUPDP9HP `PpPP`PpPP02 r6Fbr0FbxP HP0H0 p \bP DPDP $ <<<<<<<< 0-L2_S2(0S0h;C$@T D0@T0 0-0L"RPO 5@00"000FC000,  0P2S0塄 -PLM@* 2tpS&_P`" }bC"R  \X0iCb,0 00 0S "1S 9Pm5=2/02 -LM@ 20CS2hM 0-PLM@P 2 SQ 0 @      K0  [0[Ă p-PLM@`P 2SQ p @ FĠ0 K K`K     0SH08 #\ 08S0 S f -LMPp`o@ y ͒PR!1 `/`$ K∉P $@0PT3 2S $2S (2SPa0@;` 5X0p ! 1PZd Y0XPr0PDa $܈P 0 S00S$" 0@T00S("00S "  02.<8<9 PX 0崇p00p0 9C 1S 2q;< p-AMLAOP `0$D P 0XX  &Ph20h2p ?pv5C< -LM@0 R5+Q P 5;5Q 0S110C1<P5 ;%5 Uq p-0LM @R0P5@ p_`7Pl 7P ,2S %@ %5;5phK_ P [q;<;< -LM@"> ?PP#> 3pPP? '΄$ @p*oPP ˠ, ` PLyX 4Q M D{5,u5;<<<8<< p-0LM@PQ00 5@ R R00R``V p2020SU,ph鞆t"0 bqL;< -0`@LQPp+^0T 0T p ^505-h0T  R\  @ p@ "qi i i 0-P@P0L HR 0t00t0 1S 0hq,: -0 5P=5U@,LPP0P74PX`PpPPPD`PpP<Pow 8DžP 0eP002g x(a d"걅P ,OP,RR ,L  X< j ;H0S D0SP5P@@05%+%[ pl0[&@$  /;<.L5=;< p-LMBPT pLD <` 00@  \T ph\.'Q Q -LM2`Sp`t5 X  <5  o$  HRU@ P  0S- P  0@pU@P5<5 Y   H@ o 5 &* p-LM2`SP4"8 "4D0 P&4<H0 PO̠D0x  `嬀20CS2pcꃈ (D`| p5<<8<< p-LM@R40+P`  0 7? @p<P@ =1+(  X=7p;< *>0-LP $@7P  0S 00P7  ĀP7 -LM*N0 S   0ڀP7  P7 -LM@2S"2S 5+Q P 5;5Q 0S110C1<P5 ;%5 c p-!!LM*^@ `0= @@;T<d+ H  @妀2022@0CS2T20 2p顇 4b 0{ u<@5LD< -PLbpVt@ UY5X;e5 XXm"Yt00t0q t2 X 2H0220CS2;p00p0 b< 1S K;< -LMP`2S@tp RA R00RppW h0l0h0P(T ̠AD0  @2 02;20CS22D02吀20CS2h 0 hp00K 1 00 y00S,KA p+0[l00l0h00h000 0C00 0 0pX `7Pl00l0 <P  sX P5l;< -`L2PS@pjX1TM1T9*1T) 1T p OX5 - R @R @ pY Q @ g5050 RtD t4Pp5@ ?tFl0T `0TT0P\կڭD0T/0p2i 1i i i 5i i 6i( p-L Mt0@0t0P` X*N0 K`_ 1SWp,:t -5@=P5LUP}DP9HP `PpPP`PpPP02~r:b~r:b9P H}P0H0م p Ӆ \ #P D}PDPą $ 꾅  <<<<<<<< 0-L2_S2(0S0h7$@T \90@T0 0-0L"RPO 5@00"0008000,  0P2S0by -PLM@* 2tpS&_P`" >W7"R  \X0iW,0 00 0S "1S DL5=2/02ᮿ -LM@̿20CS2h p-PLM@`P Q pV pU UPpU] U 0ll P`P`0U  XU Q_0UPdD<6:B7F p-PLM@P` 2SQ pUUphU] U 0h h `P`0U   U Q_0UP7:dD}0pT0P0W0@@X0 2ˠ D ,0 8 H @ < 0@ 4P (` ^z!1XK\8}P@P 0S0T0 0Sx 0d0d  0a0 @|PP 0 S00SP 0@T00ST    Y |Pp  <0R ,b(0!0@ (1$R:0S0H05 S0D0 < .S0<0*꘻;EʖQ: 1ʖQ- KQ 0     008#(< S SwP0 LP0 S  S08#(00KQ Q Q ʖ Q K Q Q $0Q   -LM\0@S@0s D0S V0pP `K0 xV0PEUU V0P fLQLH4@DD0d @}nP @ }=G<$5G< 0-\PLU@ 0D0S oPDnPHf㻯DPv [v U`B0x0f   Hf <0+S`d L ! T0S4XT0 hP0jPD 0jP\ 0) 0X T!0@ 4<0hP@  00lfI 0 S200S=+ $0@T 00P P P 0  堣l0 %c00S|0 00Sh0   PU8<.<9:( >@mJ0a!@00CS0 k 0S A ` 00C! 0Pa0 S AP?AP#xAP =d1 bpeX dP00l l XeX cP00k k @eP cP00k hk Ti(!!xK07!0K$K#@K(@K'@K%@K, 0S  Yh\ Z M< -LMT;@SP `Ktp 0 S K U0 0KP  [PP_ -"L|M0PK ,0 ͊  0P@0 2 ,0S ,阐Kl Ͽhh2 Qh00KT2 K@K@K 0@ K K0K@K00K!*0 0K0+ KKK0KK@K7S@K S000K1n p K`P4@'pW @0P0`z'K\1d@ 0.K K0K-@K/@K l tP@  P@ HP@P  0PP@}  0P@s  0P@i  0P~P@`  50Pu@Xh<:N<\ Z * + -LK W01S  0 TP@51  >SP@,.,$; p @paU TP@%@ %5;5.3. . .-$ $ ( 6 D66;<;< -PL@`p .10&S^4@6A6A6A6x@6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6A6@A6@A6505Y0 R - 0%@  Q @Q @ AN58:88: 8:  @I 4P5A0AS  -LM5 A0AS@%P 0 R-t0^0pt0 P`P 0 `VPZ1SD-j KT  -LM@PS-5p=5u,:nS `0:S   i-T0 XS0zT, SS,z -LM 0S4 0 0WP 00<: -L M0p9\@  \ ^P0`  o. TP  `T ))0@Y9s 9s |2|":00 h z:@ 0 ,:D(J1[   2 P!u 9  070$71 7 GT 㞏N )N>Y0ڈ1!51 0|!|1 0 ( p5ᄙ P1!1H1)1< - 0PL@$7QJ6J6 K6 K6K6S *` T  T7l8101 aT7lT7l 'TwR # 'RR( P`  P 6|h0 L 'R g 'RT \7sT f(=gfffh:O< -@L^Pp `L mj zjL -LMRP`0p RRX xV t00t0 TR* @ `* B*p00p0 k5;5ij*O< -LPIM0R,0 4 0p RRx,0 S h,]R ˠPB04  @Q4P R>K Q0!#Rr0` VF 8! k P@i " 1[ @0 0p0V 4 8<#8:#:0 073*|;`S80 @ 1S 5  ), 0 K0$A ;8 1 , ( @ U@ 7 X X07S@ @S@ @! f  g@ VP Q@1PPXS%X   C  X 8GPP JB\ʔn4 ]'0`0000'0!\:  0 @0\p '.40Py X \:Ÿ  PQNX ~MP@:0/. 0b < ::02n` 8\: 41  i'8 0PP(   PN.MP@ :0/. 0b:8,0 S 0,岼/ @@ T7KKl  .4 0 Tǚl0$ .4 00 :P>:>:>:>:0?:h?: -<0LM @R (;),;@ h 0-h0PL @YT'3H<#(R 7S -(K 7S  0hCfdh p-LM\00 @  P PP0[o@`, ( ph# -LM0@ @7 ("(  h T=\  V 0-0 @L$8P0 $  0$0h   0-0 @L$8P0 $  0$0h 0-8L@0P 5 ( "(  0hDPll6tl6|l6l6l6l6l6l6l6l6l6l6l6l6l6l6l6840,($ :::::::: p-LMPK 0@#[0 01[8#Y#h #͠##: 0P` -l˄hp;t[xk0--  0. <0p -L`@0@D$cTdTDP@p  @}TP K=:: p-LM`PV@ V@@|0 L\R@ YT@  8 , @ ph  0-L@PTT T 00CS 0h( -LMPc0@1 @T@0>S @#cTdT  "bPTX7l0T'!NlU0.NH qD 0m~@pm !0@T`0p HP S 1  <0 ?GPU> < 0 5GPEPT8P<1)-4AH L:  @HH GP  Q 5QN n   =5;5%@ % 7 S  A vO \7pO H@/\=:"VSP< P8$0P 8)l0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4% 8P0 $4P0@8$ 4@ 000 006 0060@006  0060P08$ 4@00000000006 0-@L8P0$ 48P0P $4$0 S8P0 80 -LP \@: p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph\@:SC2<0 S T Q P0$8 40 X>p8 $P04<+Q0  T0` `  Q' (Q$ P$80 88P0$ 4 p P$80 88P0$ 4*98$P 8p, Q$8P0 4\   $4P@8$0 88P0 $4 -0$8 P8$08P 8L0@:S<@: 0-@L8P0 $408$9P 8PP$8P0 4 P }U0 p-LM(0@`PH 0BS l668646 H0"S prvp H0"Sp H0"S 8P0 $408$;P 80% 0 8P0$ 408$9P 82p p-LMP`0 P0 ,08P0 $4P0@8$ 4 ,00,0 00300 00000pT000 0 000 00000000 00600000S p8P0 $4P0@8$ 4@ 00<000006 -LM 0T@啢P  @%#,00R0S ? xU  R;X0 X00 X0i`0W< C:qx -LM(0@p` RP2 *R  H0"S 5 `X2T` ,P`0d 0S`0T0``0T06R H0"S H0"S5 0T00pX2T0 ,0qQ* Q T00T0QL0X•Tp ,X•00Tp \0a6SX•T00 \X2Th ,X•0T0h \X2Tp ,X• 88Tp \06S/ X2Tp ,X• A QR\ 00000X2T0 ,00000000X2T0 , 00600 006 9 @  X0 0060  X0 006 X0  006000'.0 SSX2Tp ,X•0T0p \@006  0060000  p-LMP0T @`P V @X•T` ,0: S@ 2}TppT00T0pX2T0 ,X•0T70 \X2T0 ,X•0T<0 \X2Th ,X•0Th 0\X0 X•X•Tp 0Tp 0\X2Th ,X•0T0h \X2Tp ,X•0T0p \X2T` ,X•0T:` \ -LMPh 0@X”T,X”0T0h \X2Th ,X”0T0h \ -LP 8C: p-LM@P`   0?>C2<0( H 0L80P` 0d0T  $8P4 00 X0pph8C:S<,C: 0-(0PL@ 7 0ES 6(666 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% \0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000000066 -LM@<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -LP C: p-LM`@P  (0H0 L8 0?>C2<0 PP @ 0 0d T0P0 $840  X X0 \0  php$8P04\C:S8P $#R4$0 h0LPpb U' ! 0ESWW 8P0$ 480$:P 88P0$ 480$: `48P0 $408$0P 8WW 8P0$ 480$:P 88P0 $480P$0 8P0$ 480$:8P0 $40P$8: 88P0 $408$@p: XgH= -LP @`U` @\p0 T@0 ThXgX=8#8- SP 0S P 0S\^ 0\: -L -8 pWL`P@4S PONU @P8 >P P W8 p -0 L!$ -LM@0 T - 0!L $ -LM@0 T -LM@0 \ -pL`P,@ PUO00|0 S P0000 -13a"!L$MP5S@` 80K(040K00 ,Pp  0,0 0 4K8  04Pp  0pت80 0  Pp  0%0 Pp  0\ 0  Pp  0==@=== -L M a `@" P   0, MPp@Z(0SP  P  $0 ( (0^0,! 0  (0 ^(0 ! B010(0S0  0, 0,x0U  d0  $0 ( 0 p= 0-H0LP@   0!CdQ0x50 -L M,  a "@ <1}`PᬀTp@) ! 0  0(0S   $0 ( $ 0 , 03f1 x% 0@ @妩( 0@垩8=x= 0-P@L$0  00 -L03aqp0Ql P P@l% *\`@V,0d 4l%_=== 0-LM@ P@  0@4S0 0 0 0h: 0-2L@,0 $P 0$'T0j= p-LM@\H0P p@o`Vd$d7 = S2 o p-@LMT`PT0T H,@0@   404@0,ߨT phڨ==@ =L =T =d =p =;V> -LM4 ,0#4@080 è 3R 4|0S0 @ 00 <04@5@888 T p 8 !PE8 O~Z p|0S Z`pP,@0PUOW80OnZ `  2  0@0 ]@\p 0@ 0@X d 05p_0008 0!< _ Ÿ4, K00K4S 804  "4S 9PQ p0t p`t0  9p@PtUt0 PPU 0$@0 8004804   , 8< 0000 4SZ 0 0 9S0K4 ,0K|0S. 00p ;000d ' 0@Lۧ0|@<֧|@0 =8: = =7 = =8 =P =!7d =t = -LM`-彧 帧|0XㅀS 00 A>000d 00400 6 <80`05pP \p  (0K80O^W P(@,K@* =;!7x)77 0-L@PB  ,0\R0h (0 ,, -LM`4 -@L4+0|0 S0  ;T#000d @3R 43R,3R*$3R 3=B 0CS000000 405 2R2R*2Ro2R25f:0600"SS22`00<0880pW P uP㬀80pO^W Pp0t@ 09 l%ݦ04 p5S A,0K0K4 @pp5S P p5S `p5S4 9pt 0@ R0 00R:0R1R1R 0R 000R| 00Rd`0R] _:=BW0RW 0RS 0|0R0L0RI x0d0RD h0 =!7$$$!$$$$K$J$.017t47 =7$&%o&P(v'qqʄ -LMp -G &|0S 00"A>000d 0 506 0 040080*2 `0<0 2Py 2Pu 2Pr p0t `0FS5880`VP \ 080`O^V Pĕ\  ,0K A0K@4S `4S 0 $  @$P0#4 ``<4 Yp0t  @$P ?` 00 p0t  $  @$P0#4 ``<4 u<0P f:=@0CSb` =!7x)7%$$7% -LMp0t@  2"r,`9r. d2 pL"0U RB = ,K+ K@12d1 ,0K @T,[ P+[@p12dQ00@TY pt0@ M ! 0 T0p 0 ͠ 0S Ɨ+K,KR01,0K, [+0K  0 ,K+ K0,[+[ 0Q ,K0 0Q 0 ,0K+ K|0+[,[t 0Q 00+0KT0T 0Q, 0S0!,0K, [+0K  x>Affff -LM8 P8p0@ tp0@tD p0tH , p0tT @ @$41 0@00 4 @98Q48 < p,@!8,27, 2<O^< p4Qpt 0@ p@t 0D pt,0H p@t00T 8oz4! 0T0` \#X3 QQ H3Q @3Q 83Q 03Q (3Q 3Q 3Q 3Q 3Q 3Q 2Q 2Q 2Q 2Q "2QQ~ 2Q{ 2Qx 2Qu x2Qr p2Qo h2Ql `2Qi X2Qf P2Qc H2Q` @2Q] 00"SS RO000 0R0玁0 C800 ( &  1 ,!`, 4< 04 |< R <Y6 @9-<  0R0` D` @90 0'0  R0000 0S0:0 0 S:'0 00'Α0 0 00 X%&$!$J$K$$$$$$$o&'P(vf -  808 0 0 0 ffffE-08 P` @TP0 p0P:P 00^0:0SS00Q  00QQ0 0Qffff 0@-P@ 000 000 00ffff -LM`4 -Ѣ4|0 S0 1!00d 0 405 1Q^ _1QZ 0601p`0 080< t@ 8 8 80pWP  g0Pᬀ 80pO^W Ppt80@ 8  0l%偢4Zpŕ\ ,0K4 @0K@5\8 8 pŕ4\ 0_0,0Q0 =!7Att4>7 =7it -L MP`0p0t00 0H 40 p0tP 0p@0c,Ÿ2t@ ,  p,@ pWOYDpt0H p@t 0P  ! 0T0g! 00 4 2 00, 8  R00ą 0g a 12  07\00L000Ũ0 ` 12 # 0# 04h0 PQ 0 0Rg0 0⬡00g0::: t = -LM4 .04 S,0#408 80 2#S  SPPU`40  0 p0@ p0 p <S  40S 3'P 2P }2Ps Z060470|0 S0  60+S2 d000 00"040` <588@80pW P8 P㬀80pO^W Pp0@ t g0 l%804 p5S A,0K0K48 @p5S P p5S fp5S4 80p t 0@ 0S01P0?S٠0}ՠ0y0S0P 0PkƠ0j0P 0Pa 0  p0@ p0 p =d1t0 =!7 E7 =7 = = =w1G1 ='21 -LMP@p0H tp0tP 0\"0c2#ppA2  ,2  2Q2 R020ĕ!0SQ00ė`, `VY~pt0H p@t0P  ! 0T0f# 00 ? = 00 6 b"f, Q0|  Q  Q  00| 06\00L000Ř0 ` 12 # 0#d0 ,0 s|00Q fjnffffff -LMppQ0 @3g1tP `.0 S,0#4 0$P @ p!p1W0`4p@0P!QWP5Ť4Fڤ4S$(> W 7 04 0 t4S@,0K0K @/4S 0EP W @$PP  < 4P  0d$4b R==I=J7 = -p0`LtP p0T t 8 pW P@4S PONU @UU 1P8 8 p -`L-P`p@0 <00 |@880T +80@Tt = -LM.0pS,0`#4@ 0P $@ |0 S0 !00 !Qc [1Q0 1d00<01 `04 8580PU@ 4SONP @80Up@tPp <<p <T0 00 T0p@tPp 04p pPt@x 04x 6 D0Q40 00 0 00 =HF!7M7XQ7I -LM8 /8 0 4 ,4可^4 0Q8o}80 0! 0T200,0  a002Q 0S0@0 20,0 04  00 8p`0tpS4^VPTP@  !,22 4Q[PXP8 p0@tAs@ 80tPp`Q@ @0sPAp40  0P Q55 @0080t@p0As@  @RA80@*R40ȁ60S4040tApP`s@0p< 0 @A 44< mp0x t8 @P00@  fff -0LSP p`p0tpPt`@P @00P hp0tT pPt`@T $L4<T -0LMpE$x@|0 S0  `1 00X16 d00<0H1pPt@ 4 5`08 00 p@tP 00 pPt` @ $H@8@8 80PU@ 4SONP @80U =;!7U7 -L$M8 4 803a410. <0 ,0R8#4 @ 0p!@0  h1<\0 4vO<PE 8 20D0 D0pP @tp `@A 44  Z8@ 0 @0<S0$0@停,0K40K<@ @<4S4<8 @0L$,j==8:@ =L =T =d =7 =8 = -LM8  < 0 t0p@0 8@ !  , 80,4 *40叟0S40 8@@A@@ ,00 @0 R8oO8<0 0! 0T40,0 , j 0080 S"` BX@ 0 SP4 84 @,A08@T@D0 @,0 0010"00"`P @ R0!@2@ 04 00 0@  88@ @  00P0 @007 8 4@0!A,0`@08X@Dp0@ ,0 @TXPh&PA04@ @ &l04 @0 4 0.0 '80@4 0`A, @08\@Dp0@ ,0 @TXPh&PA04@ @ &l04 @F:M:T:Z: - 0L @p$ `aV2V `0 Sbs 0@ ,H2 RR 0D ,0S * "0 R- 0@ \0 S"*!0` R 0D \pPt D0p@t0 mpPt @0p@t0 pPtD0 p0t @pPt@0 p0t @x} 0$ ` `8`0$ `[ -L M p[0MD2[Pq 0$  @0$ B H$ 08Tb 0 $ @ {P00P@ |;0 S:Ӑ0Ռ00|0 S00 40 8!A> 000d 0 506 1!`0080l <. ,0R#480`ㅀVP \`  (0K80O^V P@,K@4S `` 0$@  0$0@ P =;!7`7`a77h = -LMp`  ,05\R(0 0 1Pt@  0\ip0Pt p@t0  80 ,,: -LMp` 0,  Rd`?ڰ#0稃!01Qx@  |3\tF`#0 01Rx@  <\(3#0 01R|@ 0 ,@0S b7b7b7b7Td7 i/ 0i(0SV   0S1 0  0PXU22002 0#P P i 0 $  $ 0 $ 0 $  0T p0Pt p0t @qp0Pt p@t <Jp0Pt p@t0 o#:P = = =; =( =< = -LMp `[0K肟[Po 0$  @>$0 A H$0 t7 $ 0 @ |P@w00 ,2R0Aq  0\3.0|0 S0 4 !A> 000d 0 506 1!<`0l 8 0(K P l 0($ @PD1(`@ (Px U! @18 3d1TP@ 0S 4S `җU ͗h˗p0Pt p@t 0Ph =: =;!7`7`a7=7== =L< -d!L`1M, H `, L1L0,0D!D0P 04 , 040 8 8P1 @0e!pS1#D 0   PP%U4 80 0R4 80 , 0 , 0, 0 , ||0,t t0 0 0, |0,0L|0 oJ7 77: n7Pn7n7n7$o7X = -L03a`^q\0@@L0 lŇ`IPU$T l% f = -L M1 p`$$x 1,0 $, @0 Q 1D!00 0 0 P$  o04 <0M>000 P$013$0@ P⊡ X00P  PPX, 001  8  R(04$: = =f = -LMx0@  001<@$0 01 $ p-LM0 h0 P@` 0 <@Tp 1 0  -00L!0D $ -40LM@0D T -00L!0L $ -40LM@0L T -40LM@0T \ -LM`P -H2p>m Q0 Q0 @0r -P@c |0 S10 !000㜡d @40 0`<58 @l(|HPC P1P!  D崕0 8尕4( K,0K 0 0 0|4S:']P 4S 0-pt 0|,K (0K]XuPr|@Dn|@L = =!7q7=@ =L =l =x =7 = = =t = -LM810,0 p P `,@0(`VOp0tL 01pp,0wpP  Q10[Y ! 0 T 0w 0Wp <040 P0S RQ0mff0@-p0"R 0\P0X@00"R  ^0S0, 0R%9\g f(0(#00"(R0 Q,0S009 -L\Mpt0H 0#80`x0 -PuG85pl 0 p0@ pD  0lK@0 P@% 4 0S0060 $0剔凔 f|0 S0  `4P00X$X4d 00 040< 85Pu7u7u7w7w7x74pPt``0P @$H@P @88P 8 O80pW ` P80pOnW `Wx0? W: 0  4S Cp0KtK  @4S  0P Wx0x 0 x0 x p@tPH x 88H 4S `x $D02pPt``0H @H $D@<@4H 1p`tP`0P @P @00P pPt`P @$HP @ZpPt`T @T $L4@<T 0 Q 0   0 p0@ p0D  @ lKPH D 00   6LnU06`@06@\g< =!7|77 =z7UH= -L Mp` ,P, p0tT A 100p0@000 0Z_Yo` ! 0 T % 0S000 PR0C 000 ,00,0 pt0 ,00!,0000@p0@Q@ t@A0  H0!80,000,0 0 R0 0Ņ(::4: -LMP$2p0,0 `,@0YO` p!t@ 0Xo ! 0T0,0 .0S000 PR0C 000S0,0 0\ L}7L}7L}7}7}70 0 |0 00pH t 02 0S00ą,00LS }7}7$~74~7H0   ,S$00::T=:: : -LMp4< |0 S20 "p@tP00d T 00T pPt`@ @@ $D@@<4@ x!p040` <85 t D῀8p0t@ t`p@PP@ @PP00@ 80`VP S\ 080`O^V Pĕ\  (0K L@,K@`ĕ \ 0 = p7Ā77 -LMn0 4 , ,0C, 叏 R, 40S00^pPt`@ @$D0@ @L<4@   0! $ 0!0 T ! 0T00 7010!08 @,pP@At`D@@  822 , @pP@AtpE@` @A844 ~0 RC0S0 ,0,4  0.4 ( f0 f5 f- f p-LM0`!$ 0!P $ 0PP!0Tp -LMp0`t@ 8 p WP@4S PONU @X5P8 L#P P W8 p -LM`L-壐 |0 S0 (!(1d $!000840<56` 08R:000480pWP \ 080pO^W PGĕ\  (0K T@,K@ĕ \ 0S` =!7@77 -LM, p0tD 0 ,`0XoY oY,0! 0 T,0p0@80 A@ tp0D@ t4  00(  %  0!4  0 P0@00080pP!@ A1@ tpD@t 4000   ,0!P4 ::: -LMp4 < Ï4|0 S0  <0S000 < 0R000<0S006000#;00d #p`tP040` <85P @P $L@@4<P pPt`P @P @@00P p`tP@ @@ $L@4<@ pPt`L @L $D<@4L p0t 8 8 p)t08  p0t 80  ,<0SM80`V P P㬀80`O^V P 0S l%4 04 p5S < 1RA0K@4,0K @p5S4 0Pp5S '80p 4t 80 pPt`H @H $L4@<H  =!77 =7؏7 -LMT 8 p0t0 t2"0 40 , ,P,可P, 8T p00t4 R o80 4! 0T@,`01 0.00 0000 d 00 0 H 00@,0 10! P0 4,  04 ,80ApPtZ@pt1 `@A 44 8H pPt`@H $L@4<H @ \000 QS0L00 0S0@@000 8H p0t0 PO 20 S2Ʌ0SɇGjffn -p0`tt L8 XP @4pS PONU @5 [ 0S  8 꺍p= -LMp.08 S,0#4 0偠 R R R R R 囍 z喍|0 S0 #3d #000` <04508  SR6 R R tw04 8080PU"@PS ` p0t4P 0 12#  P}80PONU @ Rm R' R% R# R! 0BS8RQpPt`X @$L@TX !@ @4<X pPt`P @P $D@<4P p`tPT @T $D@<4T pPt`X @X $H8@8X 80@S4 ,0K  , K00Kpp5S 0 0 a&h0K l%嶌`8 0BSR:80S0 6040ꅠ80AS =;!77= =l7 -L MPX p`t@ 8Q 00CSiꄕ7777(70DSW1堑, 00 p,@0pWOXo ! 0T p0 !t@ 0  00 0bZ30 0S00ą  0p !t@ 00,  Q 0S0@0 0 T DD0D@@0@80000xfffHfXfdffff=f f f -80ZLP `@p0 $ 0S 80`ONVp @ v0S0 ׋0 Tp= -LM`d(`84 PP P8P H8P @8P 88P 08P p0tP 8 '7QQ 7Q 7Q 7Q 7Q 7Q8  8 '7 QQ |7Q t7Q l7Q d7Q \7Q 80 Dw4V000 $7R 7RR 7R |0S 00&A>000d @4@5 Ɵ RR VR vR R RR X6R P6R R R R R R~ <6RRx R6u %5QQm 5Qj 5Qg 5Qd 5Qa 5Q%] 0`  <08 5RRN 5RK 8 `%\5QQe P5Qb H5Q_ @5Q\ 85QY 05QV @5@%<545  8p〆  WpPA` t 0pd@0t 80pW 4RR |4Rᐄ 80 \0 $0 T0 $0 T80pW P P#80pO^W P0h#d3QQ X3Q P3Q H3Q @3Q 83Q pt80P 0"2QQ 2Q 2Q 2Q 2Q 2Q 2QQ 2Q0 8 '$G 04 4S 0`"QQp $2Qm 2Qj 2Qg 2Qd 2Qa 1Q^ 1Q[ 0K4B ,0K@4SI !1QQ% 1Q" 1Q |1Q t1Q l1Q P 0X!QQ' H1Q0# 8 4'8  0 0QQ 0Q 0Q 0Q 0Q 0Q >A/>:4 064@0K:r꜀0 L0P 6@060000:00GhMhbiMibuuRur =3M8M0M!77 ffff =77 777 -LM`W0 t3RR^ h3R[ p,@PpWOYo! 0 T +  2 "   0P2 2  <\W  p !t` 0 P2P"008 $2$"0080 $p0tP @ ;:   20S`1  1 R20SU!0S00Ƈ  20S T1  H1 R20S020ƅ(!0S00Ƈ  20S0 - 0 R) 0B0 T0 G  000S |0  00S 9 ! \00 0B0208M0M#ff ffffjn -(@qL` 0 T $0@T , 0P^h 0T   T  0S00 -LM0` ,8pWP @4!S PONU @;2 \  0p 84= -8 ZLp `4S OnX ` 4S 0 0QQ$ 0Q! 0Q 0Q 0Q 0Q 0! $8 P8  l0A  0T0@ $  hMhbiMibuuRurp= -03a`pM@ 0L P m0$0 10 T5 $044 \ -`pfL  P 0m0$@0 0< T 0\ -L4M@ pV$:D6V^ 0,K P- 0,$4 0%Q] c5Q5Q:5Q5P 5 D p , (xx0S 240S ,*P0K  0 PPPPP|, 0x,00 0P PP6P 0 $4d  005 0$40060` <D4P 84P04P:(4P 4P l 04\0H ,00808 3ZH0#3L P0Dp4#P D屆  03jx1ଐ 㜐l%|p ]9P|H 0 1cA8 4 0#< 0<0/8000 P 0`< PLV 00P P`@PD LV8  01ca 2 0 <0&.<000 P dD OP80U<0/L000 P@  0<@ ,@=P0<0@ \!0\ s1` \080t!t1h l0Lh1P \1P T1T1P0,1` \0(1P 1=<@0CSQ 0D0 D 00Q 0Q:0Q00Q 0=C0CSĹ777̹7̹7̹77060H1 < `008!pS00W80P \ (0K80pO^W P  0 0@d  :9d x@,K@ĕ\  0 4S 0S00 =;!7(77 -L,M, "0 p0t@ 4 p0tD p0tH 08 p0tT @ @`00 00"0!D0 4D0` 8 n,0 < 4 8 ,@4YOpt40@ p@t 0D 0!Q pt80H pt0T <Q,o@0< 0T,DpT10 0(H0 1L0 0H T0 40!2P 8T 40 8 ( & 0S!PL0 bH1< 0h< p0, t00  0200 00   H0<0< 0  < u000rd:i: -80ZLP `@p0 $ 0S 80`ONVp @ 0S0 0 Tp= -LMP `42@HYp0t$ Ps  $ 0@ P mہ|0S 00t!A>000d 00 506 P1P!p<0`0l 4p8p 0(K P 嶁 0($ @0(P@ (Px X   @183d1 T `@ 0S  H僁X 8~ h = =;!7x)7|7=7== =L<-|0| H t0t L0P D0d 0`0 XX0X T0T P0P L0  0|0 7 77p7777P7 - 0$L0 $ -LM@ Ġ00 T - 0$L2 $ -LM@ Ġ20 T -LM@ Ġ40 \ p-LMP0 `$x0@4 0$0 0 Rx0$ ph؀ $  0S $$ 0 0 pha@=`=D f -LM2`p 0,  Rdp?DHP <2\4 <\}0@@ ,0PS d7P7h777 i邀0 i{0SV   V0S1 0  0`@dVT220025 J0#P P iA? 0 $  $ 0 $ 0 ` $  0T $P = = =; =( =< =  0-!L 0, 0 , -LM 0  A0 0\ -LM0 A8  #0 0\ -L M.0PS,0#4pp|0 S0 |1|!00d 0 405 00CS7 7 7(7(70600!0`  <08 `@  P80`ONV @0 R p0tH p0t8H  $0K x$ K(0K4S 0 0 (K900 =;!7H77 -L MP 0 R p0t@ , t3,p@ tD , !00 p`,@ 6pWO`0 R$ C0 R pt,0@ p@t 0D p@!t,0@ pt 0T 0! 0T00) ' 0 R  22 2 1!,0 0, 0  111 2 00% # 00 0S h1h!002,!, 0  0'0 ~$1$!0,04", 000 0S 0 002,!, p0tH p0(8tH Op0p 0,04", p0tT !0, .::::::: -LMpt0`4 40P -8 =~4|0 S0 1!00d 0 5 400oS0060`1 `0< 8 %80pWP  g0Pᬀ 80pO^W Ppt80P 8  0l%}4pŕ\ ,0K4 @0K@pŕ\4 0\4 0 8 8 ` =!7D7 =`7 -LMPpp0P tptX p0`t\ p` tr0jx!2#` @, @TόYpt0X p@t0` o! 0 T00  0 000c1 0P00@x 00000c1c00  00Q  = f8 f -LM8XpP `@4 S PONU @`$080S 8}p= -LM` } }00| 0R400 A>000d 0 506 0`  <08 -pP e\  (0K80pO^W PH@,K@zĕ\ 0 M =;!7x)77 -LMpt0`@ p0P t@8||0 S10 !00040 1d  6 `0<58Lp@0tP 80pWP \p $0K80O^W Pp0t@ ptP ,@(K@ ` =!777 -LMP`p0@ tpp0P tp0WT X t0 07 80 0, 40 ,A)^όpt 0@ p@P t 0pWT X 00t,0So;! 0T00"  0S40 00 0 55$$‘0 ,@ 0N,@ X000H000S8 00  04@0  Q0 -LM`(-{ |0 S10 !000400d  `0<6 5880pWP \ 080pO^W Ppĕ\  (0K P@,K@,ĕ \ 0|` =!777 -LMPp0@t@ 0@ 8 p0tH p0tD 4 p0tT , ,p,` 0pWopt 0T p@t40D pt 0H p@t80@ ,\oO0,@! 0T00/ - 0 , @ 0, T@0D0^  0080 180 8@0A8@ 00  00 `04@0L4@  P@@4  0,,4  nj, @0:5: -LMt0p`@ -pz |0 ST10 P!00040D1d  `0<6 5880pWP  \ 0 80pO^W Ppt 0P Tĕ\ ,0K @0K@ĕ \ 0`&\  0 W` =!7877 -P@p0L@ t`p, ^Vm[! 0T00  00 0S00 0nQ0A000  00 Q  p-LM 0P$, (@0Ƞ,Ƞ\`p . `0^ phUP0$SL0V \ p(0$S,0 Sl:727$9 -LM p$0P PY 8@4P,`K 00 `P 0 0 `P 00K P xy0$ X10  (PT  2 02< (1!Q 1Q  '> N 8 S 0 SdyY _y$ $@ $P< $`0 $0 $0< ==+!W9=L<C : -LMPD T < WA0 W3 # 00 3#3/ @ +`4TX $`…\ą$ÅP!E&"0BS񟗛77777 0K c )2[ ""L22RD02z"02=?0?Fn` 0Pg!l02>JN0@ 0PR44eP@,P:Px3 O WT.`*c\=,x-8P1D2S 045B084 0~B<2S4eoxmxax]x0 02>0X0u?:Pp 1TU1T5*1T" 1T p%!8 @ 44A8#  @ 8C844 % D@ _5 0 Rᖯ05 fc=4Pp5@p ~ :2S k =0T 0T-Pڜ0Pp\0S\X0T/0x?p!7P  pw}2i 1i i i 5i i 6i(`= 0-@L(2P ,0( 050Rw 50 50= p-LM@R0P`5r 2S11,, 1, 1  B !2 0CST774747,747<72 S( `%050%("0*\ RP wphCP v7 P C d5 @05%0+%YU!)- 0$32 S0( 0 00d==== -LMk@0p`(2 ,2P S01S 5@ @505DU!H0 U n5@ 1SK= p-L M@P!n00 1  R"0   $20CS2S+0.060pL10dSM H SC 41 R00660  0S p K V 1[ 0<0 KL  KH ![  1[ 05<; S ; S  1[; S05< 01[; S05;#00S00&0HJL 0-PL 0 SD0S67h7h77h7h7<7h7h7h7h7x7h7h7x7h7x7 00/00@$C00 06Sx0 h0 T T006S  0u 00 00= -LdMSC 0S`h ` d t  0Sp 4  A 0x Ė ` P@  505x08#(00CQ4ŖTh \ Pl h x#\y$,0@00$ 2  tP !P@0U0Px l(0l \ 4Ŗ4Ŗ\TM X"d00`0`00xĖ(0S40 p 40 t$pĖ(0S ^ (2^1! 0\2 S ` 1 Rat $0 ( $0 x (x0"00b0,0 \0KV X| * d\0KpP0tP d  4T K4 0 00 0P|0U @PX :kh045$05x$7470488L -(2L@1\`! ,I>᳠ X Up 42 0!X \(P"x U/P0("@`^T \p4RΆ@0 A mR88 0-LPf@0h9 -L0 LR E/+ 0B>>QPL5%0bS5% -LM(2@h2\``" ,(2–@\P<"C.,U (2" rR  ,(2"䁟QR@  ,T(2!,(2@!,T(2|!,P(2+,("@0+\(2"R  05\(2"R  05\("05 \("05 \("0+\(2 ,R^@0 88844(4 404 0-(2LP,,0@% 0 000(,\0 -LM2 S, `0pZ ATP @ ˯K J0S5`<5V P NT`@V*!K 0'2S ,0S ,U(2,,(2@0,\?  !. (2,,(2@0,\(2,,? @ (2@0,\! h,= 0-@LP! g L00 R 5@ J$0 @Q0h駾U L"f= p-LM(2P , 0`: 1 R pM @- !0S  2b3c!0#0Pd P0 P00[0ph//20CS(2-,("6-\, Q 0 0d [HJL 0-@L8! QA0P Q5=50hR 0-O 0PL$ ?2/0"0 $ l0,  $P0 /! P,2 0CS0 20r<= -LMۏ p$ P^ χ05;NP @P+Pj2S"@ 0$ 0CS@@'T`χ0O_ P@ P`P(+2|S* 0,K P@(,$ P0, p (P qqU qq 0$ `d 6·0O]P@ P`P $T=p==x7<=L<;== 0-PQL@x3"3SS3SS 3SSS0P3T#X3\#`3d#, 0-LM!^@ 05"PJ%PA(1Q20CS,(2*,/0?;C0C ?; 8c0 2].BS B? 00 / 0 ,38"P;0q0 Kb1[01K![0J"P"f=== p-@LM X NT1T!0P5 H1H!0 2 ; 00"1R3Ė  0Pp%4 AQ4 0Ė$(0SP$,0"@ $0  (4$CH{47044704 -L MaP PZ dDtÕN. 00 0ą   P@  ?0pPdĕ 00   0 Pp@ `&0 W p0W `WPp@0Wĕ(0S $0 ($ ll == -80LM@CP 00 -LM(2,0\("˜@\4\8"1B/\^u("@0^Ę"F/2,P\(2˜p\`!E/0\(2"R. +0\2#6I4R@@ SC  S=  S7 X1"R2 @S ("0,\(2˜@\!0.\( ˜0@\ J/0C\(2*,("<*\DH @DHDH("`4H \(2 z?\w (((((,( -LM`QDP& 1p @Wp\ (0S T (0 S$ $P0S0 @ WP4S04044$0(T$04 -L$MĐT(0$S@0 0> 0 0Q00Sw 5@t Ĕ@ @( 01Rp`C0C D0 2\20q $0  (  $0  ((B2S 0 0 0@ 0@0 0  0  0  00 -(2L 0\ -LQ(( 0 0\ -L M@K @ AK 0AP0 -LM00 @$0  0-0L0 P@$ 0 - L <$0  - L <$0  -LM0p0$`@ P0  px0@S&K  2[:: 2KA-` ^0P@p00`0A  S R0 ApQN `000 000p0 -LM$2S (2 , (2*,]PYn0@(*0,` (2),S~p`\*0@(U~0,p`,*0@(V~0,`*0@(p0,`)0@(W~0,`)0@(p0,`|)0@(}0,`P)0@(p0,`$)0@(Z~0,p`(0@([~0,`(0@(p0,`(0@(}0,`p(0@(p0,`D(0@(]~0,`(0@(p0,`'0@(^~0,`'0@(p0,`'0@(_~0,`h'0@(p0,`<'0@(|0,`'0@(p0,`&0@(a~0,`&0@(p0,`&0@(b~0,``&0@(p0,`4&0@(c~0,`&0@(p0,`%0@(}0,`%0@(p0,`%0@(e~0,`X%0@(p0,`,%0@(f~0,`%0@(p0,`$0@(}0,p`$0@(i~0,`x$0@(p0,`L$0@(j~0,` $0@(p0,`#0@(k~0,`#0@(p0,`#0@(}0,`p#0@(p0,`D#0@(m~0,`#0@(p0,`"0@(n~0,`"0@(p0,`"0@(o^0,˜ \%0x P%48@00P&`00XŘ0%0 00l0h%x5   t (2!,}`!0@(U~0,`!0@(Y~0,`h!0@(Z~0,` 0A @>-: 0p01K![t <@8#X N[/q!y012 s=:CS|6878 78 7878 78 78 78$78$78 78 78$78$78L78,78D78,78D78478478L78L78L78478<78<78 78 78D78L78 78 78 78 78 78 78 78T78T78T78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 787878787878 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78787878 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78 78\78d78d78d78t78t78t78d78|78|78|78 78 78 78 78 78 78 78 78 78 78t78l78l78 78 78 78 78 78 78 78 78 7878 7878t78l78t78 78 78 78 787878 78 787878 78 78 78 78 78 78 78 78 78 78l78 78l78l78l78t78 78 78 78|78787878 78 78 78 78 78 78 7878780S" S000 0CS6868686868686868680\00`00d00\0h00000 0 0000 0 00 00000 -LM@Q01-0R/ 00R0* R( 0ASD88D88P88P88P88P88P88P88P88P88P88P88P88P88P8888P8888000 , 0 1 000R 0{(` -0LSPb 40S\ 0 0\0,0\ 0+\0 @, Ac0 , p R R! R R 0BS:8:8:8<8:8<8:8:8<8<8<8<8<8<8=8#'00CS񟗅d:8d:8d:8d:8<<8<<8<<8<<8<<84<84<84<84<8<<8<<8P<8 %0 ,0*0 \0 ,}  0BSC R R, 0 0\0 , R R 0$#, 8"\<  Q0,, <4<,\0|", :P"\ @~!PP 㦰0 ,0*0 \0 , 3 \H 3 1S " 3 \<o1("Pq0*0\0 0\ 0,, ` @ 0,\0,,@ } @9`V  1 \,+  l'0 X N -0L SP1S 0-,0p", 5"\0", 5"\0s0CS"x?8x?8@8@8@80-,0@+,B`uD BB0-\ 0-\0 ,0` ,0ee@0 \0B0 0+0CS0vǓ,0`-,@0S= SS r0 ,0e0 \0-,0@+,0BB`ED6u(8(9IM -LM0PS[ :P` `@T TB@T) m@T  Tp p`V*0T1R,,0\0` ,V@5:@0S TT T 40S T ]@`TT 0DSZ\D8\D8D8LC8\D80+,0$0+\04$,0*+(0#\0A.,0/  0A.\0#,0&0x#\0l#, 8488#\@T 0S =  #SSK0 , 8 \;?V 0[,, 3[,\Q@k0\", 848("\@VMM@K q Km2[[`0`S "Q:@7 01K[ KJ0 , 0 \@ 0,\0 , <@>I 0,\0 , 08 \0S=pp SS 0 ,0!0 \_(9(8:IM -LM0@S 0S S0K P ![,0R 01K![^ P -LMPTP ( R Q0(0 Q$1S0(0 Q| i 0Scz0pS 00 ,2\0, <\0( 1\ <.\(0`0@\!0Z/\0@!\.0\1S  @<\8!Z/1\0@\<!.0@\< Z/50K cPp  1[02 \Q Q 0K IPp1[: (_  S00 (0X0`!h! -0L0CS@`n0 ,0PS^  P  PP&(0SHL88M80M88M8q0^/0\ 0 \0 ,p㠬0S 0 ,P P厬0 ,P1U2U0000PDp@p0Sg`0$ ;\'  -LM0@ ,0S10@ +0 \ P )P0 SS SS S S S 01 KV1[01K![00a-0 \ P -LM1PS ` P@ 0S 0,, <4<,\ 0S P@`K P@0 S Sg1[ :1K ![P@0S% X0PpS0XS00< S)   P@![ 0  WT W  ^P@;1K![W:*!K1[; P@1[01K![>P@}  P@v1[:1K![ -P@l![0*0Q!K1[: Q1[: 1[:1KlP@Rk: 0-LM1@S[ 0S 08"PPK jP1[:1K![P0 , 5 \ LPP1[|01K![P` 9P1[D;1K![P( *P1[ 01K![PPKU P1[01K![U !K![P P1[ `0R1K R1[ 0 1[`01K1[ 0R1K1[01K![xPs Poj40R 0-LM1@S 0PK P;1[;1K![` !KQCU8T8T8U81[ 01K1[ 0R1K1[01K![@Pt0S P1[t p0R1K 1[<1K![,!K![%P0p P0R1[<1K![+!K![P 01[`01[@0 A -LM<@/0<,R/0< 0S<0< P  KcP1[<1K![P0S01P -LM0@SwP Q PP -LM0P0CS!rP@  K3P@2[?02K"[`P@P@0SN 0SSD SB S: S2 0S) |P@ `pK @T @T 1[08#h VP@P@ FP@P@ }P@ Q>Q.2KP@ 0-8LM 3Q01K@PA. 00, ?0 0A.\< KPU1[1[;;1K![0 -0LM 1K@P0A. 0, ?00A.\8 KVP0 1[;1K![00 -LM K@AP? 0SI  K 8P 1[>1K1[![ 01K1[,@01K1[!K01K1[<1K 1[<1K(0St[8[8[8[81[;1K![P  0S ![ P1[;1K![+!K1[;K -L M0@(@ `,P" K[P@2^02[ :2KRR2[2[<<2K0BPPS"[2[*"K2[=Ã@0Ó\\Ń2K 0 \ 0SS S &K P@ 2[:2K"[*"K"[(P@"[!P@a0S5 BKP$pK @T }@Tx2[}H0E8#X 0SSn P2[|: e@T \^0EP@8V#X 0S S  ULP@2[ 02KR2[2[002K2[02K"[UP@  0P@2[p02K"[P@{ P@t2[;2K"[P@j00CS0S0SP@ P@SU&K P@G2[02K"[@ "K"[qP@H &K P@12[`02K"[^P2[@92K1꠆ 0-0@LTP+?@@@, 9:6+\0 ,0 0-LM0PS00 , K@KPM1[ @@1[9 SL  SL 0 \0 -LM0@ ,(0S(b8hb8tb8b80S0 \ 0-LM @0BS0SR 0SP R0S0PK +P %P1[   KP KP![  1[  |0S 0(0K KoP1[S(P; S ; S |0SS 1S 01[; S1[; S0 -LM0pP ,0` ,@0DST1ST| TP 0DS@ 6T 0^/,P' x0-,@0 3@1T0^/,P0 , @ 0^/\ @0 \@00S00 01^/\0 ,0A`0 \P` 7 S&pK 9P` 2P`{2[ A00CSv R0SORK 0S?IP`\1S (K* KsP`R2[S 1S~ 0,,0 0,\@ aT 1Sh 0 1,,0 0,\U*P` 0 \0 , 0 \0 0\ k0-,@pT0S01 -LM0@S?`p0F00 PU 0S 0S 0SP0S0S P0S "K ]P2[P  SP dR R2[@002[  0 ,?@d0 000 p-LMP-@`K %\ \0 1[ 0D8#Hp p順 -LM 0@6 \0 , hƤ -LM 0@6 \0 , h鮤 -LM@8 #80CpP S,U  `K 0 066 0 0  0\0 , P -LM0`@ ,pK 60' \0 ,vP8#hm0 ,0 0 `w0PUXm -LMh0!XS@`+d0S& IPp 0,0 s``V V 0( 0\`i"i\[ 0-h0SL@!Xd0S0hJP0@ , 0 \0h\[ -0LSP`= P5 0SS& S$ S p 5@pW0SW((**P@ V("(P@ 0 , p-QLM@`P.0S0(6 \@2f0 ,@?Tpp ; 0 p -0(SLP`"= P5 0SS& S$ S p 5@,pW0SW((**P@ V("(P@ 0 , p-(LMQ@"hP*0S0(B6 \@آ0 ,@ Tpp 9280 p -LM0S@ P! px8`8V04 \㚢04 ,0p, -LM@08P `#x ?88PP04 \bh0, -LP P@ 0SuSh p P@_0 , 1` \0 ,0 Sd! 0 \0 ,0 S. 0 S S P@ 0S  0S@0,, <4<,\ޡ 0 ,p0 ,0L@0 \0 ,D嶡0@0 \0 ,' -LM@ZP  00CSx8x8x8x8x8:P  00CS KP1[91K![0Pq p-LMT01K[ 0K a c? #P80S S p 0 , : \p麺' -LM8@(\p!X"h7 \'V00 eV0S0S$ 80S P80S  0@p 0_@ 0iQ 0i' (-"@TLP!x8`:P6 0WSQ   !T*0 "! 08#H'P T:T: -LM8p Ƞ,Ƞ H.P ` B("(V$+*  !0 @0 ,0208#HTT x08#hV:  ("({  B("(t -L M0SP)K*K4s S 0S 0 ,%o 00 @4@ 00pa0 \) KJ dȚ) [ X* Kd㻚40 SPbT*0[@=#=*0K* [0P0T40 S'@* K*0[@0*0K* [P 4@00 @0 T000 '0d)0K|) [ X d0#4*0K 00 00 0!,@0 ,` @RT:T < S  7 @\T:T0M0 ,` @.T:0,0\꠆< p-LM@K0 `Pd\0  [ ȠXP0![00 p p-LMP@`K0 C08P#H, [T 1[#4000C S З8З88888З888З8@08#H T p0 ,00#0p - @L> pR0 RpPU `3)*0R1+@ 0\0 , 0S;@0 0\0 P,U` 5:1Spp -LMP, P Ppd W11@`2**0P1+@ 0\0 , 0S;@0 0\0@ , T`5:P` `@T*0P1R,,0\0@ ,T5:@ T*,` W0 *p@ T`:;1SJ0 S8d888\0 1" 0 2" \  \00  12\ 0 3"\ 0 -LM 2R@PP0RqR,,, 0Rh 0RR,,0\0 , 0PE!R,, 0SR,,0\0 , 0S!R,,0 -`0P4L@8UDp:U)U' A0U!+@ 0\0 ,0!S +@ 0\0 ,81S -PPL`p P @0TP1V,,0\0@ ,T;!( 0r` p-LM0@Sp0,,0K =PMQ![C (1RRQ!18 1K`P1^3 @R П8П8П8T8T8T80!2200@S 8@8(88@8(88@80!22008#Q0!220!2200 (0![R 0p!F -LM0@),0 x(,0 \(,0 @(,0 $(,0 (,0 ',0 ',0 ',0 ',0 |',0 `',0 D',0 (',0  ',0 &,0 S/ 0&,0 &,0 &,0 t&,0 X&,0 <&, 0,&,0 &,0 %,0 %,0 %,0 %,0 x%,0 \%,0 @%,0 $%,0 %,0 $,0 $,0 $,0 $,0 |$,0 `$,0 D$,0 ($,0 S/ 0 $,0 #,0 #,0 #,0 #,0 t#, 0d#,0 <#,0 S0#,0 ",0 ",0 ",0 ",0 ",0 S0h",0 @",0 $",0 S0A,,0 !,0 S 0!,0 !,0 |!,0 `!,0 D!,0 (!,0  !, d@@@@@ @(@0@8@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA AG-`0M@O0L 0P 0  @P@ P(P,PP00 ^`@0@00 `P0@ Rf  0P@ 0\K @\A \4 \! h1\ X1\ P1\ 0Ѝ0P@ @0pW P@0`PU` ` P `@0 P J0S(1S 0@0S0 -LM0@0CS꤭8888888888888`8`8`8`8800040,00 ,-0 R4 Q 9 S0 S00 ,00000 S0 00Q000 40,  KvP1[0?>C20 004 0 -0l@`L P0p  \0@  0\ -PLM8 PP 0Sp Sr S> SS 4K !p@040C* K08Pd`#H2[Ġ0L8oS  0Q 1P8 T#X 000c8X ER 8004K !`@0* K08P#H2[0A 8}S XV`!TU0f8@!#X Y7#X,! 0AS008  * KP2[0SX8p8|8L88<08 0|<s0s00* KPn2[=3S񟗡ر88888202P0Pn0n00::z:: -LM @RR R R00R0SR 0 KJP1[ 02  KAP1[? -LM4`KP@ 0S T0S4 X0S h( KP@L P@4-P@* P@3,P@͒"[P@X ( KP@ tP@t崒-kP@&Kp @T#2[92K"[)"K"[T08P@#X3,HP@划"[?P@00*K, KP@2[S{6K8 KrP@u0S/ X\n3[1Sk&K  pP@`bU  08P@#&0[pWWd`X:K0X0i P@B 3[1S&Kp ]@T2[92K"[08P@#X00:[/ N5 -LM@Q 0S0K UP1[L'S  R  P P p-LM @0BRS`Pp0 S S S  KPVI0 S S; S/ 1[01K![~P0S S p KP1[01K![hP p KP1[01K![XP p0P0.\1[01K![DP p<S/S S0 S S$ S 1[01K![.P KP1[01K![P0P0.\1[01K![ P p0.,Pq KpPl p p-LM0@ S`PpSi  K\PV<0S/ 1[01K![P0S S p KAP1[01K![P p K1P1[01K![P p0P0.\0S 1[01K![P K P1[01K![P0P0.\0.,P 0-LM0 S@!K S 0 KP 0 _PPK P1[<1K![OP IP P1[;1K![:P![4 p-LM`P@0!, ,0@T:p 0-0LP,,@ 0,,0 G0@ T T 0 0 -LM0@D ,0 S P RT[PP *0 0R:0` -L@0SP``0SP <0pR` `W0 IAMT -LM PP@ !P@ P@`pK @T S@THN1[0S 0F8#h 岏 iP@婏 `P@堏,WP@嗏 NP@ GP@`  @T @T4 1[t0F8#h@BP -LM40 S@ 0, 0 \ 0-40LSP2N 00 ,0d 7@T 0T 0-0L0CSP @0 ,0 @T0T 0S 0 a p-LM0@SdPg:SS |p0 ,gg0D ,0PUpU' 0-`0LS@00S( 3P 0 ,0 0l \0\ , 2PU 0U 0!P P[ -LM`0X S@0,0S  0 \P[ 0-0#SLP@ 0T00< ,0 d@TTP[ -LM0H S@ 0, 0 \P[ -LQh 0 Q\ 7 0,00,@ T[ X 0-40LS@P1 S 0U[,?0Q[,\0 , 8 \0, ?00[,\q40 0-0LS@dP 00,,0 0,\0,, PU0U -LM0,S@ 0, 0,\ -L M`K @ȠH 00 <4, 0 ႐P@" PP*Q0* K 0pS0  P@0[008#X U: -(L!x"h@mPP0S P*P0 S 0P0 :P -LM0P (@ p`0 8@#8 X  0 (@ 0` t0VW  08#8 Xp 08#8 Xp -LM0` p( 008#8 PX0 (0@PU:0S -pBS00W0LMSP@`Q$ 5430:㛌fP@ -0( @ 0 0 X0  0\P@  0(0` S0 ,X00 X -BLM8Z`P#x@4bWQ$ 5430::P@ 80(0 @ 00 X0  0\V0 0\X&P@ 0(0 S -L0KM@c 4P0[0 -LMp `P@P   @dҋT PcUdU@0 s0 -L M0@ (0P, L,:, 00 p W3`sPP ,0( 008#8 X00c#$ 0 4\PP  ,0Rp` WP0( XS*0  S800  - -PLMU`!p&**K@ 0@PH$HU,0K PUOPU ["[:Pr08#x W: p-LM 0`S p0( ,@) P0 ,PLd1UT 0 ,0L0 \0,,@ p0d ,X%X@ 0,,$@! qP,!0 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`SCA00"c1a  : -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ 1W< 0<0  ?B3cS!3$0J0$008 bp0 \?<U U080S=gfff:hMb 0-LM0@(()0K[ S 0K )H(^ PU 00++ 0KK4$0 0(()KP[\0K  )P( 0- @L aP,00 0dS0@00@00X 0 T0 08 -0P2c1RL@,p ` (H]6D 0,0T (0 0S0T00T0=8P88 -LM` @\ Ƞ!$C"a,Ƞ@Qp 0 @ @y0,P@000$0T0 0`0 S008 -L 0!0 0T  00 #(0 0 00   20000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000<㉀$2S=4 <8=,8$=4=<=T <0@- @,PU @0T00\0#(# 0$ 0 T0PXP0|8,8 -LM `,Pp 0K NĠ@ KKPK000  y0T0N p-LMP`!"a,@  \40T0pn 0 0 00 T0}.? p|8x8 -PL0 aR@,p `  4*20,0 0T0L(00T0L=|8O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb{0in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  0  )?) 0  )?)^18#811 d R R q000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O /@mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8@#f2-@@Pr?0RW` 9x999` B`p Bp` B`RE0C`R9`4 9999 9 9 9( 9` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR ` 9 9 9 9` B`p Bp` B`p RpPP2-B@P00O0RW` 9p 9| 9 9` B`p Bp` B`RE0C`R9`, 9 9 9 9 9 9 9 9` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR ` 9 9 9 9` B`p Bp` B`p RpP2-D@P?O0RL` 9\ 9h 9t 9` B`p Bp` B`R:08`R/` 9 9 9 9 9 9 9 9` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR ` 9 9 9 9` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480@#f0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   :` `! R0-P@ 0bR03 B00\#f``0 B`3`1`1c11c!0"b2c3c0acP@\#f_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q%2K} }}}%}2> > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|z:::<:T:l::::: : : : : ::,:,:,:<:<:<:<:X:X:X:X:x:x:x:x:,:,: ,:!:":#:$:%:&:':0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-:::::0:0:4 :8,:@88:8D:tP:t\:xd:l:!?$,dbEaL 8pP-%!T1;? 8#2!U#4@\ 0HP#+ "#P'()`5689:=`>K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik&''(())**++,,-*++,,--../-@@A@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 F 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80(   !"#$%&'()*+,-./02468:<>AEIMS[gjkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗 n;AvXaM ְdx #l#t##\#d##p###x#&#Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2007 OpenBSD. All rights reserved. http://www.OpenBSD.org  $$;;;:;;;@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~UC(N(N(HO(&O(P(&Q(Q(t(&R(d n;0&AvQkkXaMq//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@s---$--Ȋ---p----h- PL.-X.$--@Z.\\.h].h`.@a.J.ha.h-vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJTp1`p1(%;;;;;;;A; << ;<;; ĥ;ȥ;Х;إ;;إ;;إ;;إ;p ;;p 0;;p ` ;;p p;;P ;;P  ;;P @$;;P P,;; 4;8;@;8;4;D;@;D;,;<=$;<=L;<=T;<=\;<=d;<=  ;<;<l;p;@t;p;|;; ;; ;;/;<;o;;0/;<;p ᜦ;; ;; ;; @;; `;; $;; ;; ;; ;; Ħ;Ȧ; 0̦;Ȧ; @Ц;Ȧ; `Ԧ;Ȧ; ئ;; ܦ;; ;; ;;;;;; ;;0;;@;;P;;` ;;p;;;;;;;; ;;$;;(;;0;4;<;4; <4;0@;4;@D;4;P<;4;`H;4;pL;4;P;4;T;4;X;4;\;4;`;4;d;4;h;4; p;t; x;t;|;;;; ;;0;;@;;P;;;;;;;;;;ħ;̧;Ч;̧;ԧ;̧;ܧ;̧;;;;;;; ;;;; ;;eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0 1(1p%|;;;;;;;;;ī;̫;ԫ;ܫ;;;;|;;; ;;;;;;ī;̫;ԫ;ܫ;;;;|;;$;;;;;;,;4;<;ܫ;;;;L;;;;X;d;p;|;;;̫;ԫ;ܫ;;;;;;;Ȭ;ܬ;;;;;ī;̫;ԫ;ܫ;;;;L;0;X;<;H;;;;;ī;̫;ԫ;ܫ;;;;L;X;;;;;;;;ī;̫;ԫ;ܫ;;;;L;;;;;;;;;ī;̫;ԫ;ܫ;;;;L;0;X;d;p;<;;;;ī;̫;ԫ;ܫ;;;;|;;;L;;X;L;;;ī;̫;ԫ;ܫ;;;;L;0;X;d;<;T;T;\;;ī;̫;ԫ;ܫ;;;;h;;;;;;;;;ī;̫;ԫ;ܫ;;;;VA;9PVA;9VA$;9VAp;9VAx;9 VA;9pA;9qA;9qA;9qA;9qA;9qA;9rA;9tAĭ;9tAܭ;9A;9A;9 A;9A ;9`A ;9`A ;9`A ;9PT,;9A 8;9 A D;9D P;9D X;<9i `;|9 i h;9 i p;9 $i x;<90$i ;<9 ,i x;<90,i ;<9 .i ;|90.i ;|9!i ;9 !i ;9)i ;9 )i ;9-i ;9Ai Ȯ;<9 -i ;9Ai Ю;|9Ai ;|9Ai ;|9:;; ;;$; ;0;,;<;8;H;D;X;T;`;l;t;|;;;;;;;;į;ԯ;;;;;$;4;D;T;d;t;;1|;1;1;1; 1̲;; 1;$; 1<;`; 1t;; 1;̳; 1;;@````` ```;;$;H;\;;;;;; ;L;;p;;;;;;$;<;P;p;;;;;4;l;;;;(; X; ; ; ;D;|;;;;$;H;l;;; ; ; ; $; <; P; d; l; ; ; ; ; ; D; h; ; ; ; ; ; 0; P; |; ; ; ; ; @; d;;;;;;;;8;P;;;;; ; ; ; @; t;;;;;;4;`;;;;;;;,;X;;;;; ;,;P;t;;;;;@;l;;;;,; \;;;;;4;P;x;;;;;;8;X;t;;;;;; ; ,; L; x; ; ; ; ; ,; \; ; ; ;!;!;!,;"H;$|;$;$;$;$;$;$;$;%;&4;&T;&l;&;&;&;&;&;&0;& P;& |;& ;& ;& ;& ;'h;'4;'P;'x;';';';(;(;)@;)p;);););););)$;*X;*<;*T;*l;*;*;*;*;+;,<;,T;,p;,;,;,;,;,;,4;, T;, |;-;.;/;0;08;0\;0;0;0;0;0(;0<;0 h;0 ;0;1;1;2;2;34;4H;5\;5x;5;5;5;6;7 ;84;8P;8t;8;9;:;:;:;:$;:D;;|;;;;;;;;$;;4;;@;;\;;|;; ;; ;; ;; ;; ;;(;;D;;\;;|;;;;;;;;;= ;>0;>\;>t;>;>;?;?;?;?<;?X;?t;?;?;?;? ;? ;? ;? 4;? L;?d;?;?;?;@;A;B;C;DL;Ed;F;G;G;G;G;G$;GX;Gt;H;I;J;K;K;K<;KP;K`;Kp;K;L;N;P;P;P;Q<;QL;R;S;S;S;T;U;U;U0;UT;Ul;U;U;W;X;Y;Z,;ZT;Zx;Z;[;[;[;[;\;\(;\@;]\;];];];];]P;];];];]$;]X;];];];]$;]X;];] ;]!;]"4;]#l;]$;]%;]&;]'H;](|;]);]*;]+;],L;]0;]1;]2;]38;]4p;]5;]6;]7;]8P;]9;]:;];;]<(;]@h;]A;]B;]C;]D8;]El;]F;]G;]H;]I(;]JX;]K;]L;]P;]Q$;]RX;]S;]T;]U;]V$;]WX;]X;]Y;]Z;][;]\L;]`;]a;]b;]c(;]d\;]e;]f;]g;]h,;]i\;]j;]k;]l;]0;^`;^x;^;^;^;^A<^B0<^CL<^El<^G<`@0@@ Q@c@c@<3833L33433<3uaudio_identify_acp4D444 545454,74LJ4J4tZ4TZ4tr4s4x4x4X~4h~4444      44ċ44,4t44444abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'` `:Rr: :]<::I*::J,:R:7d: : : : ,:K::@#:::: ::H@: N: _H::P:\ : !: !: !:E!: V":mn:Kn":A#:[#:<$:0Z$: $:%:j&:':?':nJ(: &):@44|4H 4l4И4x4444t4444ī4\4Я444\44(  v      W 1 Q `  ܽ4@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   4  L+ L \4L2 D   O  {Ծ4o  A AZPZPZPP444|4fG---0000 0@0P010`0p0aLfLLLLi d4D44,4D4`44H4F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@n@0Df @  Q k k"k"k"k"k @^z BF |9 $|4444 B  w W UP  <1b0 0{&"79=F@W wn a- (4(55555h55@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0 052535h452V{%1" `"'`~%ZP `A5A5HG5S5TT5T5xX5|^5hF F hp5lp5r5\s5L5555@@9WP P Q@url_int_miibus_readregurl_int_miibus_writereg555p5P55ܯ55G W WnPnPA  ! 4Xhp9{#{{{rS#S&@'ah 33.U 1(Ex$ l5P5̺5X50    h5 55d5   `555`5e  l!  P ` c feX5x5 55  BD555`5=K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,- B6PC6 G6u6!A  !@@@@6\6(6S<66H6Q`0S<d6p6H6LS<2`S<3tS<66H6S<5S<6D6l6CPSoLq<p>`q<DAxq<PAq<QAq<RAq<SAq<XAq<dAq<pAq<qAq<rAr<sAr<BB,r<6CBH<$\<$%l<$|<$<$<$ <$!<$"̎ȓ<WГ<p<<th<<<$<0<@@(p<P\<Q\<Rh<Sx<T<U<V<W<Y<Z<[<\<]̿<^ܿ<`<d<e<f<g<h<j(<k8<lH<mH<nX<~l<x<<<<<<<<<<<(<8<P<d<t<<<<<<<<<<<<<<<<,<@<T<<d<t<<<,<<<<<<<< <(<4<D<P<@\<A<B<Dl<Fl<P|<Q<R<S<a<e<g<p<q<r<t<u$<v4<xH<yX<zl<{<|<<<<<<<<$<8<L<`<p<<<<<<<<<<<<<<$<4<D<P<\<\<\<\<\<\<d<|<<<<!<@<A<B<P<Q<S <X <Y0<[@<`P<aP<bP<cP<d\<eh<ft<gt<h<i<k<l<m<n<o<p<q<r<~<<< < < <0<@<@<@<@<@<@<@<@<<<<L<L<L<<<X<p<<<<<!<"<$<& <'<(<)<+,<,@<-T<0h<1<3<C<G<H<`<a<b<c<d<e<f<g<h<l<m<n<i<j<l<m<p<q <r0<s0<t<<u<<v<<w<<x<<z<~H<H< <0<T<d<d<d<d<d<d<d<d<p<p<p<p<p<p<p<p<p<p<p<p<p<p<p<|<|<|<p<|<p<<<<<<<<<<<<<<<<< <(<<<<@4<D@<E@<FP<H\<Ih<Jt<Kt<L<M<N<O<P<Q<R<S<T<U<V<W<X<Y<Z<\<]<^<_<B<L<M<N<O<P<Q<R<S<T<U<V<W<X<Y<Z<[<\<]<`<l <Y<t$<u$<v$<w$<4<4<4<4<@<@<@<@<@<@<@<@<@<@<@<@<L<L< \< \< \< \< \< \< \< \< \< \< \< \@<?L<fX<gd<hp<i|<j<k<m<n<o<<<<<<< <<$<0<`<<aH<T<`<`<d<p<|<< < <<<<<<<<< <<< <,<8<1D<1L<2T<B`<l<JD > > >  >> ! >> >  @DHL  @DHL     &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a2]G4" w! ($727"($70*7.*7v*7p*7q*74*7q*7ʄ*7$*7!$*7J$*7K$*7$*7$*7$*7$*7$*7$*7$,.7$,.7%*7%,.7%,.7&*7o&*7S&,.7Q&,.7R&,.7'*7',.7',.7',.7',.7',.7',.7 (,.7!(,.7"(,.7$(,.7%(,.7)(,.7*(,.7P(*7&,.7 t<7t<7At<7it<7 <7@J7C`K7F`K7H`K7I`K70R71|]75|]7@|]71|e7q@7q@7d1@7@7I1T(7I2T(7T(77ST(7I3T(7lo7U0t7T(7T(7T(7\~77)R87777773M478M470 470M47hM47hb47iM47ib47u47uR47ur473737q37u37v37w37s37r37=757=757w57q57u=7t57p57s=7X7X7X7X7 X7$7$7$7$7$7@H7AH7BH7JH7KH707e07070707S07507e07n0707H07`07T(7T(7T(7TT(7UT(76T(7>T(7fT(7gT(7~T(7T(7T(7T(7T(7\T(7]T(7^T(7_T(7PT(7QT(7RT(7ST(7X7X7IC<7iC<7vC<7C<7nC|]7yC|]7zC|]7a#p7c#p7e#p7f#p7h#p7D:."l::  : :9: ::::f: Z(:8:"::{<:222CC @ @  "2"]G4" w! 6higYCW xv|w   &'(yz{u^_`}~IJKLM (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx   #&) !%),036:=#(,159=ADHKOR(-38=BFKOSW[^beh<BHMRW\`dhloruwySY_dimqtwz|hmrvy|rrrrqqqqOpenBSD4.2RAMDISK#138 @(#)OpenBSD 4.2 (RAMDISK) #138: Tue Aug 28 22:09:06 MDT 2007 OpenBSD 4.2 (RAMDISK) #138: Tue Aug 28 22:09:06 MDT 2007 deraadt@armish.openbsd.org:/usr/src/sys/arch/armish/compile/RAMDISK dackirqtargetlunsizewidthxintchanneldriveconsolemuxconfigurationvendorproductreleaseportnoreportidphydevfunctioncryptobiohotplugloopbpfilterdrive at %s channel %d drive %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl tagged DT %s: target %d now using %s%s%d bit 80.0 MHz %d REQ/ACK offset xfers 40.020.013.310.06.675.0??3.33async siop: can't find my sync parameters%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d %s: rejecting invalid wide negotiation from target %d (%d) %s: rejecting invalid PPR negotiation from target %d %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: no DT option %s: bad offset in siop_sdp (%d) clear fifo failed %s: timeout waiting for DIFFSENSE to stabilise %s: invalid SCSI mode 0x%x %s: switching to differential mode %s: switching to LVD mode %s: switching to single-ended mode siop%s: can't alloc lunsw for target %d %s: unexpected phase mismatch %d %s: selection timeout without command %s: unexpected disconnect without command != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: script interrupt (0x%x) with invalid DSA !!! unknown irqcode %x unhandled message 0x%x %s: scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x our reject message was rejected %s: done without command, DSA=0x%lx invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()%s: extended message too big (%d) %s: target %d lun %d tag %d reselect without command %s: target %d reselect with invalid lun %d %s: reselect with invalid target %d %s: reselect with invalid target error, DSP=0x%x reselect failed %s: reselect with invalid tag %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x parity error %s:%s: phase mismatch without command scsi gross error %s: DMA IRQ: DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid parity bus fault illegal instructionsingle step dsp 0x%08x dsa 0x08%x INTRF %s: unable to load data DMA map (for SENSE): %d %s: request sense failed %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d cmd %p (tag %d) added to reset list %s: unable to load data DMA map: %d %s: can't alloc siop_lun for target %d lun %d %s: can't malloc memory for target %d siop_start: bad statustimeout on SCSI command 0x%x %s: unable to allocate cbd DMA memory, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d %s: unable to create cbd DMA map, error = %d %s: unable to map cbd DMA memory, error = %d %s: can't allocate memory for command descriptors %s: can't allocate memory for command descriptors head siop: resel switch fullIBSSLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: Error decrypting incoming packet. %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: FREE(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) RTL8169RTL8110SRTL8169SRTL8169/8110SBRTL8169/8110SCdRTL8168 1RTL8100E 1RTL8101ERTL8168 2RTL8168 3RTL8100E 2RTL8139C+RTL8101RTL8100RTL8169/8110SCe%s: PHY read failed %s: PHY write failed %s: bad phy register %x %s: reset never completed! : %s (0x%04x), %s, address %s %s: no PHY found! %s: can't create DMA map for RX %s: can't load rx list, error = %d %s: can't create rx list map, error = %d %s: can't map rx list, error = %d %s: can't allocate rx listnseg, error = %d %s: can't create DMA map for TX %s: can't load tx list, error = %d %s: can't create tx list map, error = %d %s: can't map tx list, error = %d %s: can't allocate tx listseg, error = %d : unknown ASIC (0x%04x)%s: tried to map busy RX descriptor %s: tried to map busy TX descriptor %s: can't map mbuf (error %d) %s: watchdog timeout %s: %d silo overflow%s, %d ibuf overflow%s comprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : st16c654, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes %s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: WARNING: unable to establish power hook %s: WARNING: unable to establish shutdown hook %s: could not allocate Rx ring %s: could not allocate Beacon ring %s: could not allocate Prio ring %s: could not allocate ATIM ring %s: could not allocate Tx ring %s: could not create desc DMA map %s: could not allocate DMA memory %s: could not map desc DMA memory %s: could not load desc DMA map %s: could not create DMA map %s: could not allocate soft data %s: could not load rx buf DMA map%s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate beacon %s: sending data frame failed 0x%08x %s: sending mgt frame failed 0x%08x rt2560_decryption_intr%s: could not load old rx mbuf%s: could not map mbuf (error %d) rt2560_tx_mgtrt2560_tx_data%s: could not allocate protection frame %s: could not write to BBP %s: could not read from BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526unknownRT5222%s: timeout waiting for BBP %s: could not enable device ral%s: MAC/BBP RT%X, RF %s %s: could not allocate Mgt ring %s: could not allocate Tx ring %d %s: timeout waiting for NIC to initialize rt2661_rx_intrrt2661_tx_mgtrt2661_tx_dataRT5225RT5325 (MIMO XR)RT2527RT2529 (MIMO XR)ral-rt2561ral-rt2561s%s: could not load 8051 microcode %s: could not read microcode %s ral-rt2661timeout waiting for MCU to initialize %s: could not allocate beacon frame uhciuhci_allocm%s: host controller halted %s: host controller process error %s: host system error %s: interrupt while not operating ignored %s: controller did not reset startstop%s: cannot %s uhci_alloc_std_chain: maxp=0 uhci_abort_xfer: not in process contextuhciabuhci_device_isoc_enter: xfer=%p in frame list uhci_device_isoc_close: %p not found uhci_device_setintr: 0 interval UHCI root hub version %d.%d%s %s: unsupported OHCI revision ohci,, legacy support%s: SMM does not respond, will reset %s: reset timeout %s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return ehciehcidb%s: run timeout ehci_check_intr: sqtdstart=NULL %s: config timeout ehci_open: bad device speed %d%s: *** WARNING: opening low/full speed isochronous device, this does not work yet. ehcidiehci_root_ctrl_start%s: port reset timeout EHCI root hubehci_abort_xfer: not in process contextehciawehciabradioradio at %srd%drdattach: device name too long RAM diskfictitiousrd_idlebioioctlhotplug_device_attachhotplug_device_detachhotplug: event lost, queue full hotplugclosehtplevhotplugreadAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command the kernel did not panic procscalloutallbreaksextentsmallocobjectpanicpoolprocuvmexpvnodewatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sAfter %d instructions (%d loads, %d stores), Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangmancdspeakerheadphonesaudioaudio: could not allocate play buffer audio: could not allocate record buffer audioattachrecordmonitoroutputssourceauddetaudiodetach: %s didn't detach au_portofoplaudioprint: unknown type %d%s at %smpuaud_draud_hraud_rdaudio_silence_copyoutaud_wrau_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfomutewskbd_get_mixerdevwskbd_set_mixervolume/etc/firmware/%smidimid_rdmid_wrmid_clmid_dr: <%s> midi at %sunconfiguredarc4_stirextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqueueplknoteplkqreadinit died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: draining against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: unknown locktype request %dmalloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map%d,No KMEMSTATS compiled in physiophysbuf%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-12.12s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-12s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlezombiedeadonprocADVLOCKCTTYNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPSTOPPEDPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsensordevstunrsensor_task_unregister: unexpected state %dcoredump%s%s.core/var/crash/sigaplpauseissignal hashinit: bad cntsysctllksysctldlkkern_sysctl%s,%s%s(%d)sysctl_tc_choicedummyTimecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %ld.%09ld to %ld.%09ld sysctl_tc_hardwaredenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func syswqwqtasksunable to create system work queue threadwqdestroyunable to create "%s" workq thread boredsmashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at rootconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too longconfig_detach%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structure (default %s%s)can't figure root, hope your kernel is right setrootroot on %s%c swap on %s%d%c dump on %s%d%cinvalid geometryno disk labelunreasonable partition countdisk label corruptedinvalid label, d_secpercyl == 0invalid label, d_secsize == 0disk label I/O errordos partition I/O errorwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%llddisk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 filesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %dcannot open disk, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryuse one of: exit %s[a-p]parsediskroot device (default %sswap deviceintrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools%-*s %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenablefindlistquittimezoneverbose--- more --- 0x%x0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpiperdpipelkpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplmbuf prepend length too bigm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectqueue %d > BQUEUES %dcan't return dirty qbremfree: lost tailbufplgetblkgetnewbufbiowaitbiodone alreadynchplvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs: reducing max cluster to %d from %d due to FAT size msdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdir.msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedfile errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data checkinvalid block typeinvalid stored block lengthsinvalid bit length repeattoo many length or distance symbolsincomplete dynamic bit lengths treeoversubscribed dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pstream endrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rtinitrttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroutewlan%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_cryptieee80211_aes_key_wrapieee80211_aes_key_unwrapieee80211_hmac_md5_vieee80211_hmac_sha1_vieee80211_prfPairwise key expansionPMK Nameieee80211_derive_pmkidGroup key expansionieee80211_eapol_key_micieee80211_eapol_key_check_micieee80211_eapol_key_encryptieee80211_eapol_key_decrypt%s: %sassociation failed (reason %d) for %s %s: received %s from %s rssi %d mode %s %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) ieee80211_recv_4way_msg14-way%s: received msg %d/%d of the %s handshake from %s group key%s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s -%s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for AID bitmap! %s: no memory for TIM bitmap! unable to setup inital BSS node%s: begin %s scan passiveactive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodenot in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u mode %s null node%s: no node for dst %s, discard raw tx frame invalid group cipher!802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) EAPOL-Key frame too large: %u%s: sending msg %d/%d of the %s handshake to %s %s: sending EAPOL-Key request to %s %s: station %s power save queue overflow of size %d drops %d .5 %d%sM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bfhturbo0x"NODS %s->%s(%s) type#%d%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s %s: bogus xmit rate %u setup APL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaearazbgbhbnbrbybzcacncocrczdkdodzegf2fifofrgrgthkhnhuiliqisj1j2j3j4j5jmjojpk2kpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntttwuaukuyvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreerevarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_set_iss_tsmtcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5FinalRMD160FinalSHA1TransformSHA1Finallibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrypto_waitcryptof_ioctlcrydevcuio_copydata: off %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copydata: len %d < 0cuio_copyback: off %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copyback: len %d < 0cuio_apply: len %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lencuio_apply: off %d < 0swcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESAES-CTRARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSaes_ctr_cryptmichael_finalfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_statfsupdate: rofs modffsinodino1plffs_write: typeffs_write: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corruptedext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpath%s: typeext2fs_write%s: nonsync dir writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapuvm_km_pgremove_intrsafe: no pagekm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs=%d PAGES : <%p,0x%llx> refs= PAGE %p: %b flags=%s, pg_flags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p swplkuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_ctloutputip6_getpcboptip6_setmoptionsnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d at %p not found frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uMB) avail mem = %lu (%uMB) cpu_startup: no room for system tables; %d bytes requiredcpu_startup: system table size inconsistency_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15** IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumping to dev %u,%u offset %ld dumpsysdump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible vmapbufvunmapbufrebooting... The operating system has halted. Please press any key to reboot. WARNING: powerdown failed! cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: Failed to align the kernel page directoryinitarm: out of memoryunknown option `%c' can't init serial console @%lxboot device: lookup '%s' failed. boot device: %s wdsdraid%sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs scsi_sizescsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target links%s: unable to register bio scsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260%s: not queued, error %d cdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcadrive offline%lldMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lld sec totalsdstartsd_ioctl_inquirySCSI opticalSCSI disk%s %ssdgetdisklabel%s: WARNING: cache synchronization failed /usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %diic"%s" at %s addr 0x%xlm75alm75lm77xeontempmax1617%s: addr 0x%x %02x=%02x: %smtp008it8712it8712f-aadm1026gl518smasb100f75375as99127fw83l785ts-lw83l785rw83l784rw83781dw83627hfw83782dw83791dw83783sw83791sdw83792dgl523smlm90lm89-1lm89lm86lm63max6642max6657max6646max6690g781-1g781adm1032adm1023adm1021adt7461adt7516lm81lm93lm96000lm85adm1033adm1022adm1028adm1024adm1025adm1031adm1030adt7467adt7460adm1027adt7475adt7476adt7470adm9240lm8747m192ds1780ne1619emc6d100sch5017emc6w201thmc50ricohrtc: RICOH RS5C372[AB] Real-time Clock %s: ricohrtc_reg_write: failed to write reg%d %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_clock_write: failed to write rtc fintek: F75375 rev %d.%dVcc, unable to register update task unable to read reg %d pcaled: PCA9532 LED controller gpioi80321_io_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_mem_bs_free(): not implementediopaauiopiiciopmuiopwdogpcii80321intci80321_intr_establish: IRQ %d out of rangetcr1clockstatWARNING: CHECK AND RESET THE DATE! WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: preposterous time in file system resettodr: failed to set time : I2C controller iopiiclk%s: unable to subregion registers, error = %d iopxs%s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersattempting reset PCI I/O memory spacePCI I/O port space--------------------------[%3d devices bogus] [%s]----------------------- device vendor product register space address size -------------------------------------------- PCIBIOS fixup stageSystem BIOS SettingWARNING: unknown PCI device header. NGOK [%s] %02xh %s 0x%08x 0x%08x mem No available resources. fixup failed fixup failed. (new address=%#lx) new address 0x%08lx pci_addr_fixup: Resource conflict. %03d:%02d:%d %04x:%04x Thecus Nx100I/O Data HDL-GCertance CP3100board id failed iq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) irq %d addr 0x%08lx intr %dobio_bs_alloc(): not implementedobio_bs_free(): not implementedcom_obio: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE diskwddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedwsevent_readwskbdwskbd at %s: console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %swsmdetwsmouse_detach: %s didn't detach pre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create event thread for %sunable to create usb task threadusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04x%x.%02x, class %d/%d, rev /, addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %duhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored %s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d sel%d-uaudio_add_selectoruaudio%s: audio descriptors make no sense, error=%d %s: audio rev %d.%02x, %d mixer controls %s: alt %d missing AS interface(s) %s: failed to get configuration descriptor ulinearmulawalawslinearslinear_leulinear_leslinear_beulinear_beuaudio_mixer_add_ctl: no memory i%duaudio_get_cluster: bad data volumemix%d-%suaudio_add_mixermixeroutdacphonelfeauxvideofmsynthuaudio_add_feature%s.%sbassmidtrebleagc4 msdelaybassboostloudnessuaudio_add_processing_updownpro%d-modeuaudio_add_processingpro%d.%d-enableuaudio_add_extensionext%d-enableuaudio_merge_terminal_list: no memory uaudio_io_terminaltype: no memory uaudio_add_alt: no memory %s: ignored setting with type %d format %s: ignored setting with precision %d %s: ignored setting with format %d %s: non sync-pipe endpoint but multiple endpoints %s: ignored output endpoint of type async %s: ignored input endpoint of type adaptive %s: ignored audio interface with %d endpoints %s: no usable endpoint found uaudio_identify_ac: skip desc type=0x%02x uaudio_identify_ac: unexpected AC header uaudio_identify_ac: bad AC desc subtype=0x%02x %s: no memory inputsequalizationumidi %s: %s %s: out=%d, in=%d %s: disabled. USB MIDI I/F%s: illegal endpoint(in:%d) %s: illegal endpoint(out:%d) Fixed EndpointYamaha Specific((genuine USB-MIDI) ucom, %sucomlkucomopen%s: read start failed %s: lost %d chars ucom at %s portno %dugen%s: setting configuration index 0 failed %s: setting configuration %d failed ugen_do_readugenriugenrbugenwiugen_do_writeugenwbhid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev %s: %s, iclass %d/%d %s: no report descriptor %s: %d report ids %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8 and Z dir.: %d button%s%s %s: mouse has no Y report ums %s: mouse has no X report %s: X report 0x%04x not supported %s: Y report 0x%04x not supported ulpt%s: setting alternate interface failed bi%s: using %s-directional mode uni%s: could not find bulk out endpoint %s: couldn't get ep %d ulptop%s: offline %s: out of paper %s: output error ulptwrumassCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured %s: unable to get Max Lun: %s SCSIATAPIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cburio%s: setting config no failed %s: getting interface handle failed %s: missing endpoint uriorsuriowruvisorGeneric%s: no proper endpoints for port %d (%d,%d) DebuggerHotSyncRemote File System%s: init failed, %s %s: device is neither visor nor palm %s: failed to get interface, err=%s %s: failed to set configuration, err=%s udsbr%s: request failed err=%d aue%s: EEPROM read timed out %s: MII read timed out %s: reset failed auemii%s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemiiaxe%d: getting interface handle failed %s: %s, AX88172, AX88772, AX88178 couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk out %s: could not find data bulk in %s: no descriptor for bulk endpoint %d %s: interface alternate setting %d failed %s: no descriptor for interrupt endpoint %d extra ethernet descriptor %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: open interrupt pipe failed: %s %s: too many errors, disabling %s: usb error on rx: %s udav %s: %s, setting config no failed udavmii, read MAC address failed , missing endpoint , couldn't get endpoint %d , failed to get interface, err=%s udav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x no %s: data interface %d, has %sCM over data, has %sbreak %s: Could not find data bulk in %s: Could not find data bulk out %s: status change notification available %s: could not set data multiplex mode %s: no endpoint descriptor for %d umodem%s: %s, iclass %d/%d %s: no pointer to data interface %s: close notify pipe failed: %s %s: abort notify pipe failed: %s %s: abnormal status: %s %s: Invalid notification length! (%d) uftdiuftdi_openuplcom%s: failed to get device descriptor %s: Could not find interrupt in %s: reset failed, %s %s: failed to get second interface, err=%s umctuvscom%s: failed to set configuration, err=%s %s: uvscom_readstat: %s %s: uvscom_shutdown: %s %s: uvscom_set_line: %s %s: uvscom_set_line_coding: %s uvsop%s: cannot open interrupt pipe (addr %d) %s: uvscom_intr: abnormal status: %s ubsa%s: failed to get interface: %s %s: failed to set configuration: %s %s: ubsa_request: %s uipaq%s: no proper endpoints found (%d,%d) %s: unhandled set request: reg=%x onoff=%x umsm%s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor found for %d uscanner%s: bulk-in and/or bulk-out endpoint not found %s: could not get interface descriptor, err=%d,id=%p %s: cannot open bulk-out pipe (addr %d) %s: cannot open bulk-in pipe (addr %d) uscnrbuscnwbusscanner%s: open in pipe failed, err=%d %s: open intr pipe failed, err=%d %s: open out pipe failed, err=%d %s: alloc cmd xfer failed, err=%d %s: alloc cmd buffer failed, err=%d %s: alloc intr xfer failed, err=%d %s: alloc data xfer failed, err=%d %s: alloc data buffer failed, err=%d wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthratuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-extatu_send_mibatu_start_scanatu_initial_configatu_joinunknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atu_get_card_config %s: could not get card cfg! atu_rxeofatu_tx_startural%s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not read BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d qsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 1 Gigabit PHYMarvell 88E1000 2 Gigabit PHYMarvell 88E1000 3 Gigabit PHYMarvell 88E1000 4 Gigabit PHYMarvell 88E1000S Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1112 Gigabit PHYMarvell 88E1116 Gigabit PHYMarvell 88E1118 Gigabit PHYMarvell 88E1149 Gigabit PHYMarvell 88E3082 10/100 PHYMarvell 88E1000 5 Gigabit PHYMarvell 88E1000 6 Gigabit PHYMarvell 88E1000 7 Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present dcphy: internal PHY bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706C 10/100/1000baseT PHYBCM5708C 10/100/1000baseT PHYbgebnxamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYurlphy: RTL internal phy %s: %s: enter %s: %s: link %s rgephyRTL8169S/8110S PHYciphyCicada CS8201 10/100/1000TX PHY%s: unknown PHY speed %x nfe%s: unknown CICADA PHY model %x dev %d function %dpciprintpci_io_find: bad requestpci_mem_find: bad requestpci_mem_find: bad 64-bit requestOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx CardBusOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDeltaPermedia500MXPermedia 2Oxygen GVX1Permedia 35000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249 PCI-PCIM524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3 PCI-PCIU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1210ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681AX88140A/88141Radeon Mobility X600FireGL V3200Radeon X600 (RV380)Radeon X600 (RV380) SecRadeon 9500 ProRadeon 9600 ProRadeon 9600 LERadeon 9600 XTRadeon 9550Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon 8500 BBRadeon IGP 320MMobility M6IXP200 AC97SB200 PCI-PCISB200 USB2SB200 USBIXP200 IDESB200 PCI-ISAIXP200 ModemSB200 SMBusMach64 CTMach64 CXIXP300 AC97IXP300 SMBusIXP300 IDEIXP300 SATAIXP400 AC97IXP400 PCIIXP400 SMBusIXP400 USB2IXP400 USBIXP400 IDEIXP400 ISAIXP400 ModemIXP400 SATAIXP450 HD AudioIXP600 SATAIXP600 AC97IXP600 HD AudioIXP600 PCIIXP600 SMBusIXP600 USB2IXP600 USBIXP600 IDEIXP600 LPCIXP600 ModemMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon 9800 XTRadeon 9800 ProRadeon Mobility M10 NPRadeon 9500/9700 SecRadeon 9800 Pro SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZES1000Radeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRRadeon Mobility M300 M22Radeon X800 (RV430)Radeon X800 (RV430) SecRadeon Mobility X700 M26Mach64 VTMach64 VUMach64 VVRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRadeon XPRESS 200Radeon XPRESS 200MRadeon 9200 PRORadeon 9200Radeon 9200 SE SecRX480 PCIERS480 PCIERadeon X300Radeon X600 (RV370)Radeon X550FireGL V3100Radeon X300 SecRadeon X600 (RV370) SecRadeon X550 SecFireGL V3100 SecRadeon Mobility 9200Radeon Mobility 9200 (M9+)Radeon 9200 SERadeon X800 GTORadeon X800 GTO SecRadeon X700 PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRS100 PCIRS200 PCIRadeon X1800Radeon Mobility X1300 M52-64Radeon X1300 ProRadeon X1300 Pro SecRadeon Mobility X1600Radeon X1600 PRORadeon X1600 PRO (Secondary)Mobility FireGL V5250Radeon RX1650 XTRadeon RX1650 XT (Secondary)RS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST2000AR5210AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLL1Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000PCI 2 SerialLP-PCI 4 SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNF5D6001F5D6020V3F5D6000VME 617VME 270655015601BCM5752BCM5752MBCM5709BCM5709SBCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM5705BCM5705KBCM5720BCM5721BCM5705MBCM5722BCM5705M AltBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5754MBCM5755MBCM5756BCM5750BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5750MBCM5751MBCM5751FBCM5787FBCM5787MBCM5782BCM5786BCM5787BCM5788BCM5789BCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM5702 AltBCM5703 AltBCM5781BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4318BCM4319BCM4306BCM4322BCM4309BCM43XGSerialBCM4401BCM4401B058015802580558205821582258235825BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearAAR-1210SAAAR-1220SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IR82C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Live (Dell)SoundBlaster Audigy LSSoundBlaster Audigy 2FirewirePCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port21050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCI550TX530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDGE-528TDGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Light Pulse 982Endace Dag3.6DEndace Dag4.23GECB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02PR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iIPMI77516500781179517814/7851/785480658165815479567955/7954HB6 PCI-PCIHB4 PCI-PCIMSVCC01 Video CaptureSH7751 PCISH7751R PCIMCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIMiami/PCIOlympici82557B 10/100FireGL2133 PCIX-PCIXCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950IPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA2114580303 IOP80312 I/O CompanionPCIE-PCIEIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIX82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 2100PRO/10GbE LR (82597EX)ICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 MPRO/1000 PT (82571EB)PRO/1000 PF (82571EB)PRO/1000 PB (82571EB)82801FB LAN82801FBM LAN82801GB LANPRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000GT (82541GI)PRO/1000 PT (82572EI)PRO/1000 PF (82572EI)PRO/1000 PB (82572EI)PRO/1000MT (82573E)82573E KCS (Active Management)82573E AMTPRO/1000 PT (80003ES2)PRO/1000 PF (80003ES2)PRO/1000MT QP (82546GB)PRO/1000MT (82573L)PRO/10GbE CX4 (82597EX)PRO/1000 AT (82571EB)PRO/1000 AF (82571EB)PRO/1000 QP (82571EB)PRO/1000 PL (82573L)PRO/1000 PM (82573V)PRO/1000 PM (82573E)ICH8 IFE GTICH8 IFE G82815 Hub82815 AGP82815 Graphics82806AA APIC82559ER82092AA IDESAA7116EE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGP5000 DMA EnginePRO/10GbE SR (82597EX)82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA AGP82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 MCH82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCI-PCIE7500 MCH HostE7500 DRAME7500 MCHE7501 MCH HostE7505 MCH HostE7505 MCH RASE7505 MCH AGPE7505 MCH PCI-PCI82845G/GL82845G/GL/GV/GE/PE AGP82845G/GL Video82865G/PE/P CPU-I/0-182865G/PE/P CPU-AGP82865G Video82865G/PE/P CPU-CSA82865G/PE/P CPU-I/0-282875P Host82875P AGP82875P PCI-CSA82915G/P/GV Host82915G/P/GV PCIE82915G/P/GV Video82925X MCH Host82925X PCIEE7221 MCH HostE7221 PCIEE7221 Video82915GM/PM/GMS Host82915PM/GM PCIE82915GM/GMS Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000X PCIEE8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI SATA6321ESB SATA RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945GP82945GP PCIE82945G Video82955X MCH82955X PCIEE7230 MCHE7230 PCIE82975X MCH82975X PCIE82915G Video82945GM MCH82945GM PCIE82945GM Video82801GH LPC82801GB LPC82801GBM LPC82801GHM LPC82801GB SATA82801GR AHCI SATA82801GR SATA82801GBM SATA82801GBM AHCI SATA82801GHM SATA RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI SATA82801H RAID82801HBM SATA82081HBM SATA82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801HBM IDE82946GZ Host82946GZ PCIE82946GZ Graphics82946GZ HECI82946GZ PT_IDER82946GZ KT82965G1 Host82965G1 PCIE82965G1 Graphics82Q963 Host82Q963 PCIE82Q963 Graphics82Q963 HECI82Q963 PT IDER82Q963 KT82965 MCH82965 PCIE82965 Video82965 HECI82965 PT IDER82965 KT82965GM MCH82965GM VideoRCU32 I2O RAID3124 SATA31244 SATA82855PE Hub82855PE AGP6321ESB PCIE-PCIX82830MP CPU-I/O-182830MP CPU-AGP82830MP Integrated Video82830MP CPU-I/O-282852GM Hub-PCI82852/82855 AGP82852GM AGP82852GM Memory82852GM Configuration82854 MCH82854 VideoE7520 MCHE7520 MCH ERRE7320 MCHE7525 MCH ERRE7520 MCH DMAMCH PCIEE7525 MCH ConfigurationE7525 MCHPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965AGNi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power8281082810 Graphics82810-DC10082810-DC100 Graphics82810E82810E Graphics82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8330GIT8888F ISAJMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDEKTIHSSIDS3SSIDS1HSSIcAppian LiteDual SerialQuad SerialParallelDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88EC033Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6145 SATAMGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200e (ServerEngines)MGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDPCI32PCI511GPS170KSZ8841 10/100KSZ8842 dual-port 10/100 switchMN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2PCI-GPIBNET2282 USBNXB-10GXxR (NX2031)NXB-10GCX4 (NX2031)NXB-4GCU (NX2035)IMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtDP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620T1P2S1P4SCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066ESAS1064ASAS1066SAS107853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04 PCI-PCInForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 USB2nForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3 PCI-PCICK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 USB2nForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7300 GoGeForce 7300 GSnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51 PCI-PCIMCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 USBMCP55 IDEMCP55 MemoryMCP55 PCI-PCIMCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430MCP61 ISAMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 MemoryMCP61 SMBusMCP61 IDEMCP61 USBMPC61 USBMCP61MCP61 SMUMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAMCP67 SMBusMCP67 LANMCP67 SATAMCP67 AHCIMCP67 HD AudioMCP67 IDEMCP73 IDEMCP77 IDEMCP77 HD AudioMCP73 LANMCP73 AHCIMCP73 HD AudioMCP77 AHCIOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA (F32)010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950Exsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56CMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS Host (GC-LE)CNB20-HE HostCNB20-HE Host (GC-LE)CMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAVerite 1000Verite V2x00ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVPT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 1076I/O 10778532 PCIEI/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP6312PWDOG185008580RT2460ART2560RT2561SRT2561RT2661802981298101E81388169SC81688169818081855C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C8435C852 xDRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcelMagicLAN SWL-2210PA10xNeo-4Neo-8FDDISK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9ExxTigonSTG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA1901915597/5598 VGA6215300/305/630 VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA530 VGA551155125513 EIDE5571 PCI558155825591 PCI55965597/5598 Host620462056300650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio966 HD Audio83C170 (EPIC/100)83C175 (EPIC/100)FDC 37C665FDC 37C922LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotEasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniST201ST1023ST2021TC9021 (alt ID)40XX4018ANE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigETC9021 GigE (alt ID)TN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 Secure DataPCI7XX1 Smart CardPCI6515 CardBusPCI6515 CardBus (Smart Card mode)PCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 Secure DataPCI1620 MiscACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2032 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBusPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OSD ControllerVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostP4M900 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VCX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64 PCI-PCIVT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700 PCI-PCIVX700 HostPM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVT8237A PCI-PCIPM800 PMCP4M890 IOAPICK8T890 IOAPICK8M890 IOAPICVT3351 IOAPICP4M900 IOAPICP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVT8371 PCI-PCIVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPK8T890 PCI-PCIP4M890 PCI-PCIP4M900 PCI-PCIVT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363 PCI-PCIVT8235 AGPK8HTB AGPVT8377 AGPVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIVolari Z7X3201-3X3201-3 (21143)CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205Martin-MariettaHauppaugeTTTechDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonVortexEfficent NetworksIDTFORE SystemsPhilipsZiatechCycloneEquinoxAlliance SemiconductorSchneider & KochDigiMutechXircomRenditionServerWorksRicohD-Link SystemsCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveATMLC-CubeAVMStallion TechnologiesCoregaASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1Hifn3wareAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioTamarackAskeyAvermediaAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomNetSecZyDAS TechnologySamsungAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionINPROCOMMLanergyRalinkXGI TechnologySangomaOptionAttansic TechnologyAgeiaJMicronASPEED TechnologyTekramTehuti NetworksHint3D LabsAddtronNetXenIndustrial Computer SourceNetVinGemtekTurtle Beachc't MagazinDecision Computer IncQuancom InformationssystemeIntelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDmiscellaneousfloppyIPISASethernettoken ringWorldFipPCMIG Multi ComputingXGAtelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorACCESS.busSSAFiber ChannelSERCOSCANbusIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationssystemdockserial buswirelessI2Osatellite commDASPundefined"%s %s"unknown class 0x%02x, subclass 0x%02xclass %s subclass %sclass %s unknown subclass 0x%02x, rev 0x%02x) rev 0x%02xvendor "%s", unknown product 0x%04x%svendor 0x%04x product 0x%04xunknown cy82c693_init: bus_space_map failed (%d)cy82c693_initcy82c693_readcy82c693_write: broken match/attach! : couldn't map interrupt : invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: couldn't establish interrupt: unable to map device registers pciide%s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: unable to subregion %s ctl regs %s: couldn't establish native-PCI interrupt, (unsupported maptype 0x%x), unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d:%d: bus-master DMA error: status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s configuredwiredcompatibilitynative-PCI, %s %s to %s: DMA%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) , (partial support) (unsupported): no DMA%s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA66: ATA100: ATA133 %s: bus-master DMA support present%s: %s %s to %s mode %s %s: can't allocate memory for command queue: unable to map BA5 register space %s: port %d: device connected, but communication not established %s: port %d: unknown SStatus: 0x%08x %s: port %d: device present, speed: 3.0Gb/s, speed: 1.5Gb/s%s: port %d: PHY offline : can't subregion offset %lu size %luport 0port 1port 2port 3%s %s channel: can't allocate memory for command queue%s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs : unexpected PCI function %d , %s %s to native-PCI compatibility : cannot allocate memory for command queue , (unable to map ctl registers)540620630630S633635645645DX650651652655658661730733735741745746748760962963: 5597/5598unknown SiS IDE type %d %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) : couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: can't allocate memory for command queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers : can't map mem or i/o space %s: Allocation of PCI resources failed %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address %s: PHY reset is blocked due to SOL/IDER session. %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_desc memory %s: Media change is blocked due to SOL/IDER session. %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type em_set_multi%s: Unknown MAC Type : mmba is not mem space : cannot find i/o space : flash is not mem space : cannot find mem space %s: Hardware Initialization Failed%s: EEPROM read error while reading part number %s: The EEPROM Checksum Is Not Valid %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: Unable to create TX DMA map %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate rx_buffer memory %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive Length Errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: RX overruns = %ld %s: watchdog timeouts = %ld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld : can't map i/o space %s: init failed, error=%d : can't map mem space %s: unable to establish powerhook : can't map memory space %s: pre-2.0 USB rev %s: timed out waiting for BIOS : could not map memory space : could not map interrupt : could not establish interruptpciide_machdep_compat_intr_establish called pciide_machdep_compat_intr_disestablish called atapiscsiwdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here %s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEunknown state%s:%d:%d: soft reset failed  Дid'(2` H$;::::.;:::::::t'<:<:: :::(:,:0:  <,"01-./23+)%$RP 5UTV  OQ #==<=<=؝==<=l===<=h=Tehe<==0eDeH=X=Tfhf<= =ffL=T=ffL=T=f f<=`=f f<=`=(f<fd=6=PfdfL=6=ffl=6=f(f<=\= <fPfH=X=ffH=X=f=T=t=ffL=P=fft=L=ff|=d=h:8f<=(=L:|f<=p=f|f<=0=`:< f<=0=:h f<=0=:`fp==):tf<=0=:f<=0=:fp=@=;L:,fp=@=;8,:@fp=@=;L,:Tf<=0=`,:lf<=0=02:f<=0=2:f<=0=2:f<=0=4:f<=0=85:(f<=0=L5:Hf<=0=5:\f<=0=H6:pf<=0=\6:f<=0=6:f<=0=6:f<=0=7:f<=0=,7: f<=0=7:Tf<=0=8:f<=0=08:f<=0=t8:f<=0=8:$f<=0= 9:Xf<=0=;:lf<=0=;:f<=0=<:L=<=0=<:f<=0=?:f<=0=ffp===f$fp===8fLfp===`ftfp===ffp===ffp===ffp===ffp===(f<fp===Pfdfp===xffp===ffp===ffp===ffp===f,fp===@fTfp===hf|fp===ffp===ffp===ffp=== f fp===4fHfp===\fpfp=\= f=L=H=G` f fL=H=G8"f=L=H=GX"fl"fL=H=G"f=L=H=G"f,=L=H=G"f`=L=H=G"f=L=H=G#f$#fp=D=<:D:H:P:X: ;,,""((@("  H    | @)+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! :p F 0< p p T x < 7n<L<%K4Z!PZ!tZ!X::6"8"" """"X<"<"XG"\G"#""G"G"`G"H"#""$'"X'"<)"D)"#"3"'"'"H)"d)"#"2"#"#"%"&"#"H4","."8/"/"#"02" @ @   ) 2:     r"f"m"Z"Z"Z" ["w" x"""x"/?/T$<'ĭ$x.T$T$T$T$T$T$T$T$T$T$T$T$T$T$T$T$T$T$T$T$T$T$T$t4%5%x5%T$T$T$T$T$5%T$T$T$T$T$T$T$T$T$ SM# 9~^![(LxZԍZa;hCcd$H!(jF~$ spWo^}M)nEy l{a!E_){b6F[Xʋ^"霬k=,Zl ndw,.vlkGQ% ]l'"n8r,?;j k{AB7G}.Vs *CV%4fw9G r-5KVBBg("9!)k֝4q8"m:gW6/dMXo .@.. ... export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = "X" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up  . .. bin dev@ etc mntmnt2qZsbinqZբ tmpB usrvarinstbin.profile install.mdupgrade install  install.sub ARCH=armish md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } ELFa(t4+4 (>>@@@@]@]*$$***ĕ444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x/ P000`P`0 R ^ *0 0 Q P:00@ 0S SX 00-SL@  @1S@DQ@Dt @Dt0霪 -LM$@0S0Sꔪ -< L04S0 00 h*D|** 0S00H -LM`pQ 0S5/њp@PPPQ P Q088 8$Q  L̴( p-PLM@@P` ph 0-@L PP \6hzB 0OSP8  (00SP!hL(Դ̴<` -䢟䒟<LMP000ȂS09 vpP=v @T` 8K0  \ Xn TŸ8 Y0 R<Ÿ8 0a 08 Z0000S0A  10S000 B g 10S0 S+ 10S 1!0!0Sx!p1  !h 7000D81810(10S0 `R PpU L00SRU!L0p1) @0S 0S  0<$) @0S 0Sp L*+*|fĶ*̷ D+̎H+Ѝ8h|_ -LZ 00*+ -LO0D+ -LG P00@+ -L<0| -0L000**0* -0L00*+0+ -Lp0(+ -Lh0* -L;L 0-LMK Pgp@81 0Q  R@ 0b0CS$ \\\\\\\\,\8\\\\\\\\\D0D0E0J0AS00 0xS S *S 0S "z, 0 $K0 K0*`L p-LM KPY qr1 Q PY 0b0CS5ꤌ$$$$$$$$$Ԍ$$$$$$$$$`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "0 0 (mK0 hKp*`L 0-x0LP h0   aAq 0A0q08@0P 0R0 : 0L+*+0 R0 *+ - L -K` - L $K` - L K` - L K` -LMd-\-T'P00s D@00Cs0 00Cs0cw0X@+| -8rLP,20  1P ,10S0q QP1000 A0! 11P0 1!00P00 tgPLQPa` \10S 0@{:P4 $A0P 0m:P 0f:P>P0  Rp: P 0 0; S0`@%,"PP@0h0Q XZJPhu*t|+H*`PD+`pp+ 0-LM@KsSP tO0: S\4 KPC,P0000 0?pqZ0S0000`m @ 0-L1 R 1 0Su*Q  1Q   >A P 0!0  tO l?0 0>820 0 0 0  P0    00 00000 0000 @0  W00 \D L000 %O0 0 00(00@+P+**`+H+ -0LM 0RE0RQ0R_ x00 l@ R R*T bQ >00,00S hH+Ѝ̎*+ -`1LMP``p@Q jeP@  . z0S@ N0/T0V000 0T0 0 0 0S00c 0pd  tIP@0 fR `!* 00 0Rb<0 00+`P+* -pLuM0d yK,0 =t 1b1 P a!  B=9! = 1 . P@0 r/ p`%Pno JP PoOK 0!dPP`A = R  x1 RtVOKd0`!MA =  R ,1,R@Kd0!:w?KA~=v?K!00/C#b10 # 0 됀K p`0d wKP뉁Z= @v?K 100 ,0SD,-.A?'p+0MbD -LM@N|@ -LG, -0L0%P0 `@%,"0=p7q / 30p`0-  P 0 pWp@0P`p 0S0C0XGT00  Z <H  M0**|*` -L Mȡ00 `@%,"0<pbq`C 2[ 8c8d0 K00 , )PQ4 `0pSI 0SF 囱PQ4"`0 K03K,` )p  @0 pR' 0S$ c0`PP  lCM@0 pR<0 0S@0p R 0S+m` -MLM2 P` p( 堤 h"rp?@Y 4PD(((((((((((((((((((((((((((((((((((((((((((((((0ppppI.KL1 BH BbT(JK L@1($Rp *0 PbUa=B^KPEPE@徒P 4 04 04 I>K0C 0CD $ 0t , KP0-S  TF0HF <L0$,LH'd%ػ -L0B !4 ( -LM`PP( @(K,pK 0  (0@S6JL -L M0@p00 0Si PP 0S nSZ =P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`0x00 ,K+, ?R0S@p @f0"Sl 0#FY000 LPH00D 0oSP  FhPhp -霣圃LxMP@`p#+qpA P0@$S30```````````````````````$<`DP`X`````h`p2`2`p22y2 R2l2|"0QAPc<2 R 82 RpK>P`,r 0Sp j,P g `P? pKPyPX0: S SK NPB1 R 0 5 DP) `j_0SV pW P@M:Wp@Tj_ W p0 R  6VҰ   D __勐P!PJ`L_y<EO|OOOOOd%ļ`4X -LMp K=@T` P P@ Tj_ 00T 0-x0L0PS0@Q  P 0S(0 R00 R0x+ P-L` 0SDnS 0@ ,XP@4l0PP@p` ,FPp@0oS` PJ뀽x+ -蠟L0S 0 R0 R < X @ Pp`0DS 0 PUjOvP D0\j/T0 7jojMOO p-L M `K P@0s  юpώp1 -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 墎2  B 0R00 0`p @T T|5 i54 Tv Ttq5 ^5Te Tcf50c5,4  0m Q ZP@E 0 Z/  pVl1 R/ @pTg' Z`PT0  P@0  P3To/  `P@0 x P@X50 4 4 4 { 5Y@AOOн -0LMPpP`)0 R @;$0 ;8 0 @ڍ0 R W@ $0@Tj_\ƍ K$K9@@@8$00 O|Oؽ O(@H -1L4M`, P!10 00 @,0P 1P啍TBp< AH0`JZ/ 0@K 07@`T9 T7 h4 U4T) T' ]4Z4T T R4O4 0@K,0<T00 SZj ;40 54 04 0P@0  0PKY@|Olx  -`L@(PP pJ0S p.HPpč` -LM`@P0pQ7 IP@ 0S T 0 $$郉( -0L @( -aL M, Z 0P@Pf  0PP\%1R 004 d 000\%X1R5 @$ 80`O͉<@d@d_0d ,!W@40hc ,0C0$@ @$@,0QTZ 4,Z 4D (0d 8%P<(@dl (@ed ,0C0 \%0R|+TTT, -HL M, 0 [P:P #1RL0S @D@030(3Pp g@2B`@2v#,Pc P 00 0b0  0 0$ dD0QZ Ti4,Z e4D |KST0 -AMLX6 M L6L@P p`84 , 0&xlps ?0@8SzHH@HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLHHTH`HHHHHHHHHH 5` YP_p0S JP44 R 8$ 9P41Ppl4 < @bTQ {T }YY ,(P`) P zPP 0SuP*0 P9P<40<4 ZP<$0R0X0S KP TTPP B.K B B8劍P@ 4Pᰈp0S %FBK@@8P XP@0D_P@Tj_0T@2 R 808P0"8$ c 84P084 1 RcBKHHP] {P5 P0 , 0  P /P`| 04D000$ 04~ 04T 0 00T'P` ?w'P` P P P H'P`|? p|E',(O8xOOXd%@DLXu`p|X -PLMP P` @ pK4 80S@@ 00S00/h 0-P@ 0LSP  0S0S0  -LM Mß'}KpG` pG , P@!Pq #T@U Zp`P 0S /PP @KA <0A؉ 3) 0QqA9  岉9@X [[//-/2 ,0S ,ܪ囉9@T[p@R P. //KAA ㄉP9#42 R uOKHP-P H ZY!aMK@D0 @D!i@F0Sx 0S0S 6 H@..uKGP-]KZ P[K  P@S0 RuIKA 0P?`:0StPP@' 0)DT&D'T@cO<O LX,8HpxX -L4M䗟য়T `D0, ׈ 0DSpH  TW' R  0|St7pW h @TP 0S T ,7p DW 7' 0ᣈ0VSPBO0fVpW& 6 P 6Qp& x6Wtd}  pP6PW@h&r @ (6pW D& g  5pW&\  p5W%Q0S   R 5pW0%A0S$ $  R T5pWL|0x%10S( (  R 5pW <0<%!0S, , R 4pW0%0S0 0 R 4pW0$0S4 4 R T4pWL|0$0S8 8 R 4pW <0L$0S #pWH0 $ՇL чP ͇T ɇ3Wć ,0S ,0SG pL3W@#@=\=P% pW )PTKPKp3p2PTxWB@w.0D#DP咇8PT0BOSl Ml RJp^ p2pWŸd0"Pv0St t 2R $2pW0"ex0 1pW"Zx0 1pWX"Ox0 1pW0"Dx0w pl1lW"TnpdPBOl0 $1pW!&l0 0pW!l0N p0W!x?PC0BOS 0< p0WtL9P 4P<*P  ,< = =XLP d x=,L6.P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C pp   InK`F`FAP@ $`h>Y0S 4: S < )SMKHHș@ ( G-Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l&8 X00R00S7 P 0@ P 10135:3P y) X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A*) Д0AP,  )6X@JP )dV000TU 3 5#:,P( )0(V00X@6h1h ? (6``U 0#5 %* % U UU 4S X0 4  \ P  @(ؔ  YRJ^   ($X T \% P ؔ PY0 <U U%1 ATE Uc cc(Xe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx6 <%!q0`J  0 !5 SP L S3 p0# U Ugg Ug gg *(X 0H,଄  <Ja (` 0%P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 Q4R 00UV `P4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,'O,g\gOhOO|7OO 0OODOLOOPOOdOtOPOOOd%`\(Hl @d(TT= <LTX\dhltxOOgfffOX`OOhx|t@XdNK@)aNK4@@4 彨 %P  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $$tp ܤ P%0W^  Pd \0#03\030"S3  `Q&P,<"(PK0d1P ^ U * X  PQ ܤ kQp 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5& !0S66TQ$0 N0o00  e T 'ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$(]$ 0(> 40Q9V>d8U U Uʠ 53 V:%V#=NU8'L40S@.cc%T5l %P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 PBNK@D@D*5j P p$ e <Pa4: S ܤEnK`F `F @P0   %03`\d4S: 8j\d4S0} T([44 嬄 D D ~gF -LM@(K+P`5  'Ppp0W0* R00S 0rS`Fv (P@ P@Z`F (00T P P (0vj?(0 8(0 T02p -PL`p@yPDP @T:T @2 2X -LPgM/, `PBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  U200Y00S ,0S 0S 0S $0S5MK  SpI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,ם0 {$, u (l oX rP@ <49}0'H*edAA8DD\l -LMpb|Q5Q/Y|Q& R|,Q0S hM4 0E|C|`8|@|PP:|h8|<Q@3|L0|D-|<*|4'|@5  ( Q-0L $ Q*  q10D -LM`@px $K4LPx0S0S 0 S1$0 UR#UT p-LM`PU@ T<PP UTUpT`- 0\ \8 0000ӑS^ 0 ^0|& Br0 BS 0r0 -ALM3 05  00 8 0+  0&  0!  0t  0d  0T  0D  04  0$  0  0  0  0  0  0  0  0  0  0  0t 0l (t<L`p(@Xl7 -LM00`Kq@ 00 pxPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K )P@ 40 R0 0(@J JP0 0( dP 0LJ< 0pPP$ P-L //Hd 0-LMt@ 0PdrzQ x@w 80hez0(0 `z 0S| -LM0:(0 \P0( 0S(0 0 (K  )zPP) 0S& =HP`u 00,pK 0cSb iSI lS> oS& A0S 0S 0S(0SBP0AS, [0 0S0 ,P,00 0oS"P ,0(0P,0 0 0 P,00 0iSP0 T,0$0XP,00 00.(0p  -LM `P0p-S000P(K 0(P P@  0S 0 Q (rI{mIv $x D0h0S $ "-,0 0$  -LM@D00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 0 0`t -LM@v0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@nv0 0 -LM0@S  hJ 0 << 0 -LM@00$08  0 0(0-K 00 $ 0g@+$x -L)vhxp -LM K00"P3t - LP3nt  - LP3ot  -A0 LR`P pPJ RDA R pP3 RA R psP R@ R pfP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p X` -LMx \, P`p 0LSE$,0 wu@nuT 1  wW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ 0K0 X" XK 0SXT1 ,0S ,*K1sK/s-sK*sa0S @K00!d 0Sqi S  SetplhrI dG Hu<u0 u$ '0<L\(,8XD 0@XxLhTTl|\9dlx 0-0P@0LS 0@0F00 PP 0-|PL0@S d0d8u00 0HS@-u4*u$&u0000 PPL`< -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 PXu -LTM\ X3XSp`| , xp p <R|0Vr |0@00T #|mUpa@ P<p0| `Kx| Pxt K2 PJ4K|x ) P}W ,<<|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,岕x P+u xS4Pl/WPP|0 |(1  0P =@qq0l0  ҽP|0|0%D.t  t~pA|@Px :p7 P?/H})'`%d%t@ht@T=gt H* 8`D -0L @(T -qLpM@P`!TpF@9 -PRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx`1`00 00Q @` 0T Q" T 1@KP0: S 0`S  0`SqT 8  (.P PP$Pd%Ĩ ] P$` -NMLMDD0S( `Ppu $2$" 2Q0UOINK@D@DP4: SB 3P0S 1 R ktP1P s(0 S l(\o0SKAAnP0%4R%4R B0 RP@ B^KPEPE0 @ PINK2@D2`1@D2:o?00 sINK@D@D5PX0 R~4: Szuo00$P'PcP P P`(0@hP -0L 0㨓@(p -鐥LMP`0 4 t%ASp ?0@8S񟗅PPPPPPHPPPPPPPPPPPlPPPPPPPPPPPPPPPPPPPPPPPP@PHPX`0SX$00, 0S (4 | 0S u 0S#00k #000#0S ] 3000 #C05P 0 R J 0040 s\#X#A mL#0S 8 ,#0S0Pa0Ua 2 R 2 0 R! @ЂŸQ 0@;Pp ]0"0CSLU BP  U 5P 00j U *P@ 1\  `P 40`V0ES @MPP PkP  8, 0 R, KP+0Q0ESU 7 @e/Z6 P h P00SZ 0 RUUPr,<yyT xdwd%y\w((hw y`md\ p-LM@P`g0Se/ 0U $000 0 phoBp ~&p -7LS 0707Pp `0 q @@qA0pW 00PZ -$3L MPU0 ` C@@@@200Xp 2 R \2 0@@  0S (0s& 0S! dBdpXpD00CS0X0ӤX0r PpP $B00CS00Ӥ0b PpyUYUmp0SE 1 R20S 0 S,   , KPJ  Q( K@@"X P 0 A0P 02.+_+ 00TK 0PKp  Pl0S l0S *WT`0 Rt  P``wy8WEV \w((d'dwmd\fdgd -LM@l00CS% & & & & & & & & & & & &% && & & &&0h?$ p<d` p-L M 0@.QP,# P*p@ 0@@da 2 0R @ ^ 0S  R@X0V@   PR@p(?pPj(PU@( -d2LM Ro L2p R 0S 0S <s2 RL  0Qq * P1 *"1\R) Q?!Q0yM,@0W0 1R PUh>?0S8SP g<-?"0S8S /;0@@`\P$`0`o0 R0 R P  P xP  Pl$*dyPX \wdw y`WEVx`wyyhwrdAedAsd $ -LM( R,@:( 0e/eT *0 SR:*$8 -L M0Ss0S 0% O R|3|!x w( h s, \ o0 P k4 D g8 8 cG<PP@ 0 Y4S "Rr4S  Jr4S4SP0ST0S{ @\0 S@ oXں Xp 0@@0   Xp  \> oxa  0, 0 @@0P`0,  `0 @@0P`0,  ` 0S S! 1,  x 0S S 0 S1 0 38,  0P 00C   0,   ~ pu tpl \pc0  0 ldl T( (4@LX -LM0 pWPd^(`pVP@R0 6B0JP@SA//000T0000l00x00000000V0 +8@pT`P0  `P   | H P@ `P?@0 A>P?>p= -L,\@D0D ,R@D0D , 0@@0 `p4@a @P0,D0p20D0 `(|T -LM0`pZ, 0 K0#00 000 ӑ \33   R3!0 0 0P ( h, \0 P8 D4 87< 8# <0 0D/ P@PxB Z 0 0 R 0K 0./ P@P\B Z 0t l$0Q (PH2DD"8@To0, 8@T$${$wP sT o 09@ \0 BS@TZ@TP@\ pYPU@ ;T0K <J<!(00  0?0 X0 00CS00  ä0> =: 00 X0|& 0D\tT  0Dd -LjML0pD(0 GpP ,P@ 0`P` 0!0|pD 娷P@\ o_Ke/ 'P P`D e/\ PP3 DA@jX`D00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnUk(0 S (|Tkpgt4kT Qk%<Kk'J y(('` -LM@0PKaP  0SpY R 0ST!T4K0p / 40(0 `p;p@ P8PK1  Ajpf0S f0@4f @480#4  f0 0ilQ -LM@~g0S@ -LM@@f000S 00gg0S M-L M0hp`P@ \ |0 0  RP 00 0 Y@@H* -CML 8 MD$ BKL, :L < 8 \ 0'0\8$cP1 \P00\P` :Pp` 00LpP5W4w ,&(7Pp G<`T *0S P0hC1 @T:BKH@7H (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x   ` h p x     ~044 PSB>K0C 0C0<0  J9tP#W4 ` 0S44<X0D0pnP44 0 44 `W 0SD40D4 !9XP0W`u 0Sr BKHH0 -04P@St  4D <44 !\0P`T Z00R00SJ8BKJ J P 4WpP<$ 5:1 P<4PBKH0H 044 S;;S<$(  00 8DD PBKH0H 044 S<,  0 8D40D4 PBKH 0H044 S<$8  08 m8DD (PBKH0H }044 S<0PBKH 0Hg044 S<$4uPO0BKH0H  Q04S<0O7< \PBKH 2H8044 S㰠<$EPBKH1H !044 S㰠<cp.PBKH d1H 044 S㰠<$kPBKH1H 044 S㰠<5P;BKH 0H044 S<$P>@ d$LTlxT@$0(H*Dt'DP> a0BS50S2<$8a AR:R<`0A8̑"<W @$  sB>K0CH4 H@O0`L0p H z04S@$0O0W WLO0`H 0p c04S@$00W@4 p1 ?A`XPTp *0S ӰP0h@C1 0 @T:q10  00S044 04S44S ( 7044 0@$ 0@4 @TM TZW> `H p@0E.KXXG W2 `H0 p@0X44 ` g @@gA@W  H <3@$`L 6D$ D$ h 6#W `H p0E.KPX W H0 @0P44 x ` 50  R0 4((00 08/5x )5,8S$5K 54  4 D58t54  4 1`5 4T 54 544<L` X        -L3Mp0moKPe/OK 0 e/  KK?KH2 01 2e/$1 ( A 0S '(  -d1L(M\@@K @ Dq04Q@K`@@ 0[< 0VC 0Q2 0LH 0G2 0B0. = j f bc ^ Z5 0p$B 0`XX Lj'4 T(T \    `    8 x    0 t  82P *0P ": -ML M l NK ) e/@9 , ;  Q ) ) )  P  P  P NK)@KA>K0CA 9 INK@ @DI NK@lNK@ P`\(K0NKHS㴠04@@ $ ?a(K0S (K G.K B0P@@`p p4T p 徐\4+S:\4 X4(@KS:X4 0 S(PKa}KNKAe/ 뎮KhkJ`; X c P+xP000CS00  ä0+0(Kq0 P@ P 0@pS񟗐VaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaYaaaaYaaaaaaaaYaaaaaaaaaaLZaaaaaaaaZD[[[\a\Yaaaa]]a]4^__aP`a`_aaU _OKe/ NKAe/ N.K  BP8NK @ hFce/ ? c0p8 PP 0SPXKL@ 5p 8`P@ $8 0 ae  =cǟ7 R@@R@bOKe/ NKAe/  \  F  CNK0)@ NK@e/ P P  UP  +e/ OKe/ NKAe/ NK@NK@e/ PxOKe/s NKAe/n NK@ OKe/c NKAe/^  Q    NK0)@ NK@e/ P )Re/A OKe/; NKAe/6 NK@ OKe/, NKAe/' NK0(@BOKe/ NKAe/  9S    NK0)@ _NK@e/o P IT]e/  X    NK@  J7 \4\&UYNK00A )04 RU X NK)9@3 R> C#PP  R0000ӑ yS0 R000ӑnSU Pd#00ӑyP ,0 S D,ނN.K4  BP@ 1NKAe/ NKAe/ P^NK@^U \)P@ NK A 0B`"b TTaPP0S NK@e/ P Y POKNKe/A7 NKe/@2 e/. NK@ \ P1 R P NK@ )9N.K0  B&P  1M0NKAe/:Ke/ NKAe/ NK@3 ,2D'|f  ((F'ATTrdAy\J0XW() 3DX y`x(<` -MLMV@$  R, 8 <  SO a`LV00Ld V \p XwH,0 S @,فL84 0S 9@@ &8$LD8T08¡8T00000@4BNK @D @D8 PDT LDpD0PP0DT0 @K@0L^P`FK0`  08LP@DE>K  D$ 8 (0HD S DH0 8d4 d$H"8@RH  `T P@@0 PSd$"hh p0S hD0 S0S` 00 0S+KT0RD$ 08L@$0PvDT0@@ m 8@P@ L|a_XD00\8L P D$0@04<8L$dP3 R DD 0S- Dd@0@@0` PU``D0@@0 p  P`0pS :0S:@8 }P 88LeP DT@0008LPL8zP Dd@000dh.8@@0`0 @PU`DPf`H0S'`D@000h 8L4  0@ LD00T00S)@TLD  IP 8aBL 0S i0p@P`p`LQp hLTUp0BKa(`KH\0 (KH . 0<k'(XWPW 8`l R-0LP3 `aF r\*(\` m齹 R 0@@   0 SS S S0d0T!\  mV(<<P0, 0 m[(4Ht -SL4M< @ D  P<0a EH H@T8@K<0H@(T,` (f R0@@  <HL PL 0 SS, [R R 2[D@@08` P``H<L X0HD <LpL " Y<DLv`0pP`p` @m L '0SL [2[S[8 @4@p`` PL 0Op0@<H L PL9|2 R 0SS 0@@0p < P`0pS :0S:D< P <|<HL PL 8K<HL 1PL 8@K 0SH<L PLS Sm ,0[ SSi 8@D@`p 0 S:0S*D (0 000  00L 冸D L0 0D@0>D 0@@0` D0PU``1\ <( DDP0 0(-(XWPWt -SL Mp, 0 *\| a\wJ,@(Z` o<, Q9@@ \ ZT , tR 4 0( @0 P` \. 0S*Ÿ(8@ P!0S4 0S S 0Ƞ, P`   0,8@@00@ , P0WPPPP P Q, 1o ,P(,(Z Z" ,@ 2R R 9 8##Xp00@0` 000@ 蠐唐嘐圐,0(Z 88P0( D(PWHWD(t -L,M4 *K0 P8 [3H Z@@KN4P0KD 8Ÿ P0@@0 ` p @@KP0K  U)dB0S%< W@0V<@0R@ Q00YXY0X0 @KDZH0ZV4 @@K`pP`8 0@ @0  0@  VUV0U07ZY(0 0pS $ 0`0S@ "TSp@0K` 0 @0S48u@ K 0S0HWPW -RL4M0, 0 > a\8J,(Y` o鞶,  0<0 0. @P   .(00  00P 0t0[K4d7< @P@d `0`@bS>4@D( bP$ 0060@D0N O )<E~K@4 kS gS4$(:P @DmS4(4( Q0a#5P4  4t8pPt h1(K R-K,U(K0?S X0 ` BR X0  äX0X ) -LBMMB>K0C0C8 , <$ 4 2@ (K0S<@T8 2H$ (K HQD )@$D4@0P@ @0 `0@` pPDD  0@TS2(K DQ1(KHD T@U,0 S ,y<$r! 4 n 0n0C B#B""a`aD$  WPxx!xWt4 0P4X D4P<Q @$B~K$!pG pGXPB W(0K GP# 0( K(0K QQa B DRR4"ࠀ98$@`@0 84P``@48<$BL00CS0X0  äX0 ")'T((< -LsM e/0  K,0 6|8|xh;W!p0l!8PP  XҠPpX/W-40$W, 0pWX 7 W@0pXW00CS00  ä0 (1@p PPz  @P@(`A Q ġ,@ P00ԡP@$'$70`*pw 7 wxl`,pС0@&P00ԡP@60` pw |6|k wxK`0pС8@P&P00ԡP@860`pw 5G wx*`8pС4@%P00ԡP@50`pw t5t# wx 4p748 @<@R00@VU`PA``ԡP@0$4 pp w 0<Ƞ, 0 @X  WT,8 @ P ȠP`,8@ R9Q78,8@ P.0S+ȡ,8@ Q P:0S*,(00  Q00 R0x00@ȡ@0 ` Q PU``X0S0S8!07K0C0C4 000 !P=@0@@ 9 劝PP 4S JnKⴀ`F10 "\a0@|$叫Tʄ1SBKAA  0庹'h4( Jp4 -2$ML, p0@@0 P`` 0@@0 \0, p`P( u 0S0S `9 0S0S t0OP0v <0Dv4 04HW4(PWP50t -LLM0 , 唠4 80 L P 0@@04 80` S0@@80 P`L@`0@@0PP  0(#SS3,0Spp w 8\< 40S:0S*4 彪0. @0 @PK0@Ÿ 0 S:0S*.H@KPP@@P@ P(0蔪0Op00@@80 0@W^ 0 R? R00RP002Ƞ,8@ 40T @K @@K P`  X W TD,(00 @PK00 00@@0 @K Q 04P@oPp,P0@@ 80 <8 0@ 0@TSh0t. $Xx 80HMxH8 0T5 6(PW8660t -2L0,M, 80 @P^ 00C Y   pǏTL   B020 K`0 K@`P!0,` Q`Pu 0 uv 40 04B","0@ O @@4OA08 0XLvH 00q@00PKp7(7(0\7t -2L0DM, 0 D0 @P 00C   @0K/T   B02@_0K0 @08@4哄᜚*< P⒤*LP H P@ P0L@ p` p,0HP@0!1pP@L tC rQPkX T<@K r; (1( @K QP0< 0@K 8P4 58B"`P,"0@ N @@8NA0D 0u `0huX <00 K@ Kq|777(7880t -2MLp`0@SPP@0P@0 0P@ 0EP@t L0L tu@u ~x8|8(0t -2$MLp, 0S) 0@, @P!0P@0 1  `Pu 0 uvM Pv 0B頠!P `P3P @0P`VUVU4~M 0 0 P88(0t99H9 Q-Lp`( P% P# P! P !@R ZPP @T! 0 /\ PP P A4 $0999(t|fP0S  0 S E p-LtM`KP 0seh @T P ~0S8 @puPW9rdAedA|f S-Lpo UP* %DP ( 1wZ 7<@@0 (`,048PR3O<(`,048P7\ L1mXdP uPW 7<@@0 (`,048PZR3O<(`,048P7 ( (0R, ,0R0 00R4 40R8 80R7<@@<0P  `  UV@2 44 4oP0$ 9($:@:t: N;tA-0p  R0Z<  P`0O;PA>2 -L M0U@pY 55 u  % 5P00xйT$4@  $Pp 4Q 0SDP Ppd P(D0: S  S  S0 0Ep{ 00 R000Sg RꀶDDLD?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qH0S0||D K1Ps1 @u 00 ~G!0!@f 00 oG0!@g0*G0d!@T P!P00p 0Q  G0!u@0 0T PG0 _@0P 0<0  H0tx\?$\m @d??????@$@ -LMc0Ss0S 3 R S0S3 Rt3 R hCP[HP,K J0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP;@2`DBH可P(@ 0S 0+0 !a}000+pP !1aA0 @@AP| @ 0X$1 Kv@e0APR0: SN8 @TI0xt@ -\0L RL H0 @R0,0, 0>0>xA8A 0-QLP) 0S-XXXX0  hP@ڸ0 T ;;S0@0T@|0 tS>0E\ 0T w>00  fhP@0 0xt|xAA -b0LP@@xr PP PX"000SQ(\Uڅ;;SNU8U0011 U00R@@T U 1 Q P=YE!0|!>l1 h=\=,DE0S @E0S D@ <000Pxt$HC -L M䁟P@P!0S$$$UT<0000U$ha 0 RQ R 0QC!< 1 R C T:P0U$`0 `[0 njlȠ( `0P@( Kd$@ PC$0H o<<TxxCtC|CCm$DHD -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 YPAb0 0OPV?KK(@D@D?+fP`G?+fP;@@ H4P+X@ P000 P ,0 S ,g6C0 ;;*C ;$C Cp  C` C ?+eP}'tmxDDHDDDD$E -LMdNK@D0 @Dp (0 Pw P  0 y,NPi,K-F,9,K'@,@ sP, Kg>0h 7+P9T +P XPtH $I -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S ,b0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0Sy 0 002,P\0` X@0 W-P+P' ILIPH@TI -bML$Mx0x@ R  +P P L0 Db=K0C$0CP0 0S "bP' dM -%ML,M%K0(J⒍K JE(H,0 (H %b}K(pG P`$pG; S/R P58,0 S 4,a KH%0R/S /00H5 0H5` %,K( B:KBP_:KP fL%$(K0: S 4 o*PsPQ.P|4 R %,PsP00'P@40S(40S- :KL5*KP/QH xKLP 5*KP:KH5P@0S 30S #a=(K0Q|3|#׸4*P#P* $P$C0S3 R *KPP0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V D*A u%K(JPJuP@ "   {R<0P! 5t,11 0Qڍ0S0  (Ka=  ,-0QBa=l (KX00SX0X <0l 4'd IIIXP8IH(@HI I -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4_4P 1@ X40$P$ 0S U0 R @4P r @0| ,0K8P P/0ST 000 08P JDJhJJJ -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R H3HX,@\ӯ \h @(JK  0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P0W3 8< 3\T -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T mP T $`P  00T 0$`00  XPl0(&PC3dAd@d@000XRP\T -LpPP 0S ,0SP!&0aV 0S ʜP0S$0 0@0S# V ➜P00 0$ 0 T %P(@`PP0i000= -LpPP 0S ,0SP %0aV 0S nP0S$0 0@0S# V BBP00 0$ 0  %P(@``P*P0000 -LM@(+aMP@ 0S hO -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 夛@0 0 0S W0'\hO tO 0A0- SPL@ 0]0S8  R0S+ 0+OO -a- `L0Q!0p@[ P20P d 0p QL e+4 $\+ PP OO P0 KS- L0P 04P -PL@LPgb=0  G|1  @d1  9Lq0 241  +1$  $1*  00   0A0a-  mam` ;P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞Tttta=0A 0bPP2 HD 0 P,2 0 P 2  x*$0 S $yV1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 *@0l A 0Z Pv A'0  P F $04 4!N0 P V $04 4`!f0 s L1^  l P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#Rt (,H8$0 |0  t -H$L|M0 ,0 X P $00CS 4   4圐K R 0  1 P3=6K 0) P7#00CShphha=0p`P@00S@b-P ``06  P03 ($3 0 P3 0 P 2 (2 ,0S ,T2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0  (sq0b= 0P@60 0N PL [b=0P@06\  0> P '0tqP  QPQ(,$\QQqQ-H0 4S Q 0 S  q -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0yꤙ (,$08H P& -%L0M0 (0 H .P4H@ AR4  0AS#$$$HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 y&S(0 S (yR0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#'0QQQ (,$R8R -0` LK$KP P0`P| P,d 0QpL0L {P0, {% (,\R 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0,\ 00h7%40 |000 0 x 8pR(, p-LKtM @`KP]P   \L0  Fp$pF,0 00$RR- 0P ) -LpM`@K&PP X0PpWH0P 0R ,0 ^$P,R -LtMpPK@P1 R* 0R5 0: S, |0PA P + 0Q` P X 0x @$X+0L {$XP 0R @$,S8SLS -MLP4M H4p , t * $00C S*---------3P3 RIKII 4S+P) s+#0@P \ `3 RT3T P00#$3 ,0S ,O3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L垓P P0SBB0S1 R  ;IKAAP!0S$\1  #*4t!#11  BnKP`F`FU!B4: S>p@ Pp* 0h#00 ,  %x '#B X 'hp(,pSSx8lSS0ST p-LtM`KPuP 0@T0: S .Ppa*L 0#pPVpQ* p,8TLT -LtM0@/SP @//㤒`@pKT/ `40S0S ĵx0\0S0S! Fx x -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HEP)00 ") 0"lTT -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00HtP)00 T") 0M"lTT -LM@l0Sl`0P y)0S u)04 ,"$0 RZPdT -LM@ 0Sl`0ڑP L)0S H)04 !$0 R-PdT -LM@0Sl`0屑P #)0S )04 !$0 RPdT -LM!@P) 0h!T -*0LM"*@y<P( 0h!T -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c( 0 X!pW;P  0p\!x/06Q`|( 0 눚TU$U4U p-RLM`0 Pp@0T<  BPW( 0ph !P( ThU 0-0@SLP 4 0R0a 0h2$8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  JP p R0 RPa- 0S0S 0  0 ,0S ,LK(A4A P a=(K0Q p0| 0QX0P'4 0@  ' 0$ '`UUUU? -0 0R00000L R0000 R0@00x0 RlDh0P PP0 R P$ p|l $U p-PLM@` 0S pPP @P0/S00H 0 S8 @`0 0 PPPPp V,Vd0 R00T0T QH0  \80 R,0 P0"L4 0-0P LRl0@T 0S @T00SU0 ((8P$TV(ܾ -QLP=aq R1 0S  0S0! @0S00 0  P 0P 0P& 0` &P |PC 00 TVH -L#L M0PS44sp P 30C S8>`>>x>>>>>>>>>>2 R 0, K@00KtP0,0 0y0  0l"(0X"" 0@"bMb=0@`l `0 @p 1؁ * RY 7 R$00  +QP0 `ç 0!夎 P;0\1 x1%& 0\!  R8a- 00 R0 !0 R  R00 R0 00S  0a @0@00%0SPA%h 00P2괙$VVVV  W8 W -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p T pPH sP  P@P0  P <',WLW -2LtMxŸ@0pŸT S, Pp$T Ↄ0 CR 00һ2 ,0S ,I0R Y X@K1 R@(08&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  ᒋ:TP 0 0:S l R1 0 LP0=?0C0 h鸙d%(WW p-LM0@P/(|P00l0s0SP`ph8<h0Sph00phꀚhld -LTMptp % p 00@JS񟗈NOOOOOOOOOOOOOOOOONO$O0OOOOOOOOOOOOOOOOOOOPPPOOOOOON(P\PhPOtPOOPOPPOPPPOQQQQQQRORp(4qDTR0S`0@0w,0S 3wCˊPv  4 um4Po\j43d Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: 2p2pH2p 2|2 pt2@p}l2pzd2|w2|P1@ 0S `Pa0CS"@QQQQ`QQQQQQQQQQQQ1` 0S{1P1P1P1P1 87t1p1{1lPzqT1z-L1y*D1y'xP0a,AH0pK @p b<1P@x   0sP@ PUH@ 0d5 0'8X<hXX89X|pܙl(X04X,@LxX$P(@fXY(<t 8n9(( d%d0Y 0 BXL0@0t0 X X0 t0SI0S| |0 0STTdTdTT 0S@0tP0 0S0 0S @0nP 0$!0S0<1 pP1 RH!d1 pcb$^ Q ! R 1R B Q QA1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PᄨLM@, 0 4 8 0\(Bp 00@JSWWYYWWYWWYYYYYYYYYUWYYYYWWYYHXYYPX\XYYYYYYYlXYtXYYYYYYY5%95@5P2d0h ,X0(d%000$T5045@%, 85R Q@b% % 5 00CSTY 0SYY[[YpP. Ym 80I`0< 80 VL PD;P< PpXP(L4 RYPW 3 , RC0S 0S P 0S\30 }QoP@ ÇP P 2 P 2Pp(嬇P `P 2`0P<0 20H CQ0"Q0~ `2PtYPN Ya 8 I`0 @0 8 V; @Q rP1<xP0B LP dP}hP1 RY0  ]inP@ NYDPP 1 K/PP 000B"P(P `P`P@  P*/P|$z `0S XYXYYYYYY|Ypl$xLX8d%((x'YYZ8Z K00C0 X $a -ML M\\1 `P$ ^KPE840,0S/0S0 S0 K0S( .S @ Wp ᬀ P;0W$0 S x$<d0 K@TTH~'`aaaa Hab8b dbpbb p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 0Mb -LcMZK MpKK K(@DKK( @DN*K", 8KWLK KPH0`K: bK(J,J 02P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,;T *0S 0TP*0S0T0* K\ 0 1(K R K([u0(K RK*K:K(ZKX:KZK(8Bu0S  KP KZK(8TKQ :K(0' T\bb(bbc -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV c@\S R0P -LMp㦵1PU|PP 0S`QDP@ 0 S/R< ,4aP2 T,/00 1  zbPP 0S~~~~~|00 R0 h@T0 0S/S C@ ,$T4c3$dHd=hdX0X P#3!"c1 0c!R 0S R(/>3( p-PLM@3 R0 (a0S= 0#S4 \S. &PP$ 0"C12d1@cP 0S P?P P0! 0px  ` 0#S@ P,寳P  ,/>3dd=dX0X P#3!"c1 0c!R 0S R,/>3, -PpL`@ 0Sd /PPp0 S 00C S0u 0SмP@j U 0SE00*n0S1W 0S !0 0P!10@ @@P000 RH 0 Ӽ, } ̼x P 00000 0S MS CS000 0S 0S cS mS00dv,QW0p0@ .QT@}  (9 e $4eXeteeeef@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R  H -LMP 0pS@ q 20  00S| 0S>T`q @P_0 1 !.B=R pGV0G SRꨌL  0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R Bp010!.CDR Pk?C@.PT @}H* 0-LPL@DT  00S0 = 0 @f -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00ۺ0hغ00$qv -dpL0S ` AT@0`V01P@P幺᷺U0 p-LMP@T0 p0Sx`t 0 h0h ?}X0PC000 d 04 4G`fhfLf -ML0M (R04 ,0  2 ,0S ,64! K!8 0AT ~KpGR0pG8 @TP@, Q0 0Q  CP XD! T14a=  8,1008 A>  0`PS 0S030S  ^PT 4a=0 S0ń8  $ 4'fGLfg8g\gtg 0-LPL@DT  0+0S0 z 8g -8L@T`i !0pAT YyPP! @T lP@ dP dP 0! 0A吹Ꮉh: T  /yP 倹 ydP % 8ggh -@L0`SpP` M0AT yP @T xP:0G08 0-LPL@DT  0铯0S0  <=0h -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q ŸP@ 0`0 10 A</>3`h -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S pP 00 0 0   EB0, PhPP 0p p00  ` WPP 0X0@ 7P 00  <Phh 0-LPL@DT  0魮0S0  @=h p-LML`0S P0AT  0V@TPOUp@ -LM䀟pPP, / 0"c12f1`cAT 0S @TԷP@ cP pP ,000! 0A(o0ST @/>3,i 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00ῷ0@/>3 0-TPL@ T0 04 @00r0S00S0Dę`i -MLM,Q,0S, p`* 1 R 0/S BKAA<P % `Ѐ@0Q P@pbBP 00(00 徠 000 ,0S `,3T |P 0 D'iHęii -`L0S$ PPUJp0"S@0S ? 0RH Q B PUZ000DH p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@1p x -P 0S\ \P00S0 BS,4Ġ00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR|00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  YZ0S @T0   00Xܙ -LMP@ uPpuP \ 00CSP0 @ ($ 0iiؙj(jXj -LMP, P, 4#, 出,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8   -3LCM |3 B, RħԪȪԪԪ83 R  3 ,0S ,0BP0SPdU <"Kz d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP P@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A 婯PdC000 (3>K 啯PVXCX_K#^?K@|A ϦPHx!1RS@$0uP0;CS040@4Q0S|  `dlA  !r 10C1 =At0\ T0 02P@T00< KcK0 ! ݷ`VKe/K:1  < K eK R x0S: A U( 0S +j5  1 刡 n 00Ì bK 0Pʱ+ 0<6~D$&'r464\&=K@ӮPpOd&Y?KP0C PŮP Y?KP0C P差PwilF]?K 墮0(PK0@00  O? K ^ 300 0p1  000+]?K| W ]?Kr 7 ]?Kh ~P@ 00 姯OOK,k@@H 0-LGP:0^  x0\*m5P0\@ PL0@ DM@P@4ޞ? Лlt$ -LM@ @ -MLMXXb0PpH,0 pp03*0* 201 0 2 1  Q P1@ԡ`0 810 @@d0P0?P P$JKx!(@D@D0h!`P%ok 0P ,0 Q  ,;' h`8#8P#$0$ @JK(@D @DK<:(<2: !<(K0<:(<2:(LL!<  0忮'd̛\`d`ppip̛ -L4MD 0K`lD 0P@K0 Z L7  剮  ,D h0S '0S0 0R0; 6"  O R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $L0 0c@BHX@000CS00  ä0e S7 S@'PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0PHpWp!pW T0W6 'W00,P|0 ă ā Ă< 4 <( "4\,<pW0 PH 'U00CS00  ä0 p婭D 0T Phß00p@gU0#DHLᄭ$H 0 \DP0S.W)4S4#0pW@ *0 @S0pW:n0pW@ *0Sp a0W:\YP@K0/PKP@0/郗0 \G 8K848 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7   pdp̛l\hhq((,q4q@qTqXq`qpqxqq`dqqqqxqMQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004婖K(IITK(JJT$0 tzl * f^0# ql* ]^#0S`V* XЈVP@ʈX0 ҍ - P@ἈV0 8#0 ?l *+^ *'^Q 2 R v  ,0 S ,M$2@2@P0 ДŸp`0 ɔ6@PK0L X0/0Ṕ)K@ B0/0/P@@婔0/P@@0/ᙔ0/P@ @K0LP@0/@刔)K0 BP@0/@KP@P!<0 @k *] i W P@M  kf  k *]3K (JJ0 k *] 0RBK(II l*s]Y@A'((rl$rhT墵H*xxdxxx "2S 0 1R0S 0S̛ -L0 㱐!x( p-0LM 0PaQ*@PU: P@ x 0P 0 Q@ 0S @@Tp0S 0 @0`X -LMСpPe 0Qi$0Sƚ LPo0@0  Po0 z5@"%$0& P9 MP P Ꮸ(` 9P0S0S} 0@ efXeP0 0QO$ 0M 눢h|f(y -LMp 64 K, p" PP0S40UX0SP `4V ,"0 0S@P1 ,40X+0S*kP8 #! Pܥ`S/0 P\ P8 L; 4,  00X00,00 0S0S,0 2PP0S  4, 0t 00PPPPX,00@0& 0 0 0$0&0PO}t0Sqmꈢy - qPFL` o0 Q00\0S@`.Q,*\ L0S `00S  0 Q0/S0S:0 R P /P R鈢d  -MLMp0P@AnK 0 `FO`F 0 0U0 U00S0 U. 0S l g@H0S D 08: S0  ',ydyzz -L@!x1hFSP/ 0Q0 0 : SFH` d0S T(0S 10g1hhP  PP 0hܩz zTz4z@zHz`z -LMa0P, 0 (@ tt1L pKR `0 T! 00C SGh0X8X@XHXPX` A?K K0 0Q0 00nS 0 S 0nIK00 K pKA/00, W       'hz p-LM(`P,@坧P ,FP p  L0S$ `0! 00C S<LtTt\tdtlt|0 0p0000000ꈢ -LCM MD$E~KpGpG 0,           `$ \$ ` 3* R@ R  ȣd$ 0SP' 0Sk3 3(K |3P\4 4 XT 9@T40 @TL T0@: S< ,(P,0 S ,2 2@PP 2 P2R( K"\$ XD @An04"T2 R0S <iBNK@D@DH P@1 qd4 S00C0 zy !1@01k 000l<y \10S @&<nx0)0S dP^ 0 qPV 0 UP@ x0SJ MGP @0S? <4I 0S t8'zpzT|zܩzzzzz<{H8{P{d{{{{{ -T0L8M<0 0  8 @ 4 0K0 , ( $   Z@K3| -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P,E.K B B0h$ !1`$ (@K  d 8 X \ @&?ၑ hBNK@D@D 0 P h F0D_0 p` "p'd{ -LM r`p&娋 PP(0Sc P, (0, ( ,0VƗ@0 /j0,000S7RP@N &,0SA&y00,0S0 00 ٣0 R !@@P0, P( ,P6  c Ɨ@0 S/0,0C0C;0 (0R눢{T{{8( -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  ^0001V' @ 00CS00 0S 1P01rXQ0P 000,0 QP鈢 -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,3 0@83P @" Q 7%0$ :  0ePPd 0hƑ(0CC1/|x0Pw00S  n Q<;P9'||||ة -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0  p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S ,\ 4 0 |00S00YX   D0TPDHHPH @7 Q L: 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:080|0` @P0088  <  +'d&||||ة}P -0LM PU@p$`y` #T*U0 R  0喃" l`▂#0U<0 R 0p 0喃" ԩ@ }4}P}h} -0P0 P00LMS0 P܀ R0 P.:p$60PP5`@2:(P`@,F0B$|P0 R0`@00.$F00$@0 pd} -!LM0\00 \pG\(:`(P``ӝ,F0Bཝ$˝0 ƚ \ṝPt0t0l h d@d0 B0(0000d}\ - 6 8`0(@ 0L 0SĠP`傝묀pplP3@00 00`PS P@0Ss0S͛P,D눢} -LM@P00 -LM@&B ? Pa(⚛PUp* 0А0 T00P00@ 000p@0 (($`"d0 dS D 0 Q00ǛP 눢X`TL} -P0LM@֜<0 P 0S P 뼩T~ p-LM``0S TPT 01@CT*ge000p_0T*T`X 0  ᨩ -LM`P@aUpᰀ 0SP 0S 00C0$d 㞞\0 iD80  \0   >TQ(~\0~z 0-(0@ LRP 0 ,p, 00 0-(0P@LT ,ZP  T00T0S 0 T @0d 0-LM@N0T0 T00S0 T0P=7@H0S|1t.p0 Rd T$0K0 P 8 (<~dD~,L~P~T\~h~ m -0LM@ 0h \ 00CS  00 00  ~~ -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`P( 00@$K^K$ @0 0 /&`$ 000H0G  W00 Rd\ 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 ]$0$  00C00<\ -LM@P r0 `0"pM b0@SB@T\1 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ OP J0 R T@DG  0;T@Dl6zX T0 R 봩`X~L~@~Td%ii~ p-L@M P`K B0S 0S  j p -LM`t`ğ QS, @ DdI 0S 0Sm p P0S 3 ,0S ,s 0ṢģL0S/ P먓0S 0S0\CS 0S 70S 0S @C 1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0 R | P+ h1 !0/o (K0 o@0 ,?0S {0Su P 00S(< ㅚP0S X^ P D <I tt̩@(~ЁT\P <H`xĂܾT -LM@P4Ppc`VWW1 0S>000 0. $0`F0V$0@X L0 S00*P (@ R00  0R 0S R0R0S P 0 R P` gX0 S00Dŏ<</ȩHL<T0ܾT -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  ꈢt) -LM`VPڴp崀S@PT 0S  0T @T R 0S `FVP 0  0P 00괜L -ML M0,0   BR*.*...xt P d$ PTDT$E>K0C4  L44 $0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:_$3 ,0S <, 0S 0 S s S # P"   00C0 " P  000 00C0  TR0S-@<2V@[ P  +2(K_KK@$ (@0\4  X$ sM!Q& B0O0  0l{ 6`X!0SV Eo0 ᒂ5@"%$1 R0 P P. Pd P D0:90|f'X`$9/ȃЃHDT@z4zܾT4Tz<l -MLM$p\0,0 (`; R 0S  L0 S8(K 4  `0 A?(K  A?(K D KKgR0((K0Q 0@^^>KMK 2 P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dZ X (,0 S <,E00 00CS񟗳11`3`3 4 4$0S&&L0S6 `03  00C SKP2(3P303P383P3@3P3H3P3X3 0S 00C S'22323333333 300&c P%00C00000000      0S $\NK @D@D0, S^K PE0 0%z5 R $\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00r PS L0S|3(K4!  `0A?( K A?(K KK &Q$\0 0 Q0hNK0ᴀ$00$03  0`0C0  @@Q @T; Q 0S+ 0 SP $00$0P "00C0"t>KMK ἔ PH"dD000.S "X ?5P00L Rm `0j 0Sg <\@P^>KMK @d$00$0@1  0`0C0 ᘕ崀=@t?PPP( j50.SR 00Ph L0S# `0 0S 0<0P$0  '@$dL\dp|T̄ԄHЃ<p ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000X`ܩ 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.:,;;,;;; 0QP 0S P0  00 dHK HKtHK4 00  9̩<P`z<H -LM`VP$Pq 0S8 @T 0S @T0 \( 00C0`FVP 0  @00嶏TȩH -LuMĆ0,0 l p! g1PW1 1 1  6 \pP  (` ,6&CPq !,6"! 0&7& &  rK f?KP4 Z(1P*P0Q0 Q00S 0`F' 2 0P:6P P0ş 0P1!5% Q5@!0R# 0<0QK0S   1, 0S  0h` K_KH$1R,6 1R rK P0S#1}R& ɓPl0SV1#nR&ẓP<6 PA0S 0S ) `1B 0S DrK~ P Ἆ ẎŸ,0 S ,j C1! 0 000S  ReKX P !&001&hP dHPBeK7 P & !00! &GPq '1z! ue,6KQ01,&K `,6xAQ000L0SD1 S@D0S!1 S* 0Q15021 5:0Q 0ׇ 0@0CSt>lC`C`C`ClC101 0`F4,6 0 ,6! yX@0 L;'@ȩPԆ4Xh`lt8 -PULp`:4U@$Q@TPZ U:ꨇ 0 |0|0 --L Q! ( p-PLM@P`l0l R ỏT D0 Rp80 㾹 0    m|@ --L  --L  -LM@B hx --L  p-LtM/P>@TK %P0: S p0`rS $ 0-/L@PU+D0 00L/00(+B+B00鸜 -LUMpPKPP@lK80S(0: S  SU zP U@P P@0 R000K@P h1: SD Zc$^@c  P-L P d, -QLM@ ތP T Sᭌ< -L7P EL -kMLM7 6@, @6K0A䆟 A 6 P_P6: S @PK 㢂&P0S| |6 Rq 0 S i\0Sa L6L&@HfHv@@ @@@@0 00S P5P(0%<00PC0S0S X5 ,0S ,L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5y@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6P, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@3PL x3PTChG T3P= ځP03$- 6SR ,@!0@T00 "2 㸁B00㲁0"S P x2lPP\Hd,(PPO@'kT J/ Epv1  LPP>, p&R0S%"0!S$~ *pu!PLm~`@ ,eX@ ]뚙?A'dP\<\T`|ЩܩhhĩDL؈8\x@dԩ؉ȩ8\LX`T8Ȋ  0X`l|ܾT -L M, Zß ?v3弃 ;mP c+ #x3R,p / pW,P  0bW@ṋ0EOa.6 0@Ɔ& 6F@V始3 ( &$6堋r 0(& 0Dᦋ00 ᡋB 0+00 0S02PU D2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0 1 R,d0\ B+㠎P 0 R,w6xP@kU*0 Q@tPU:aA ,0 Lĩ\hShd@Ћ0p@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% 舢 -PLM@ 00 R$hkT m -LMp@H`@vm Pa0@S p1P  0PUZ c qh10  00S 2WnC` `F R R010!,!lc.ㅍ 0P3 00C .  Kp_%[EUPv10GOa.U&`n  0 6 & `@0PV6@ p$)PH*̌@ -0LM@H HzP0T > 븠edA(<-L0(&S  d0 P0S\P P1 Pa S\Q 60Qꈢ -L: S  S  S H0 R4 S S  S S@ -1LM `ReGP@@ WT|1 RRp1 RNd0ST D1 R <0QXp(u00CS0X0@ӤX0,FT& T 00CS00 R0 0  yTYT nTNT YT00yTP xr P00XGpr@4L(ET<`PX' -0 @LM̀@@0 ` @@``PUPTp p j@gP00TQ  p0WD0@@W  0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0눩  p-l0LM@Ɠ0\S` @088 000 0 `Pp鈢P \ p-LM0@S` PU 0 y0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T ĩTXdhP 0-L0P LR @  (B$P 0 T<, -LM8pP(2G 2 R b  ? @_rTo 1 RP a@T T rP叆ፆUp@ U QW!0Z00 lQ3L1 R% PZD1 R 1o 1 !@Pȇ0 @C@0P P  ?r@0@ 0P PPUgHkP\hdĩT@@ \|h -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, ҊQd4 ,4 P[ 0@0K,0QM@4 8@ {H]4P8pT54 , R0,# @K@_@K0 ᝊ 0`Q 00Vs# %@!0P -88 x 4@0pW б8@ 0@80 0ĩȎЎD  -PLM, 00 ]@_l!@K0/a,@@K,< FQG 0 s0PP< ,@`K 05Q.0pZ o X@ 0R  @@K0 `@0PK_tp  ᤆ,\0 Z<,S00 ,Kĩ$ Щp@-l@00CP XPX`  Q2 00CPp02 0  pԩȩH -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH iDT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f fz`` /00f V:TPU L0L X0 0 TP  U \K@cH -L x 0-LMMpPANK@D0@D` 0 G> m80 :w 0S 0'P -LMn0@+"wwc@ -LM0@S j\kTk\k00S lh0 R \P0008;V`T -L`P]똡嘁q@!pb@1 P4lXlXl@lXlXlXlXlXlXlXlXlPlXlXlXlXltl|lll@@1@@@0 #9A00(@0 0QQ0 R|0 R 0 R|0 RP0 R XnP LIH0MT(,ď$@(̏0((d%H -0`P0@LpP -CPxP00U0`00m0S8*PP$ 0 t 'x` -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|3t"0`000R P, -0R(p0 CR 0@0R P0Rp0Rp1 R 0^ CR X000I CR 0000R0Rp1 R 0$ CR 000Rͮp0 R T 0 R2 0T0Q0S* Dl 70@" eX`l@0((H* `$0,(H -0p`0P@LP AP@ 000T՗0S XxP@ d0 t 'x` -LpM` 0Rp䠟%  p@ PP   PP p @T㞗Pl0l,d0 KPL, P 3婁P$ ((H ` -PL M@, 0 YP@0 -SX0`SpM 0A0C,S?uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu0,0  `  L4H4 0`00  p0SV PEU@ @P PEU@ȃc0S @PPE@ $0S33 |3 00S UD30 0 O*Y U Z U < ,  @U "0p0t0 ڴ@PPUU|@P\PUSPb0S @P 0S0S20S p ` 0pGS # W R0S) 4Q P  PE@1QP Q d㕐PE@< 000PEU@ 00S1Q& 00S   @0 rP 01S00S00S @ @|0 jrPp48 (|L4d4D\,ix$(x$ 0-TPL0@S s<0ޕ > 0P@00004$ p-1LM0`@PPǕ rP=UP  rP3PJp rPx0l qP`P0X500 DqP< 000p($i zi 0i t~i Į -L,MD0P`K@p,0 ($ g _? qp 0S 0S 0S%@P vP<   qpJ<@TU  @00PEU00Sp<,0 S,D'$i$ p-L,M`0P@@K0 +$   ?`0` hq0sHD  ,8 ㊫ 0S p'$i$̛ܛ -L8M0@(0 LKPp`$ ׃ >U0 @ PK>*P @Rp0h-S`@d>P8@ 9D0D qp0 (0S ('$$i$0@ -PLp M`0  )P`  ˃P 0 Sr200000S0p,Kt(P p〔,PU V" X 0 Sr4200000S q>P n "Ph0 r1000P^ 00S .B  AR #  7  tAR #  d(> $> 00S UP2  p,Z  '>P% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPUx,I)VL~W<<( 3PH*X|8 (d -L0 ,=(0( $ppɓ 8|$zi | -4L ,=(0( pp 8|$yi  p-L M$@K DQ喂8 op$ $}P`  $0 0 ` opㅓ 0$ PS 0@UU0  CR 0 R00 h= 0PU@H00CS00  ä0 }p$xi ((` -P0LMH@D0  \ (0$0   ($x -0L0   -0L0   -<0<L00, eo0Sh$|i  -80L4000 0Oo0Sh$|Ti  -L, 0000 0,$x -0LM0@S/ h00S00S P00  ⎀,0T, @00 0 0 0( x$  -$$ 0L00    -L(Mp0@PK` @ 0 g n0S r<3[x DT 0 T KnP@o 0S, }'$|i 80i DT Qd0d0A00d0LLT -L M Kp0,` '$P@\  0q-t0p00dS Xe*<0SHD p@h <$ P0t@l0@B` TtLL p-0LM0`0S ?P 3P!K%P@T 00S ;P 0S 00S` @TV80#'p tlX8 -PLM`@Kp| `$;1 @`'@0 DP 00 ,(0m0S3|8i ܝ$ -PLM`@Kp| `$x;1 @`&@0 DP 00 ,(0m0S|8i $ p-L,M`0@PK@$ 0 N F;0S  P0r00000Sp  ,K0;PX P{H0mp83 0S(Ap'8H*i$D$dt p-L,M`0@PK@$ 0  ;0S > P0r00000Sp  ,K:PX P6H0Imp8 0S(p'8H*i$$؞ -LM@0Pp`P  R0@r1000xSY@Qg W :PY r10000D0S  rt10000D0SX0UYDDeY 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S A:P@00 `hV fB`)H*, p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  ph8@T$@Tp)H*@Hx 0-L0MPQ! @0K  <K~0@0  ; K@ P \@@0[X <0K9H0H <0K0$lP0` 0S 0'|8$i L\ 0-L MP0Q 0 @!K  0Sp r Kp}0@KL 9@0@ kp0, 0S 0'h8$i| -LM䁟0\pK@8 P`K$0 l~@ h~0tL0 H0 0L0 Q P L0H K2lpK1p`K01@Tژ2 ip/-QtPP@1@SPTUpPl rp200000S 0:SP P8l PPU t$@T0, CR 0 R00٣p0K1S,U@ Tڴ1S0Sp\X1PT![ L0D hiP 1S  0 CR 0R00ꜣl0I00CS00  ä0 \00S),0 S,'|$8i i8iiiix((i|CBH*̠РTi 4 ->MLDM1圑0 ,   >KK(@DD@D d{` 6P hP` 0S;,8>{KL@K(pG $pG>[~{ z{ 8P 4p p6 hP@ <0S <0TPD( 0 0CS00ä0<0@T|PZP ,0S<,e0'T$8i (i|@T\((`h -x0L`! @ T @  0 CR 0R00Ģx0 8}3}tSpRW` LDLUVTP@WPMVpX$Xbd0S B0S 0B 0 CR 0R00}505P &d 0 CR 0R00fx07< h |((CBġȡ` 0-0L0MP0@@K( 0 z 5|0| gP0SX0 P0 H00<$ Ņ 0S(0'8$6i(ܬ 0-t0tP0Lh@h  \0\00 00N5@08 gP$T0|ܬ8H$5i  p-LM@`00X`PD 8t@P$NP^PpܬȢ -Lqd0d0`pTX0@#nPp@@Np0 H 0ܬLt -LM@KD004 (/ 00ܬH -LM@-D004 ( 00ܬ -L M0p$0  @pp`0h\$KP`@ $0@@S ܄ܬ<h40S 0S0S-L0S 00  S\0S$Ĩ 0-@PL0 Np0 㙄0$ب 0-@PL0 9p0 ㄄08 -LpPP`@l2d0p0`@0 @e8jl@T( utPh p-LM0@S`P 00  SxPp@0Sp -QLMPp W@cX0$  A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt H} H00p@0S% 4ip,08T(8h<DP -LBM MLCNK@DP0 @D/㋏KKoK,0 PPkx c31 ePp2(K 0Sc 0( K @<PP@JrP,E3(0K 0(K 0QpRKH K <P@P2rPP,-3 0D ,0S4,G'8$KiT`ph -LM0@(0 4$4Q4QT00CS00  ä0 T 0S 0SSzXp@K Ddw 20K( `0 6eP`0SP@KX( w 2 !eP0P厝rPp 3 ,p ePx㯈p @4 @0R0 0  CR 0R0060( CR 0R00' 40) CR 0R00`R00CS00  ä0 880< L:H20@S& 4Ÿ0S @0 0R 2!0S 2^ 80 00 0S1@1S^ 0\0CS00  ä0 8Ȟp10S P00@T`10S V8`3 0  㓞00@T PU`rX0@T  @0S 0 0$0S^ (0S(' m80ԩtTĮ`((l$i x6i(Ę8rT(@\ | -LMX0Tr$0 0S00+S (宇$B$ 14PK iuw D1 DcP 1`  01S# |vA0 x! cP 01S Dgv\4 0\11u<? 14 8#"50! 40K@  DcP 01S :v| /1P u00CS00  ä0 d͝ $0ST$;'$8|̪%i ت0"i #i  ((0 -(0L00S 0  ,0S 00S "48<#80  -DLM08@,0 0S^0+S ܆`p㓏Kpp <oP,030: SOK.u 0O_K0d cP%01SD;@ u,3 (K @OOK <}oP,x0]SOK.tu l0OK0 bP01S hMKP:.Ru J0O_K0  bPp01S <1<1<1<1 <1Y 10SB .u4 00L mbP01S) (&81S<1S !@8P PdP Pd j0 ,0S,'$T<08"i H\%i dxIi ̫ث0Qi  `   -LMPP1@q`P4K $ tV00V@/P 0 K0Ip@ 8PK 0z3P #.00`P|P@ 0 DsʂP  <Kh<004  $0S$u'x,04D p-L MK,` 0 AP0S |V0000 P00P0S 00p0P@0P0P0 `20pxP p-LMR@!X` 0S   TZ p@0< CR 0R00ꝛ0S7 0CU3* V ,0 CR 0R00ꅛ` \0 CR 0 R \ 00o \0 S0 S0SD>0 CR 0R00pphRp`h(( Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00, ` R"R000ӑ0 CR 0P R  U 00 R0 S0 S0S(() -LMMp0UK,0 d1`@ QAs0VP1 L /,.P MK!..AP /.00>0@` V?K]P b 0e~X1 R  ]~q0S 00S Q0S !"4 40X ,0S$,', L4p -LMK,p0 Q`N 0@S ~W0000T00TQP  r rT@D0T0T0 d20P@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  4#I(| -L(M@q0D@K$ ,a 0 cr$ [- _p0S3 0S/ 4P% dP0   _pK0@`TUJ-PPE Vt` h@00U00SV  0S, <'$8i$ܬL<ܬ - @LM0 04\ 0-Lyt@TlPll 0hΗ, 00oW404 J_0S 0h0|8$i $DD,D0D,0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`pZ P8 ,&00pP6 P@ &< 倧p< 10@GS񟗶`PX`x,4$P@@4@@4P$p4@$P@@@l4\4X4T4 H4H$P@<4$$440$0 s 4 #4@@#3@@330샟80 ;0e#00#3@t#P@@t#t3PT#@@3@#PP3|3x3t#PEl3(#00?$3#< s<82"P2@@@"0#s"000qS`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0S\2 R 80S0Y 0/;40$"0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   z11 S41 R!1 Rx!x!t! 0S SX!S0 R@!0 R0!0!,!4K< Qq< mnP n 0H 0000 K\P"[R0 ,04خ(xܮ4$ d%\Ȯ ̮0@,Ptht@ -1L1\0@p ᎧP`h ɩp1 R\0SᇨPPK 30CS\\l\\lD0.S# A0SW ᝩ@C0@T@S@@T  003S 0 R DxƔD0 SDT弔P0 g0S0ЮX`hL  -LM H 0R,0 0 0 0 $5 R5 R 5 R @@ ` 0KV㼐 嬐 娐 夐 堐 尐 崐 帐  @  QQ \  D0.S (0^1Q o @p0 D0S@@@P 80 @T@1Y1Q@ 80S @K 3 R E 3@T PPK0 #\@KK-0 #F-P @ nPnl QR P   eiP@ 0 0))0 0 0")0: S S 00R0 d@ `Vw R 0@S |@ p2KL"0 ST2  `V bi`V2 ,0S ,D@K"0 ,nx !0t p ,n! 0l , n1h R0d0  ` `!0,md  000 (0-S iLn 0R@@@ m P [~   ?0 R0 0p Q0 R YD `S\0 ]~'$,@5 ȮЮ\xL  -LP# \ \ P  \  Php P 3S40 RP \ 0̮ 0-@LTP 0S@T0  , 0 0CS00ä0(( -L MԢ ( 3S 2 R2 R 2@ipQ[ 0SU l2@` RL2 Ry<@K$ 00@(2 Rf  2 RY0: S SK 0SC (080c!01 R 1 R0(D1 R&1 R# : S : S h00CS00  ä0 pW (0S (( 680([ "88 #$Y T, xOX@ 0B ?T@0 h?u  X:l',ح$4 Tܮ((ȭЭ 0-0P R 0L0x0 R00d0 RX0 R H0 @Thh00$t -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@4h8 4hP80080 3S 1 R1 R 01@h80 R< ;al` g0/STR `Q0.SK R pGQ< 0'س|4h$0 ȵ -L(Mlq0@PKda @ 0 凉H OPD3[1 ,,!0zP"P  0 S N 00 0 x 0x 3KpOP8T 0ꊴ8 0'i 0L\pi ̵ -LPM∡0H@Kp|P `(0 HP DP @P 01 0 R 000 ^0 0-@0P0LSW[0S 0' ; ㆇ0P˖P 0x 00P 00鑲8H 0ꇲ$ P$,  -!LWM0,0  pJPUaKJ/ _d T 5MP=WoK0PS @W 0]KS  @P U00R00Sp0 ,0S , \\ K.0 ^0 O \ iD0D <` 0$ 3'Ji(0ȶ  -LdM┑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )0.0 PPPP0 R /  \ K^l`K@ Z0 0p ŕP ,0S X,= Z@៱0 '@ 8 -RML 7 M(% 4% @% , 7) ǟxx   , 0 8 < D  t' \p2 H0@/S(4@ x 0 (HT0Ɵ:;;@00S lVA0C2SE0<00S|090;0:0;0:080gş80:( 8 07iFKL L4EG.Kx t :  B0p l [P 0 \5 09M@ Wi0:;8ꌰ TNKA @ 偰0S 0 R 4%RQ #NKA %<4P|ß0 R 4 R Xh 0@0VtP00<0M,0, "NKA 23 R 4 R0 S  "NKA],l2`P0S2 4 R.". i5P"<肟@80 =y/ > <T 2P00(H10 \sP >T sPp!NKA P L0 R 4 Rk (`rϯXDD a080 00V00NKA n1Pڠ0 R 4 R Pø;d0 0:;7B/0<0:;:?.A'̶T(xܸ((4'H'l4nĹd%h8Xmx@ض Ժ $@ <$Hhp*4xл'u(Lp`ܶ$@`8dtԶHn01 bZ Z0% 1PFKL@ L@@@@@@|aGK@Hx t : 0p l P 0 R11 P0Q1  tA[2̃<P 90 I,%R0 KL@ L@@@@@N>K@0C, @:0C D {PJ$0S p0 00 )YP"0  NNKH2@D@DP)`' 0T `YPP2)( 0`YPxr vPp X 0S Q0S33 0 $.0% >5 WP$  #0 5@T @@T d\T`$0 00000000@@X@Tt@0D @T4 @0ROK4 Iq DP` 4)* 0 'Ypr FKNK@D0D% R44:0  4 $: 0 YPO0 8LuP00 0 s0% 0% 05S8%R 454 00) .00   ,0S  < 4 (%R <5P(%. 0s 400) /0   0Q4 Z|&0) %R P0Sh&\KPEt '@0@XP86'0@XP&@)$ 0 @XP6)% 0@{XPE(@C @ɰ  ð 50C5 | @ >qI I,(0@ Lx00MKBKK dhdKL@AI L@ A 0IH P L PUd@T]0SV(0 NP@0 5 @`P> H804 =KL0Cˠ 4 $5 4 HP5 D 4 "P L%$  R 0SLPڴ0   C0S Wݬ0S  @Pr8H@:0=KEK0CL0C 0 0Wp: Rh[f ̰; ɰ//k D0 S \N>K0Cɠ@ 0Ct* @W 05 oPP ;@<\0+0@0 )<5. xWPh0s )|; jWP0s ); \WP@P 0)3 LWP%_P$O.K B BjPHjPJH4%4 0 @% 0) 30  @0HP@ V @ThOnK`F`F 0P@5@ 0S>HPLTK,3I4]T@=PH) P04 X=@O>K0C)0C& D VP 'KNK@D EY-D)+ 0 VpDOKI) 0Vp$,.N>K0C 0C@ VkPT.00 1l~$x>x 哬P  1 PPj1 hJH  0 V$ RH,%08d/PP0  P$ 000P   -LM8P |0 R 0 l00 9L \:J7P 00 @4 @ @ @ F K kV@@0H<00    0 $ -3L$M R 0SS@@@@@@@@@pp3  -U\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p Ԏ0P0?@ P`2 X0 0P 8 ,微@K⻎<@@<4 Ġ̌(<"4!Č ̌$0 -ML,M"0"KiK0(J, KŸJ@(pK(I @I" RA * -딂0" 7 * #tr0p" - *0SP `Va (" * *Q 1 R SQ  xK0\ ,0 S ,&:c,P@0 2|p`0 20 P@q10 X1 .K0L $1$ yK0pG@!0P P *,,P@(,0 21T C10 X2 0 t   *vY@'H40r,$rrd(( h -LMf@0 @ 0 PRDNNO4OPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPOOOOOOOOP PPP0RQhNNNNN\ 0S < 0$  048<("#0S S圥0S S 咥 048<("d`傥SPLHy@<840,($ PPK⬢ .0cNP [ .0YNP Q. v. vA0dpC= 04SMPRR R(Rd0`2  _  R$ R <W 0PPK .0NP 0 DRWPPK .0 NP pU 1MK @D K@D @ @ 0Xt Ptpnlhd`\Xݤ ۤ 04SlRRRRRΤ0   Q1q' ,T,P u@0SPE .,U 0+S-S0S .P.P .U@PE PiU`@PE0SvPfP wPr P ~00S 00SQ1 1)t<;RPBPcj_4@@HLPTXT` p-LM@HLP `p -LM=@T00.00 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SJ/;}l< -L0MԂԢ 0Pp(0 PTPK 2b40S @@PH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K` 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 EpP@u|*`0A>@t 0 001 0*l(pP|[*?T A.0O0P000B>0,10S 4PU/0K000 z*B040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0$hd@` -pLM@ 00s)0@d@-`@? 0"00\ 0S0S000\$ -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$$ -x0LM@ 4 BN@Ap@0t hz 00Np$ 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0$(00S00B>0@$@-(0A> 0$Đ6I $ -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 $ 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc$5=?0/9P6 0S000h p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0xCpqph(p$ -LM4Px 404@0  0000 0 00 0 $0 00  0?\00$ -LMX@ 0S 00 0N> @0S0 04h$ -LM@0 Cpq @ -LM̀p`(P@TC@!y4A>B.A 0 0$D4 dD P  40 40 4sto4$ 0-tP@0L 4@ 4@S 40 04T=0@0h0$400 $pD0 00000Sp00000S H*p0 000 H* -p000L00 0S0  Pt t%P@ qL0 0000 0S8 0(0$   H*$ ((0 $ 00 0 @080< -L 00 004 p-LMP%(B$`$@000!B000p04B0 -`Lp00S 0P@Bx 0 0S %A0 0 00(`S@0S0S80, 0-L@LP 0LR0 0CS00 00 0004<08 -鐠p0 刀0b? |`PUL@0S 2A0 P0b?U0S( 0f0@m,4<08 -錀p0 儠0b? x`@TLP U uA0 @0b?TU,0@ 00c0m^,4<08 -PL0`0pS @eA 0 R ]A 0 0CR00S 000$KA00080, p-LM|` x0RR@6A`0`P0 0R00C0*A00`00S c0Sp8040 0-p@LPA`0P0 AD P:00@P*0P008 0-t@tP0LS 0S 0S0800 P0S0080D - 0L00S W8 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S080 -LML@00 S00 S S 00 SS8 -H0LM0@S ,0@$ 0@]000<8D 00xD 0-L@dPpx8@H D0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&HD`XĠ|xX<ppp4  p8ܪ(X(D@H 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S  ' -LM@`M7pH700T0$*ZW 0PU*  pP@E X  @00R00 0R R0@T:ut 0-QPL@ 7 P:00S0S P#0Q  0Q A0S0pS P0PS@0PSP p-L MP0$@KS` $0s 0s 0S 40 1000 p4 P-L 0h4 -"LM0`PG"0S V HB@,K0 Kp0@ PPP{00S@HSP2@0,0 ? P8  8K81X 0 81 11  'P, 0d8K80 X1@0SiP ,P (8K8p 9yPYP ,F `1Z0 00 0 0`F =0`,`0Pg@0SPPt0`0S zD!t0U `00S8K 8p Ũ'14x`80< -LM@0K` P8Kp @PU0P P@0 PUk8@0P``4 0  '4 0  )4 -LP`pWW\`V@ZP PT 00  0 4 0 4 0-LP@+P@ sP0h0 -LM@Pt4Pm p-LM@P `P U P V P ph&p -40L0S  h^x -Lphj -LM@50 0R`0S! 00R0@S000Sp40PS UP@000S00tu -L 0PHX -LM(@0$SP00\l -LM@]P -L MP@4 R `p 1 0pR 00R`P Xp PZ V'y4p6Z`@ x p00h !P  P d  @00P00tu -PLM`p% 0 S" B4@?4@@%PP` 0 Pp#@}%PPP/DL/ @c -LM@ V -LM0`SP #R %RU0US 0 S %R #R1 1P 3``0SPQp@' #R %RU0US 0 S %R #R`0 X0P   d |3@Q0084 -LHMp0@ 0 P  03pq ``K@ 㓨@TPP@T 0 S  g' - L0z3pq0  0  -LMdp'P@00CS00`Ӥ0` V e0H v R00  @p.C3P@`00 -LM@uPp% 0S" `V $3@!3@@PT 0`;.$b@5.]@@ -L,MH1@TMT0K bIT0pTD0DPpP 2 .T0WT0pW`D0-PUp 2@2@`x 0|-T0W0S 20P S200@TKL - -, -1LM0S0 4  1p W EP` |cP 0|S`2@2 =@Pp8@ 80S0%S 0sS 080 @d2p00@]2T:@-TY P)K GP )[40D@00PP0Sx -,1LMP, UBR`Pp; 2@ 20,@2`@Z0 %S0sSZ   , ,1P@00P1U:@-T o鯅 -LtMK@զP@x0: S@@, p-LtMP0SK` 1@x `q᯦0S4`d00S0: S 1*@[ `T  :,p, -LtMK@EPH0K00S\ 0-d0L0ST00pP@u TU 0000@H 0S00>L -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S R,UVP i; R Ry <20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S, 00S 00S#pWZ00S0   ,0S 00p 000 00SYk 0 o~ P\(L @H -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7 H -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0dH@ -LMp`pP@uV iE 0S<00S,00S 0 0S00CXh'I P000P` -P0Q0L00 00 000` - L00 00C0 p-LMP`(!@0  000p P0-L@P@ 0Th*0he*040PP`0PP` -LM@0S00 p-DPLM@`T Pp@Tp` 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+_p@ LP@< P00 P8p0t T 4  P 0`V00S100 P``V0P@` P@@P@Fx00S00 S 0 P@ P p:P@@Tlp -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P b @0Q P 0Px00Sl00 @,@ @0PU`XW,x  pTl p-pLM`Pv ZP2p P P@0P`40`%@0P`p P P0`p@H -L0SH hp0 s 0 0  Bh -LMp`pP@u P |00Sh0 tW V P@(0 f K!X 0 -L M@Kq O p-LM`pP@ux<pP@uPph UT0 phPlX p-LM`P@P  P pyjP@$00S/ ph -L M`P, , SP,0@cT A dxlP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@HLD -hL-` 0S 0 0S<0040   0+0  -p嬀0L`'PPጠ '@T0 '0P0|<  cj+  be+P@`L0 0DS@0 80 40 00 ,0 00 0 t -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 0+$1P a,1UP0!c0@PP 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(̡'t@H p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 lP@P $0 000($@P D<P`X$0 0000  p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Ppl -@LM80 00 B0 @00`0 -T0LM0@SJ@000S P @TZ -0LlP -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000 , -0LM00@0T0p` Pcڴ10U 010`@%P`  TJ1U RZT010Pe0 DPPE0 0U00P -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c PT, P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0PR'0 @@0@0@0TP 0 PX 000P 0 yP  000l p, 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000PT,84tP00S 00<0< 80Q0(000000x0 0 P p-pLM@0`t cPP:p@ p%#@0t T T000CUP800@P@0 V000p -@0LMTpP$P $@0ꌀ0P0PE P@ p U `ZP @0<0Pf/$(0PE0@W0000@-p@T* R  :P0b0D 6@0@@0@0 $d < @-P 0S 00Q  -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0  d -L^ 0 $ -LMH@0S dR 00 000P00hl -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   lh$ -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp+P(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0  -LM P@p` P@t0u00X00S T00XtuP@tTU@0 -L M0-S \GECU,  !h4`P !LPp% 0S" 0S@PP` #@#@@?P 0`,U0SP#+4  '4{Y L W40 , ol@سD 400S Aa0@S<0 -A @L2$0R20p -'PLM! $P .P ^P@0 00 WP|@000C 0`@`000T@P@ 0s0s(p4 -LP 0-LM@ PKT 000004 -L M@K0,sώ0s 00@34 -L M^@K |0^0s 0s\0000 H00 0400 S P 4X -LZP ,0, 0S 4$@-, (02 S@04R 0-PLMP0K K@XP# 0S00R0S$ 00  08@( P-L0 x hu(@c 0-PLM@Y P 0P[0=0C:SGlPhPdP`P\PXP@8Pv040K 0(10 e0`PPP0|PPP= -@LMTd ThL0 !@<840,h}d<l< -LMЁ0P@$0 * TTbA`6 00B S10 0C00B S0hQQ@`#0,SVVE1C B(1`$1 <qK 0S#T`VPK K-!@*!0@1` 0`V@K!0@! `PK!@!P0@`0P KHP  $0S4$'phXu|` -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 etu -l0LM@QT T@ hN$0  h<0 R00 -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RV\\\p$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[VX$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4DDDD W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SH(0 -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSW|hUF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS\\t0010$K0$0 U 0  0  ,HH*dDQ PP -LMA@0 w -LP0 0S00 -LP  0   0P -LM0K0 = -0L0h -`LPp@x`0PSE 0$S T; "P80 0C$S'00@f 2E 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X` -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ R4|\0S R 0 R000000ӑS$0S4|&A0@Sa @0R0-P00 p-LM@P` ᓒX0@0P SP000000STo0Sp@h -LMK -LMpo `j@g@@# 0P`L -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0  -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ r0 Kn00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS 00CS @T U7`KPP0DS hpx{ 0@pD p-LMD`DP0@S 00PCP0  Ppl<D 0-@ L08PS@00 0R+0@00l -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 #0 P@0@@hp`0Z-00hH  ,0 S ,' -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hwp`0Z-00hH  ,0 S ,ؒ' p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0Sp'gfff 0-LM@P0$@K 0 O 0S 0' 0-L M@P0@K 0 }7 0S 0' -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@] T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShLD000@000T(0 h<$p ,D 0-L@Psj 0 0 p-LM`0PS@ t00SX 0@S  @00Sc?(0 0S0 >p<,DpT00C p p000C 000C?0010@-H 0\8001000\0 0100@-<00 CR,0010 BR0 0000@-8 0R (0P@0100 R0 p-L MP` 0@R$K0S ]0 &00$0s 0s 0 01$ Kp0@-P 0S0S0X@0^! 00S 0SN00^0 0AP<00 r0s  P@-p@0\`0 0r0s 00000\0  0P PPB@ -LM\X@TLD@0 840 ,{(0|  p-LM@@`P8 0S BPl   @0  p -0LMK0K00K 0-L M8P0@K 0 . 0S h0' 0-L M8P0@K 0 N 0S R0' 0-LM8P0(@K 0 n 0S <0'ꠢ -LM@u q0r00T00S 800T@qr  -LMB@6P񟗓,,+,,,,,,,+,,,D,,,,,,,,,,,,,,,,,X+t+++++,,,,,++,,,,,,,,,,,t1 p1RDT10SD1@18B01$1@0S, lpq' P0mp@q XQP@@ K0 SPO@@=p q  (0\PTH4x p-LMB@6Pl01h.11111110/111/11101111111111111-..1.11/11//11/11l001110pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?~@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@ut0 u SR?P@09 \p0 s2  0 _0 S*P(Rph=Fp0 s ph| |0S0S S00CS00S S p@,0RP phph-pT4ps 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf(2@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3(2@3(2@3@3@3@3@3@3@3(2@3@3@3(20B0C2S=343434343434343434343434343434343434343434343434343434343434343343434343434343 343433434343434343830 00 0 PE000X -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:gT0 -D0L<080`00 ,0b A0 ,$ (0$0 0b0c0A},$  -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00H*)\00SH00S800SSS00S0S r0000000S0SH*000  $00S00S -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVpL -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CV@HL -LU0S, ,h0S000hV -PlpL† @<0SX EL0S G@0S90P$ -LM@PF0  p-LMP `@ (0K l0 0"T\`PP (0 00 p 0-DPLP @T000  00@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Qt@H@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@L@ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0RV@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\00S0 0 T` -LM@K=0s0s n0 c -Lr 0 0S0 h -LM@P  pP@udP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u X -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@TH -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P 4`TX -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0p@-`^@P  \\ 0S 0\ 0SP@Up^p 000 000 000 -@LMTP oDl< gdah]LLL -81LMXH @@ K}sC@bc:eK0  @`Pp0S0S 0 0?00`0  X 0S L0DS$0   iLD,$h -LM0$ KK 0 0 AP$ - LJ P00l -LML0K Ap@T0[S00KT[ -GMLM7GnK, 7ǟ`F `F@0pxX D D Xd'Ep 20@FSQlQ|W|W|W|W|W|W|W|W|W|W|W|W|W|W|W|W(P|W|W|W|WQ|W|W(P|W|W|W(P|W R|WTRlR|W|W|W|W|W|W|W|W|W|W|WxRRRR|W|WR|WHS|W|WTS|W|W`S|W|WUUU|W|W8VV$6 R6 p6 R0%<0UK1 L腵4S 30(8UK1 Lr4S d <%tT5  n@5k$UK0 LW4S 08:$000S000;ꬤK0 L94P@S A04@ 00@008<4 R$ , KJ @ P@DJ PE,$ 0 Pv /P* P P#0004SP0;000@P Pl3 Rd3 PP`3080@0 P;  PD3    P 3   P2 R0"<P P070$H P P060$T 060$P 070$L 0H70LPT00RK1 L萴4S >0$000QK1 Lz4S (0,0dQK1 Lg4S d0 0QK1L T4S000 !1 bXq$B^KPEPE@dP  3P $0P <`0-S | }''|8\,Dd%` -L4M0 4 00[ ,0 zZP@K0@hP@P 0L0uP 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ $8#8L0 T3 M 00CS0|S0 004P@7-+)@ 000<g 0SC0S #0P _000 2܃L< C444 00 0hBD@0pxꔽd2 R  4@ 0SZ ,K00D cPPJ ?D080 ` 1B< @K0 00!P@$ P 1 xᑼ2q@ R xᇼd|2`1 RH@4@0t0@Y.@P?/@@B@DRPN`,0 @P`VP$@Z -@L MX /&>opn00}X$`pZ p-LM&> @`@[ NP PU$@pp -LM@_d0q,' QPQ 9P@   :z,` bv  V  {W0 0 -LM4@_d0q,' PQ PP    zp00P0S@,0  ,@  ,0P @t  T @  /W0 0Q  ,@sd -GMLM 0`p,0 MK@D@D 0P]%0 )K oO~@0  pW `V@$p,0 S ,|{' -LM堐|WZ>,0 }nP 0  @hP@$Z,0X H0\S ,0 Z,00XP`p,0  +8 - 0 S\R0 -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@&0! o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   Vp -L ESUL -`q00 L 0p0S2 @ڝ PP#Uw 11>p U11>.QQ$ DU<S pUH*d 0-LM P R|@|K  0S@ pX BS@0TD  <-S  0JL p-MLM`@0 0 Pᰣp* AK@@+0 \P! T*AKAA 0r00000S  r\00000S 0S@\:+0 Swvp'H*-Q* rh000000S  r@00000S0S QQ:H* p-PLMU`x x0d X+ 0@0PP0Pr0p p-LM 0@Px 0`0X0S 00 0 0|@P @G p` -0 SL0S S h0 hr  -0LS S h h  -LM0@S S _   h -0L Dbu@(8 -2LM0, S Q 10S 1 0 RA000Z ,  00S SJ10S? t1 R;,00 ^SZ 00S$S0000 0 a@!T@@@@pPN0 0`Y P00QP 0 Q`,  i pa Pp P`lPd0`@'P 0, 00 0!0 0 000P, Tv 0-LPcP ۸@Te 0hU 0-LMdPnP@ 0 SEK P0@  0` -9L Mɟ 000`fS eS gS )))000P@00GS񟗳\hPȜМl,4<P|ԝܝT u6 0 00 R5 5 5R95 ! 0 B 5E ,K0, R( P00R0S p AW\5 \EPD%00@%6 ,KƠ0, R P00R0Sp44u44  44 4 G$4 4=$$000ktt0 0 0( X4]TT 0@4S<4Q4APC3#0000E3 3<3   83 33/3)3 t3$3"3 333$C|P03\ P DP 05(3 L3P0@S@# 2 `2pp5D2P2U0`c .TPV00 S'V00 S`F1p0S "@0003@2 0T$223 0 h10QS0  00BP !X1 m#P 1!<tl!00@T410SPNV00S0  VQP0P p `Fvp ?`FvpWr@D ,<H* X`$X@H(p (40TP8d%LPL\`(( -LM@PpK# p P0Sʄ0 Q T p`p  00 0e D -LM@>" h5@- 0@R:T 0 S* 0R S R  :0 0b0000 00 0  -@L0P00  h T00 0D S0<PP4 0 0PS0h8 4R00C0 R0  -LM@T- -LP p-0LM0Q 0R0SP  {2P` 3S S S 0TkPq3P@L0S  p`@L -PLM`bPP20S|P P `20S7DD"0@S82@@ 00K0` <@ @@ &0K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@tZ00 R00S H!000 810S,10S 10S@q0S 00S0iO fOP0SXL@X00 R00SLX 0S0S0SL 0Y0 R00S <00SD;O T`H$ (X -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 0BEP10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR K0 0R00Rh0 : -00C0L\DH H -@L`P 1T T0p4T0S` 0U  R00000ӑ00Q000 Q0 ZQ0a !00S  R<000ӑ0!0a00QP4|&) -LM@Pxpt ttt00S$S 0,p 0 0`^S0p0C0 3t0 S 3 0S00 B B0 0 S ㄗP0@ zP00C0044   0RI r<200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, P0Q,10S 10S p, R X00b0CS0X40h0j`C 0fQ0ZQ a01 p00S  Rh000ӑ0!0a0 Q4SP H*4|&$ ) -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y:Np50O00O4S  0 0 Sr400000S00S_S   P0S r@400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr300000S>00S_S:   P0S r200000S(0_S% 0S! 0R rT200000S0_S0 Sr200000So00S_Sk  Uv 0b00S10PcUmp]0O00O0SO 4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU,H* -LP  -LoP 録0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0,4|&-\0Q 0\ a p-1LM0`S@PXP10S U t0 CR 0R0 S 0@00+,_KP$10S U 0 CR 0R0 S 0@00AKPU 0 CR 0R0 S 0@0TL@0 00CS0 ph0  0p(((0Xu -LM@PG`p!+pF@K 0PDꈺкккккккккккккккккккккккккккккккккккккккккккغ` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$tplhd%X p-LMK_P @P`J011QhTZ P@Tj_EZpD]P TP`x@c -LKM MCNK@D0@D,0 p|KKKPPPM.KAAiP@4: S  S \H,0 S <,mK`F`F P@ PP  㠓P@h 2 R_2 R BRPO ㉓P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K GKKNN( 0<K @xyP`! &04 1D MNK !0P -0 0mxcJ{p I@㪮P p @TD@0 0Pd :㗮P $$  pT:0P 0 2P T]] (P@T Ph5mK`F`F P8' htpd|`$< -LMp(K#PP3 @T `W@ W Tjo(TRPZ ( D (00(@PZ ( D (00TIp 0-x0L0PS0@Q  をP 0S(0 R00 R0d P-L` 0S7nS 0@ ,ӭP@l0PP@p` ,Pp@0oS` 뀽d p-PLM@ PPp2P .㚭P 00&P @Q T`P. 六P 00P 0Spl -L 0KM#+  -L 0'Ei(Xp -OML M\3PJK@@| ,  X0c(#(ph 90@?S_ppppppppppppppppppppppppppppppppppppppppppppp pppp ,p@pppp\ppx04004 0408 0404 Q.K B B< 040tq 0S BnK`F1`FQHPB 0 4 04 $ 0* ) T XQKAgp* Z5<4 Y584 X5;;44 J>K 0CP4DP P| +D{0$\-PPL 0<1 bh'Ld%\,<t -LM@wP L  q0@0  R\< H*| -LM@P L  q0@0  R\ H* 0-LM0P00CSK @ 0$ ϓ0 R  s00@b -L0Q g( -LM`PmP( @(K,pK 0  (0@S` -L M0@p00 0Si FPP 0S nSZ =ɫP0`0@Q QP QLQJ  0V0P 1 0* Y0  0000V 0`0-C00 ,K, ?R0S@p @C0"Sl 0Y000 LPH00D 0oSP hPhp -L$M<@K`PPD  P40KsPsC圃 -0,0K * K#&pr ?0L:Sl8P(0000S  @@Kp| @ ?@O庍2000,K +K.0Se D 00|!0`VQF `Fv  7P9Pp   0z`Fv P@ p寪P 媪P 奪P WP@D0S  Dp\0l 0 aF#40K`zX xD T |d%xX@\ \,X -LM0@S\ [PH VP8PKP xX@ -ML M0ß0`@( ,0 @33P`d088 B~KpGpGP"04 0X 048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0D08@Tn l7p@` P- U947X@ 1 ,0S ,eKAA DP<8#4P ,  \PIE0:pP%|1 R\!0S0  D=0S0C00 =:D>=:0 R s=P` 0  @@\PD0lP\ 0 \ @ @X| -LMA$QB\|@xx0  Q d\0S P 0R 0000$@]`\h -86L M P(R@`,P 0 4P {0gS 5@DT%U0-S 50 , K P5 RP ttt%<00@DT\5\%0Q4  S4  040 5 s 54 PppRp@3900 /PP )903S %90S4 R0S ,Q  0S ,0@ \0gS 9,4` R484P4$ ,00S<0SU V  V=C<U7V  7<U00T00S 3 R3%<0@S 3 R 0kX<T[9 b0 0, K4 [0@,SA|  ,@Tdp`,40 0<2 z|@T , KO4 0 @T  B@T p!00000@T  @T 000 0 w@T {$1 1w @T  w{@T >eyyph0$ @T {|M\T|0 (\ t X8         p-@@LMTP` 0-S*@P!t|P`@DTD0ph^`,0 ``-P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S 0< 0-LM@0 S  0S 0S0S0SP 00 S 0 S |[00 K 0 (0 $0 0 PDPU <ᲟP , 000H' i0 -L$MğP`P4 t4E @ Qdlt|s3 @ `PU U ß 000U000DS񟗿XXXXXXXXXXXXXX0HXXXXXHKLK 0D@ H @ < 8 4 0 , FkP7L R/0S ,Lс R R H0S U 00S S0S 1#$0$0 0 00S  0H kP X00U @ UP DP X0 PH1Z@ 0\ P P 0 ( "# v P P0 R   $00?Yl dp`p\pXp@PpH0t8 4X,< 4D -LMP@00S p SpBT  0ϒ005Q^` ^ T0 U   V 5PW 0\Y  5X +5A5! d, R 52H5$0, L 5$0( L p50Q#$0\ L 5L1 R 0 05,! 00CS00  ä0 oAo<$000`00i5 Rt Rq0Sn0Sj R, gN doG XDJ4PH\p((LX4 p-LMHPH`@D/5$ q0)5  k L@ph((ht Q-L`pX0L0CS00  ä0(m8  A 4!A00CS00  ä0/ P@ WT% T# 0B00RPP@ P@ W T T <T4 0B00RPP@pp ((X< Q-Lp@P`8 \5 0LW3D 0V C,<R 3000` \ 0 CR 000 \\PV 0> CR 000Rh@0 R \70R \ .0 S0 S 0-,@LP0S P@0D 0-LBMP0\0 @ \ xo 0S dsU0" L/4\F/K <* T '(( -0`PL@ p* 00B S0B a0BSWBA0BS7BR@P ((` `Q:0e0b``` -L@LM "00P 0;020 -L M0 K@M 0R -LP,MDKHK`@  0D @ ,@ -P0 Pk& ANK @D@D'P X0 \pPX& 80 V 0S( F'Mx!Q!!! -PLMd   KK^+P 0@S 8080 >(0 0D!M!Q -PL M0 , ,K0K0!9+P 00  11 00 1 0 圽4 1$ R0  0S 00B,0S Z0S0@0S 0P0.,P0P000 8+P0`@4h@$4MQh=F=L!L$,! -PLM   KK*P 0| SKK*P 0\S T0T0 D0 00S$0 !!!M"Q " -P0LM0P01@0P1 ۉp 0\``щP ",P0 PÉP 00|S ,P +Pp0  X0,0姷PU hxM("P"X"`"Qh"J -PL$M0 , ,K0K!>*P ,0S ,K0K!5*P00 1, 001 4  4@ jP 400|S 4K+P 4\C+PP1 00@ <1 41 }< $1p0S. ,00CW*Ww0a050K00`!50K4G0pS0@0S 0P000 +P0P00h00S ,00CW<C4@0 P,0 a$8"Mxh"Qh=F=LX"L$, -ML Mq0$0 `P5P@P@@T |PP 0S`Q/ &P@Lq@BnK-0 K@`F4!0⩈ 很P+0 K0 10S A^~ 寶X00 ! !*$0  YDBK@dP㽻㺻`Pt00P$@ $0S<$D'@سtBMF`Q"" -L`Mq Px t `tKxKh!)t0x 0CSP1 H}D1C<SP.t0S$x0t00t0 x0CPt0S@}pPK5 PmP   P`x0 Pt00t0 x0 `"P \0|} Vt0Sx0T  P0 0S< D'"M"Q""##'#$#F 0-L@0LDP0P 0000}S$0}P0h-4#Q8#Md# 0-LMMlPANK@D0@D0 $P DD @0g}Q# 0S$0 C0'l##MQ# -PLM   KK](P 0S |0|0 =}l0 0PH00}S <0<0S 02}0$##M#Qh-## -PLM   KK$(P 0S |0|0 }l0 0^PH00}S <0<0S 0|0$M##M#Qh-$,$ -PLMX   KK 'P<800 |(0  '4$L$MQT -PLMX   KK 'P<800 |(0  d$L$MQ$ -LMM(BNK@D0@DP+(0 ӆU)0`P00V00S B.KQ B B 0BNKp0@D@DQ+a 糆`P00V00SBKA0A@)0KPP (0S(B'`$ -PLM   KKR'P 0d SKKI'P 0DS <0<0 )|,0 0d$M$Q 0-0@0P 0 0RLnP0h-$$ 0-0@0P 0 0RL[P0h-$$ 0-0@0P 0 0RLHP0h-$% -LM4@0S 0SAF 0-T@L0LPSH %Pɰ40,0P 00FZ%LXX- P- L<80 {,0  h%MQ(%# -L-800S7 (0( 0S00/㱸LFRX, -PL M0 , ,K0K!&P00 1g{=00 #p4 tAte{平d14  40SDAL 4  0S$A0Q{女hP˸`4  0S 0PU @8{匳㵸0 PP@ d ,040@ L0 P0R  㑸4%MH%Q`%t%X,bF=R -0L 6 0%QQ -0L * 0%QQ -`VLt Pl@lph000z000H000V ,00h%FQMQ&@-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00&`Q 0-PLM  1A00sz P KKv%P 0S 0 0Wz 0 00 P0 ㆄ0@0S 0 S  @z@00D0HD 0 S , ,0ML%%%QFLMxB p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(xppM`xBH*M% -$0L \00'0h-(,&Q -0L  0(&&Q -0L  08&FQ -TL P D00}S8080S00x( P 0  H&Qh-P&M|&L 0-0LMS0 lKnP@tPu @0 \ ,0x0x000&&&Md ' -L MTr0$ S( D P8"$K(Kw#P $0S (0 2Xx 2 10S1Vx(0a ㊂0S1 0 1Dx1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0`@t0 S@  1 0U UP 00PUP00CS00@Ӥ0@@ T tt 00CS01 P0 R0@0wX-'@'L'MQ$,d'&t-'t='' 0-PLM   KK"P 0S t0t0 wd0 00$pP@0<u   Pw0@0tM'Q( -PLM   KKʞ"P 0Sp0p0 ~w 0$0sK0  DJ( 0   kw 0 tM'(Q 0R ( ( -LM00 @P  0 0hHwJ((M -PLM0 ,  !,K0KL"P ,0S00 0-w0 8 #P0 <P  0S 4K↺p `0 p吀@ 00 h04dP_n400080St'MQ\(`(dpBh- -MML M<ğ P,   % OKAOKA$@!P4  S0X C4 eP@ 0X30X 4 3v3 NKI I tt#1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 fᢀ4@iQ4 Z% P 4("  f᐀4 `000SP0S0q0#00p`18v1`CP 0S 10SX1'vP1 1h10S ,A0v O0@0P,0 B xQ  |A "  UkBΟP  PB $B (B   |dPp d ~dP@p H udPPp"(U`/P` 0ST PV 0ST  "Rt! t t1S t10ST ^ QB0T00V jx x1STE x$ /dPx1p x 'dP$x1pW 0S /FiP 0S00@`P`( 0S% 00:UP$  0S *ㆿ$ *0$":>0p@S *000@SpbU ̵| |1s  |}Kp<o/K<00t:P;01  t+宵 1S0 1 P|T <P@< 0! pǏ" 1P E;b  !ep` P 10`S1 l;0S, `;0S(`+0S!0S:L;# 0C\0\00u:0 pÏR0S*:Ϭ|*8P :0S3 |:0S/|ʟP*0S'P:0/P0S*@:#0 CR 0R004: 00CS00ä0)9召AT .O"90S9 ,t㭱 B )0[S ]P 0:SSPp :P0@080S 9th 0`s^K  ?<8T0~Kl1 0h1 $8  0oJp80X L@K 'P0 0^JP  LQ0U|1 G SOK <P`,}70S7 @s`| |1s(ǟ $ | "Ps0S o|1@ h0@|1  L@K0@̼PPU`|1Sp|hNF( 0S6P"msxQU% 0S6,"cs$P ƟQ$BƟ&0(@0JRşUş%0(#=0%(:x}P hP@2 %m}PP(d%0ڽ(%0X ,z}P0 %(4\ 0ğ%(850S05 F(^  ^p /K(P  !R 00S S S B B0! 0!R0 0S S S 30Sx4,"r }P` NK` 3}K0 h2SPKPP P 3R P R R xũpV3(/K]P  !R[ 00S S S  B0! 0!R0M 0S S S 1SF `20S3"yr baP"N0`0K  (h2S2 j2S P HaPh2B0 `SX2$ Or(RU R|1s|x "  Tt$|P101  t  ! 1St-01 HP 1S) 㨯%H㤯L1P@H1 0! pǏ0 廼 P0 1 M3'@,,,x",,-@-l---x(((Rԍ-tB-|=XuL-.`..,.T)*L*h***\j****` **+,+8+L+\+pBFL+FF+h-M++,(,4,'P,":(H  b0@PP  \p` P PU00S, 00S( 0S!0S:0# 0C\0\00o,1$0 pÏR0S*D1ɩ1S|10S3 10S/P*0S'10/P0S*1#0 CR 0R0032 00CS00ä0(02厩1SX-Ndp0s 1S"0S 0R 20S 2q20S2q㑮P R ! t(\ |1s|8嚻x嘻喻P#,0 S`,F7 -LM$@F"p.M8.(R -LM$@4"pMP.(R -ML M60H ,0 0L P$ D4 ͭP@ 60SD4& #x尾PX  0SX T妾P\  0 S \$ D4H`D SpD4L$:zPi D4LT f P `   S_P   M_P5\P$   A_P @gX$R P$ p/+@/z:P{z@pwzPW3 W1*P0#03U0S* TD @@dz`@ _zPVV*4= T4S 0S Y 0SD4L$ttT.T +T :;z/`7zVP P`3V U  R0305`1:` :"zPT 0S U ppU 0S /nPpP30S t3tT$ 0PP o30S@3 0V@4 10S 1U! 0KoV BNK@D@D0!}x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 O1!0?2cS D40`4 ȹD4`$0RD4 D4HSD0`$0Sr5` ,0 S,f5'KF0Th.t..,x"` ,T.tBM.@T,.p-/Lh-T/hT,$,QQ$/ P-L`7 YHP@! 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00g0/H*p000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@H* -LMl @H]0SX  A]0S<  :]0S$ A0P 0,,x"X/ -LMP0  冗 -PL 0   -P- L0  |0 -$LYM0@,0 4p@` [KL Hp4Kl  0h d `A xDpP4"0L@KFxP AxP $LK 07xP#LK P0|L0[S LK 0RDPU u  ᥬ 3 p1Q,,d\wpAP#P3T N p10S S_K <߶P,w2 m@P`آ* PPT0S U 0S S_K <崶P`,wTS8P4<P`@TV C1 p uZcQ o0pt1 @jZ]/KpA P*J0S x ^?K PxA00p0dQS PP> H10S 08 0mgPPP | _?K,ҹP00Sp0\0 ;0 ,0S,O3'LLU@ *\/Xud/l/LQd =M.-/`(S/HTJZ/h-/tBp/ -LMd@, 0 0CS00ä0 ((0 0 S թM\`DS --p1pq0LS00`& TATlH M[P8 4 E[Pl H{00CS00  ä0 cʤP@T0  ! @({^l岤0 |vP0PST̩tB\M///0 0Z0Q*&% 0-x0L0p@SlPl h0 `0 l P0 Wt00S0 0 00tBZ<0Mxp - 00LS g0lt p-LM@P `Pk00S x0 pk=d 0 00LP@0T)0@T 0 pZxtBMH0p 0-TPL0L@S 0S g0 0cS0h~g0lt -LAM M8B>K0C0C0 +, ߺ %@$  p< 8 4 BK J4`J U0@S񟗾<<DP 0tDPp 0Pek£u04S1440S (D(\k尣$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 #kX30 CR 0R0 S 0P0Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A$ PP210SS5V4Vڐ10StA0 CR 0R0 S 0P04$RB>K 0C c R+#$t8Q 00 S Y44044 1V 0  < 0 YRE 00S <$`0RR0F<,0 S x,0< 0 '$(QZT0h-M\0`-R=H*#,HTV&\0 -LM00 (@(0 7j勢[\M=0LT -JML M@͟@<͟KK`4͟VSp(=(͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$iTU< i<@T $q < <Rxp

K0C 0C)00P ʦǦ4S ¦4 S9T 9Pz OPpI 0SG |sP wsP=T9`0S 0CS00[` 4P90㉸pq `v  4S8P@80<HKP 4TSt8P- 84 $R 5P& \Y4DS8@4$P KH4TS7P @4S 4  4S  ,p7 0S m0CSjg ppT7/4 APp``@VP70S> 60S 60S6&4S.ʸ4S 4S'46# 0C\0\00KK.K6 B BƟ0O4Sʸ4S 4S5圠BNK4@D@D+,P`60S7 50S 50S/pşP*0S'<50/P0S*45#0 CR 0R004 00CS00ä04UV W 0 S 4" VOl4#0 CR 0R00,4.K.K3 B B0Oh40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00@3P@ 0 CR 0R0 S 0`0w2P@ p`$30S2 20S 20S*|"4Sʸ4S4 S4T2#0 CR 0R00B2 00CS00ä071坟40@$ 40@  0 S 1 N4$Sx1 4&t#㥤㢤4S2  㜤.㘤㕤4DS0@ 10S$1 "@PA004SC4 S0  4S4T 0S0S ,0 S,8-Lh-'F0FFFM00L\-0,JLT&X0x'`T%1Qdx1QpB$1,1 -LM00 (@(0 fţ\M=81U -LM$ϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` pPH H0S > 0RS ,0S X,00-S h>, `MfQL>P FfD>0S H0S , .0 80 R@0  D0 H0 S  L PP! =0S {=0S$NPh00@0S@<0S<8= p 8=p.X㑣P0@0 匣< X,,UpPS ,00|SO ,P@/, @0S 0 S , @h<e = T00,0T  T,| [T/0p0W\<0S 0 S,eP(<0S 0 S <0S ,x , ,0S HQ;0S 4 ; ;R,pL;"PX 嬢PH0S h 0S T P0S  4 ( P@ 4 40S pW%,oP:00 x:p) ,00|S ݢD ,'0 00S,  *0S:p: ,W0 00SP:,  R80 00KP0S;0 Z0 SI̯启P0`0 `20: S ()0S00$9 %T9@T 0DS< 0S 000tQpp\#Pp90  p@0 S pWPdUOLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00|7XK |ǟ0OT0ST0S X0ST74077 )P`ʐ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00Hh6 00CS00ä0=<6壜V0 S) 6 W W,hT$V 0S 0 WPPU 0p P@0S@0 WP, 80pS45p85 080> VP00P0  V[5#0 CR 0R004F4XK 0O50S p40S t40S \$T0ST0SX0 SX0(ğ@04 ( P`L0S 000@20 0 CR 0R00V v V 00 CR 0R0 S 0`0@3P@ 4p`~P0S CP ycch30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00CT2 00CS00ä08(2垛400@ 0 St" 1 000@ , N80 S1p 1p080@㧠<㤠D0SD 4f@ RH0S R0S10S 8 d1Rp ^00 0,K0 /p{Kj05 0$, bD0S`0d0D ]Zl00S70 @ P<MLFp1FF&Fh-M00LQU&\0x@c$F\-0,d1Q`((JT%d h pB|11111XQFP4 0@P@@80S 00S08040S4l 0S0Sh@< -LM0 S 01 `0, 1 a 0 S00SS m 0S( p͟|` XP L "B00$= =0 >K P 0S S5 Q<0S) |0S%̟L0P 0 j< <P?B1cSQ < ! b1SA l< 0R0P<X a\H 1  B< \kP,:(:?B1cSQ< `Va  V@ 'jKiKKgK qK mKo/K=KnOK@/ PW1S_1S\1SY 8 |!1 (,10$10 <4<  4 KP"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpP0DS00p\ PaV00 0Sd >KͬP@0S S >K  廬P >K ) 宬PPC P430 >K 嗬PxXC0r/K1 P@SePQ ZOK3(K0S S 220S3 20S/L3(KKoK\0P1 \ S_K <@@PP 0P R d2 0S82  @2Hp_ QA Q^ ^ 8 0@\@)0@0 0  (         $ ( , 04<8@@D  ! 1S0s`0a 0 \^(1  0S >K  ׫P X@G0P00  ,0 S,T%(S' 2(,hUXFL2d-Ld2h-QgfffMl2tB222t=22$( 3 3l3H3333}~3LUF 4(4L4np4x444/4 -0L,MP؀0p0U$0 D @KD K `唯@T00?[\H0K @H \P<oX $0S $$(,'(SX4/4 -LM?4 0S@0SZ2@F -L 000\ -|@0Lp0՛T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,ohBΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 $h h h h0+11b0 hb+ h +h+g D0S00 \Ll F=LU(SHTZ0,\-&&FFQQ&LMxB -LM`@00CS00  ä0 |, 0$0000媚MDTDS\= -DL$M0D ,0 H 00 @ gP4@ 3#3Q040 3@T 30S 30S@@S0SP 3I]t30S \3d>]T3 0S44P(HPP7㪚c0@H ,0 wP@ ,㝚㞩00000 4D cP`B000QM,82`D H0P\r4"0@0K 0C0$  0 K(4 0BK @@ Pʰz00S0  ]U 0K0 +PP@00S 0S8 !Z'5DTQT05HT'5 -BML M7|'|70 t't7t L , ed'P  0 SD70@7+ 87PP07@P(7(wP$7$gP 7 @7@@PP7 7@6@9P@ 0S rePP keP dePP ^ePPP6TeP@6  h d&P 0SL60V0S 060@T$@PP@ 0S .eP )eP $ePPE5P\5  5X P UP y40NBS񟗩`htt$08`  T4_#00#0\84Q440 0 0 Q33 I|3CKL1 OH3\  +6 <3033 dP#h3% '2 2\3 2LCKL1 OH03\  +3  l2 0"LpI2202 2l0 2L L 塹P oZP BNK@D@D+dX2@% HX04SBL4aP 10L P4ܖP@ < 9L@1 0@$ D4 < 8 4D 0CKhAA A0QS R  1l1 Y0S 1 ,娖P@@T  @' *Qd/|=6l-\/Lp-$,T,(,&t=h-&FQL6d-()(\6@66LT58 6(606'LMFFtBl46x(`-P6,,h6d%LQF&XK0TF6X- -L \K p-LMP0` 0S @0S 00@PW00000S T@0S 00$0 $ 00`pFZXR6 p-PLM 200CS00  ä0 10S AX&AQ HP CP^ @0 SP00U1P`1tX0X!0CS00Ӥ0 PB p?0a0S Q00Np@ P 0S 00S0X0  00S 0S d00 CR 0R00U \0R TL phML='6FQH%`%FF|F0TPp@-& @`QP 0R0S  0R 0S 0`S`PQ^ppp p-d d0LM\` X0X PPP0@T000p=xFQ&FFZp@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000pxF&ZF -PLMp(c1@ 1QQ! aeW0p2V*Q 0S 0S ^0`2V::ioP@U@p`0` l P \<6W0< .WPEULM7P7L7h77 -,0ML  0W1@(7 -LM 〡@TP 0000wPO8 0-0 L0C@R P忡P7 0 Q0008 P0-L@ 0S Q 0PU*0z0PU:t0hq0 -L MS( 0$ S 33 P$K(K"ս$ 0BS (0 2V2 B0S22R(00S(0 2P 0SpmP 0S (0PP@20S 202 mV@ @`2 @`2 @`1 @`1 `1P0S1@1P(0 z1d0S0`0PV  m`P@pl f`P@ 0T.S@DpP0@4!VTp,, DP 10S11  V  `0 V R00 V   DP0U `FM9=<9Q&l-QLX99h-994,x=9&Fps=LeQFRT,\-0,tB'V9V9LQ&X9: -L`M"0pVQ@,0 #20S *^K"_oK,dP@tPpB@B0T"cX`@B @BT'LP@\nP@T 2 0U1 zU|PK!P]EP  _P00|0[S@T P@Vn`P@ Wdbp\@T 0W0Z00S (P _X00S&0P  o_0 0=` 0@P0 Ps_P@P 0T0 ,0Sp,q'F!X:d: *Mh:x:'""#(%#:L:=QFX-F&$?: -`LMpPh0@T0T0 T 00@dP DP M@T0P S00@@0 800P00=:M:'FQ -AML83M4ß@0T,0 p0 3 0S 3@ SP @0S 0S 00@T@0S唢P@ 0SB00SP/S  0 S R?TDiBnK`F`F+^00S/S/00P+e^aP2P꒴1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@DE00d0SX000S |P CP@@ ^P0@0x0 ,0Sh,@='p-|&4c1 P@@PR50S1:PYP@ TK O0 @KI 5} 1@o0ef2f2c BDٞP ֞0Ϡ#PE0l 2lADd`0 @]@KĞ0 S00<@,0 Sh,.A>P?h-'&FT(F3L>Fdų|>M> -LM0`V *0獞0`YV@: H1 PUP@`VA0S,0 :p0AT0N 0S :000CS00  ä0#  T P@| 0 @0 C\0\00 T,0p0S,0 `VRM -L MuD00 K4@Hp( P0 1[SP00d@Mht@R -0L M@K 0 K  膛 -T4L>>>>س9 ???,?L? \?` -000 (P$0L0:MXZ@T(x? p-GML`1 M Xa T!P0@4 8!p ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 hP# $04 04 =K 0C^PPx Pl M0$Ls-P@ 4+'d% P?,l@,< -L0+ ㎂@( -LM`PaBP( @(K,pK 0  (0@ST -L M0@p00 0Si PP 0S nSZ =VP0`0@Q E;P QLQJ  0V0P 1 0* Y0  0000V 0`0!00 ,K?, ?R0S@p @0"Sl 0̦Y000 LPH00D 0oSP 嵦hPhp Q-0N. S$L!L!`!L!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!`!L!PP 0B00RQ  Q 0B00R -MLMⴂ0$0 G`2^KPE+8p@0S T0T0S0 0CS񟗆"#$<$(2 05R|@{PvPd 0K @88 姙`^KPE() PZq0@T ( P@TTC00S3 >K0C( P$0 05R++P&00S" 0V0 05R01Sd0 05R X H00QDf  : $0S($~',iDii JJJ -4L M@P  B B'P#h%x%%%%%%%%%%%%%%%%%%p4 l4 h4 T4 X4L4 ?<$pc@$40@cTQ2T̋dP bċ#P 㼋sP  TP0S00# p Y3  |C@PtmF ԙ`3 0000C<0PRP8 @  rJ 30SsJT Â꡿徂0"0Z ڨ_JTL2+n0ST. XKJT H2p@4K 8ķPP(y$彷PP> 0K_p9 ,0'0o,1" pPa@' ;1P U !0QL   l1pd \ÖpT PpH  ᐙp0 p  ᖍp #L0⚙@0 00J@xi(,Jd%i4Ji@J4iPJ`JxJJJ |itii(J JJ$JJJxlKi0KJLK`KJ,hKKK@cKKKm` -,0LM$@ II@(KK p-LMP 0S 000` ph `@<,0OP0080 04 ,0 $00800<`phi0tii -t@LM0 \D0,000 0000 04 $0 0080hHi0tii -Lq0P@T Ut` ,`\ 0SP0 UV@ 0U0A 00h1S`P 0 = 000 00}=00  00'<0 0 00h|00 00 04 L0 D0080 D0,0h"T,id9KLti0i Mp-L$MDbti8L 0-HALM0< 0, 050P P  !1P00,0Q 0S9050PQ/0P0 0000E00 0 0 L0 0D c4 000h i@LHLPLXL`LhLJ$2tipL 0-PL0 D0,000AT 00忕0@<0 04000 (0080 000hi0tii M-L$M̂r  8K$ 嚕`,D"2PPP\0S4K8= \X0;0S 80;01 S+l 0S0@T 0S PΖP_ @T(8K`vP@Y1|qS000000|<0,0hgP1 T1P 40PP^`  ᚖP0000@00S 000SP00 0S@  0S 0S@0 0bS`V ʷ pKdmXDT $0SD$7 'iLLLi LLLtiLLT,d9L M-LM B  @K, єp#PPi!4@!0 S0 P`E X@la0 P0委1S 100l0S AP@$# @ l⑔$ 0@0$ P@$$$@1S 1000S ːP@( 3p-H0 a( 00,0 S(, '4Li$MLMdMMM Mp-LM`@  0K =P, D0R!0SS S S,K0lr0d0Sl  00< 00 0SV p'iMM>M -d2LM\bXT24 0bXPm0S$20S B <0S0P<0<0S0!P0 <00<$0<dPUA# P`80S|1 10 q0 8ᙑ800Hq80P Ta80 SڢO_0 爑@@8@80S0 1080@0 0804 0 S0l080X8#8#$0$ ࣸ$0P$#~0  488<#8`X0H G080<miiti MN|iiNid9 p-LM$B0 P@0S 0SCAa0 0S4 0 00,0Z0QUP0  S000 0`bh0P0d008^9? Q0 00 0 0S 0S0 R0 0 00 00 00 R UPR\@0|0QTl 00T0T 0H00phiHNti`N|NhLJN$2NN Ji+ -LMHHc0 (0 NN`LJ`KiO O 0-PPL0#DHLƑ40$H 0 0 0h|ii0Oi -LM~KMapGP@+!@KҒ威-@̒ !0Kx6 K0C0C@^d F l6 zό< NK0 ,6 p@ 00K?0S \ 066KSK?6 0@00 0A00 0B00C ,0D0000L0P0T0X \?piiOi p-LMP$P(P㾌@`40S8`V@Zph鲌 p-LMP0S  `Sz 40 @T @T0P@z0 ^0phlOi -QLM`PDB0S00`00@r0S  A00A1  A 0 A( RA$ RA, R A`@4 Q 0 8h!0!\A`V@D 0 @ v> 0iA . 0 v>  0TA 0 v>  0\?APEAhyZOOOiPP,P@PXPAhP|PPPP p- LM0Qq`P$0  $ 0 0 囐$0000 f K@ {$K w$ Rrᆐ(K0 (0 j( f 0{pi -Pd 0L&@`6pSW06S 60 6h 060S 0P&00D0D  V $,$ hiP QTi̳II -MLM P, |p < 0BS8@<K⹎<0@pK@0 @G 00T`K0T0 S" DY 1 S@KHK0hPK0h0 S X> ( R h{$ R XvT` Pg D@ QN 40S0@L 18SG PP4PP8@4@1 0@冡940!1ZsNK@D0 @DD1804 04 1`1Z\H1X!WsNK@D @D8+ 1 40!"0 04 R8@Z ZK'P  0^ 7`0V P7 {NK@D @D0h N  T,0 S@,0'DQPQ`QttQAiQQQXuQQ -LM( 0R@40 ,0 00  ., $P )0 X $4 , K 04 (pK0!=0 ( $0  `40`V0 Zc;0  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0i4i -LM$;0 @ 0$0 @ tp$`KP 0 0 $0 $4Q< 0( S8 (K(iiQQ -LM:0p 00@00f$@ p 尵PP(p  (K-P00P@@TP D(@ $K ǚ$([ii$i RR$R -L M]q`0P60S 0 6 -P@0610=S 0`61SQ0&P d0AV2pႉP@0U0(F0F0F0v0 61 p 0V@ 0@@@061S @0@$S `S0Td : @ 0@0@6@ 0 Li cqP 0SpB 0H0 T  P00 S$0 S $'ii X6i(X p-!LM@`TP 0S0P0 @TT P0@00 ~P@y Pt` R 0S @p@p0S  0S0S0@0piYT Q0S 0R00Q$ 00 Qi -L0Mp0` 0 ЪpP- H@K( ^ V> pp0SlQ N0  ,00 S0 0 S X'X6i(X4Y -L8Mp0P 0 T`K0 2B tP@P0`S PPP0D spP 4 0 S  #'LYXYilB pYY 0-LMdP0  ( ,  Up@8  0Knp 00@0iYY p-LMQ0@ 0 (0( K-pP1[S1[Sh0 @K(X pP8QH~0@( pP0v0(($ K pPn $080@8}4 40S8a 0@<@0 @@0D0D0,`K, ( ( oPL0< 0, Q0( <00( oPt:0l( oP\2piqB@YZpB4ZyB`ZfB@ZZ\gBZ0?wB[vB 0[ -LQM0Pps`KKWK, KK\q  @@0@Ɯ WKD\1@< 81 4 0ƞs`OK VK0 0 ,v 0 T1 0XQ P L1 0VK ᰸p@0  0 ,0S,%'ii@[P[ -LMp`A< @0R 8 (4'P`i 0<0 00@0 Q@<0lS<W44K  㰀"[<0,@0 R!(0P0<0 <43P<0 0<0,0 `, <408P<0, 000<0%<00<0,0` P,  <0000<0h@-@━0< 4@, f, <0000<0,V ii -L M0\S, `Q*\ 0H , Ypӕp0, 00 0S 1 \ZQ0S40 sP@0   4  prP@p0|    0 00 |@0 0, \S:A[[[[ -L M, pY0  `, 匁00S" P0 0a00 SU0`  U@@`@, `0  4 PU`4\ V00Ƿ0` 0\ -L4Mlǟp, XP T Xp @gY@8Z,\    \ !00 S T0S 0 X 0LKX 0 0A0C3Sgꘌ`hhhhhhPhhPhhhhhhXhhhhhhhhhhhhh`hh`hhhhhPhhhhhhX0X 0 BT0 X 02 QP0 0R r50000S  Q QT  x0: p 0\ T 0T0 t0 0 K0K p pp0  &!0 0Sx W4  0T|00 W00S4 g TP |T TQڗ Q@4 aLT R ZT Xp WL K0B0C6SDlDtXPPP"00 0PET3* Rr200000SP 0RQ 0">P``0'S"S $S `S \SPE\000PE0P@ 0T:Q"00PE00P 8 #" 5~ Z:P` z0!G>pPRP`@/08C808#8d!2>pPP`@:0pP/ 0!S :P$P`WP`U`X0\ :\RX 00ƴPERpT0S\ PE ƴUT0Z 0hd,0 ST,'$\H\AH*t\\\\ Xu(qVV\S`] M-M LM‒@K  , }d2`@@QLD2 R\P~~KpGpG+~K ~PM.+P` 6S 6S 0  `V 60 l@ `6lSP 0SXQX SLQL SDQDV 0S Q,,1 (1@TU @K0P <K@ P{@TUU 00@K@>K0C 0C1 BS 1Sy@T ,0SH,V'i(]i\T .\[2LT8d[Li0p[[P0-H0@0 80840400,0 iD[iH[ZiZii -0 0CS00LӤ0c ^00# P 0 000t0 00p PPQ8 00C 0000X[ZiH[iZD[ p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00pH[D[H*iiZ\[ 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000T[iP[L[iii\[ -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000T[iiL[P[ii\[ -LM@p P p-LM@`Ppp UP\PP "P H0D0@T80T0s@D0   0pP]`[h]\[ -pL`P@xP000PP px0000D0SX0 L0@T<0T49@D0  0`[H*X[]\[ -pLPBo@P -P_P p0 00000S0 pt0 000D\0Q`T0@TH0T@@D0  , 0h `[H*X[ ]\[ -LM$@" 0jP@ --LM @0| (xp #0S \[|T ㊣H ㆣ<#0S ,,,$ e@ 0C<0 2/P@\H+P@`@@T_0@@0 /P@5 P@.TM0D0 P@#TB0H0 :P@P@T00L0 :P@pP@ T;TT`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @ooloop,pLpdpppp4T 0-LPgP@4 q0S0Fq P0p p-RLMP@` 0S(0 t000pq p-LM`@ 0 c#PPhx u 0 0bU *Ho,0#S (0S uc qphpq4qPq -Lp`P P@TPVtTF;t 0S 0#S h9`q|qq -MLM$0KA ,0 `hQR Q Q d8 SKAA ld8 S:qX lPP fPP0 l(KA Al K+B 0d(0Rp8:spP@ fP@ p(~tprp>K0C0C`#8 ud8! SD5;<#fKA A`t(d8!M@S:rtP fP t( GKA Bxd(0@R:q|xP fPT x( )KA A#|(d8@S:rv|Pp ffPpk |( PゎKd8H@ HS( ];KA A01(81(Rd8@ST:rG:f0P1(> (PUڈ< 8 m o ooP(1S>K0CoPU!d8PS 0 ( hX d8 XP@t KA hKA A bx40 ,0S ,N'qY4pqq 1 P-L`( 1ȁ 0@Qd 01 00PVq` Qxh!0 PTP ,@ 0O  Q0 Q@L00noP 0@0CS0@0 0{, 00CS0p@0 0e,< 0Riiiiq0<|fr -LMPnPpC 0@ S 0 S`ev 0S쀟쐟0 ZPP *,i n`0$0O` Pr@00,(, C ,riii+ } 0 kDkdrxri|r 0-l@L0S0X XP@000-X0S40(0+W 0iiir -,0LM@P'Xii -LMHH P@000 00@@T'Hkiip@-@@`@Q 0PA0UPEpi\ X X0-0PPL0000000000@n@T0j`\j 0-T@TP0 SL@R00 00000 `\j 0-`@ 0PSLLH  0S0, Pç000w 00`j\ 0-lP@0 SLXT  0DS \P00U 00`j\ p-L M|P0x0 ]@0$`KS 0S @p q0 0 $0 'rr P-L heH"0@6PZX`hx 0@ 0@QQQQQQ Q Q  Q  Q  Q Q QQ -LM `0RP  0XSxS00@PGK GKk0p1h@  T00R00ST01@T@FK!1 020@T0 90R0BSbS0@PGK GK40p1@  T00R00S?T01@?T@0! P @Trkr -x0LM0Sd@ 0 R<0<0^ڽP hkQr Q-L@Pp`  ao@@0 0#0@T` 0P@ 0hVtd@0 0#0@T` 0P@ n jjs -LMp 0( PP`30K n 0XP$@0 0#0@T@ np@ H(0 S \(`VDT8PP,K'j sssP3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  m\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  FD<k p-L M@&dP0@D`P K`CP 2[![SC$0BR0 `p<ht@TX -`0LM @R 0D!S 0S/$^YP4Hv -L P> P4 000 S/ S- @PP pP `0S oQP@` @@ (~P|0p p0q\Q@TV,@P0$ pP BKaP `1: S``(p P@V h2d2sM\/0a  t r00T0S ,幣T00SFT>Y6 1 R,0  !0S ^^P 嘣KvaP  0R|1 !P H8倣 P]]  !n80^@Mp q\]]2\2Klƣ0S4  Tl,X !LAGP8]ll mm(xx( '` mmm -LMMpA^K PE0PE` @ 0 Jp 0T0 凣Pxph SP\0P 0 S @ x@('x( x mxx -QLM@l Y0S\TH0S@4 40 0Rh.Ȣ0( xx m -QLM@p 20S`X H?0S@4 40 0Rhꠢ0( xx m p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0KP@BV;  P W0S k@0<0V$ ӱP ]@A0V0 LP 70-S xlK@pL0S LDL4r \ 4@lMb( xxx -L 8MP0 R  ( x 0-,@,PL $  :@(yDy -ML,Md:`:K@(LT:L , @0 `gS0*Kp KKZHLH000JP0K0L0 0uS0nS0 0 0JK(@D@D/P *Pp<K@@ D9PYZ(K00< IJK(@D@DP jK0(`F(K`F  0M>P@ ?hZKK0T(PE(LPEL #% *017>P@0C0*K( B BS1p@ 10DES d d d d d d d d dffffffffffffffffffffeffffdefffffffffffff8dDdddfddefffdf e efTeefefe$K@@ y0DKHsPppJK W(@D@D KH00Sb U0*KL0Z&P&NꄦK@@ QKH KƟH0 0 0 >  646BK@@+4 P#$%^*,6 (UKJKL(@DL@D0.S 0.  0 l b00l5   %%000h%h5劀p@,L50Xq4(K0SzK(pG$5pGY 50XS4ğ 0X0Q000 0S"UX$0sL40S000 PZ pKd$hL00P0-S0SAAQAAq 0S 000  b0 QŒ00 , P080!Q,000S|y@mx -0L0Sx@m p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#px@mQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`ph0%0 0X00L0 0T00P0y -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b'?(0,0000004PcUP!f ?`V 4f ?(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8@0@ <0e e e@ < @0% WZc 0Jp W⨂⨂;  Q\ `d(pGP0h000h0\S*WZ> 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K =+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K <+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  </ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K m<+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  P</ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#94p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK9x0 009P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K 9U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K 8 G0B @T0D```Vx010 麀8x 0`ḃ4 -L4 -L4M@P&v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&opH0@ 0S񟗇ꬩĩЩܩ```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CSk00,K 0^@c0S0 t,0 R0 X@ 4@ PL qPP `rP@ 30C S|ĬH RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L8P D*`0S @0SD _P Z 0S0SPQ TX :P ZTX H@0<>A r/ l`(^0S# <`^0SP 0!R00Ss ?I4K8 K0K9P0 #80@ 080 Y`V+ `000CS,K@ XP@0S ,0 R D@ @ = P RC@  I눊"00&AP< @@ +0S :@P` _X 2T .P@ 'pT IX 0S0S0L04]@CᖮT@hqlqpqdq d%0`LDX -LM0@Sp UdP`^0   K  R W0B -L M0@S {I^ 0 K R 0B렉 -t0LPd0 R X0XP PP00L '@0( 4P000(lqdq@(hq܉ p-LM`Z `P0@0@\  0S 0S 0S py -LM"40Qp,0 x(P^`0@0 P`O 4d[$K4@04  PN$\P4 K` 5"0`\Q(0p004 0PS /1 L40 TX:0 000XG A 00CS*>pp00 0S$ 0!000`\0Q\ p@@QtPP0 \`Qp@@0 \QtPP00 000h 00@ 5/0 4L T: yxyTyy -@LMT 00C0h@-p0\ ` L00n^@` 4KR>K0C0C @@_`0 fK~KpGdPpGPU0\%S>R0(5 5^ x$=L0OT )H$0\%R !040US  Z$08 3 #00\0P1Q>KR>K0C0CE.KpW B04% 0 45Po0C45 |0\%t3Rh 4!0. H3 \5<#SM>K0C !? 4%1 @ 0 0t/1E $pWZ`P2 ,0S ,Y40 S00X' @BNK @D@D0P&HD"P0\%2R  0S@82 lWM>K0C !RBNK @D@D0&W"PWUd1 \5S0000 /P L1 ?C \5SPP0 P 0ty 0-LM@T1 T0rP@0 \QpIP# 0 R0 \Q000p \KQ0(00  \TL0$ \8Qp<~tyxyD~T,P~8y\~h~ mL~ -LM@ 0l@n HQ\ 00CS x 00 00 또y~ -L M0Pp $0 R ğP0P* 30S PU:0U ă@6&0 0 ` !0/x@|#T 3S d@0 &D3T\000@O0* 0 % 0 00 0C R 0  R"  000@ @0"\`Q F p00"\Q(0p  0SH2 00鰠0<"\Qw )0 "\Qm })0"\,KQ00d0X00!\Q,00 ,0 O0!\Q000D00!\Q,00 ,0( O0d!\Q000@00D!\Q,0 0 ,00 O0!\Q00$0H00\%R4040  O0\%R404h0 40 4O 0@0 R0 B6t 0)t)p(j00 S0 00S0!d;!28!P 0S) 0S2 RXx;P HuK::P! 0S Lx x( =K8 @ < 5P x|@,CN`0 0wr{@T l{@T M^xd{@T d^{@T MLHV{E`K 0O{(x xxxx0={PxV|x"P8y'yw4y 0wyx$pxy,$ydyPtyyHwyy xyyyyyw@c,@HXLDpo -80LM, ,0  @Pxyq -L S` @CT`0t0@DT ` 0@#? 0S:0 2 R @ R0SR0;S00"\Qh0 0S "\0!0Qp"0Pd ( cpp0x0 8P`1 R 0!\Q00 00 d1\Q 000  Pw L0(!\Q  ( 0!\Q0h0 0 1N00 R 0 \4Q000w`(P  h0\%R4040 O 00 0S0   'xyTTyԑxĂ(~LwxxtwwyyЁ8ydyyyqq0yHw <(yw@xh`T -L M0` p0P0 ,0 |X00Sk8"> R,A2   (0 PH0 `X(0,0 q! 0 @Q6 P3 VP' `| R0pl0  0R 0S R0R0S 10S0S _P+  0 R t P0,0 0  0@YTn Xl<<H y$yLqyy<8y0q`T -80LM, ,0  @Pxyq -1L8M 1 q1!00( X (0K\ T P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0T@ \K0S N yqxy@ qy -LM, p0W`!ؠ؀ @PT 0S 0T @T R 0S @0PpG`W DP0 ,R0 `0 qyL -LM$$ @0 @Pqq -LM88 00 @0Sh$ qq -MLlMhF0,0   BRi   |   0 ,.PY &P}0  65]FKL0%ş `% aA5( K焕%5ş Vd$ 0h *0P000Ss` V: 5@%`4ş0 V0 *$E0P00\'` V:ğ0 ` S00*PP  V:$p4 ,0S ,w0S x0 P00S 0 S s S D$4P,$   00C0 #P  000 00C0  S;;SRVKH,l3ɠ \5\S00U.K @@ B @ R01 0#T*sp$#0\%R$0(0   @ R01 0#T: Rr@"0\%R0X0  @TZ0FK`4  A\$ 2BNK @D@D0($2 R) 0̠  _ B0S0?0?00 RP0\%R00  @yq0̠ xd> d<$0Pe0\% 1R$$0 PP PP 0:0090'yw z qq < yȃЃHxyTxԒz8y@z4z`T4Tz<l -ML08M (8Rp, ,`  Q 8 Q753 575(\C0S  P ^W0 41 R77 (K(K  (K0AO0KKl,0S`7(K (K ( K(K0 00RP^^x>KMK "P( (\0S#  R0.S (0&(00\ &"F 00CS񟗍 <   x x (0SX ,0 S ,,妔00  & 5 R E0 S % 00P%00C0 ~0S$ (\NK @D@D0@S^K PE0$ 0%5 R _pP (\00(0S0 R$ 4 R4 R$ hyP v0:  S00044 0 0^(\OR$ 0.SH_00SP[S0 41 R33 (K(K  (K0AO0KK,0S<3(K (K ( K(K0(00\P000 Q0hNK0ᴀ(00(02  0`0C0 @@\+0SP (00(0P l"00C0x">KMK \P8"4.00@P \ |P !0l!00S 0S 0D0P>KMK Pe(00(0 1  0`0C0 5崀t$v@?P_ l0S 0x0P\0 R\ 0SY }<00M0 0y'tyy$@ yLydp\|y8y$̄xԄHЃ<p@- 0$ $00S@T T S -LM$$ @0 @P zq0 -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPʦ`@P:l000`0  00C00 0@0  zw qy$zyy -LM$$ @0 @?PyqL -!L8M܁ܡ0X  (0 ( K\0 T0 P0 L0 H0 D0 @0 <0 80 40 00 ,0 , `Sq 0!PUT 0P!@U `,0V00 T@ 00CS7! ," " ," " " 0QP 0S P0  00M\K I\KB0l \Q  0  0S\KD @0 0F<# xy wyyHw`zT<H -LMp`W, 1 ^P, " 冞ᥡ0 0P @T 0S @T 0 (  0@@0PpG`W,0S0@00Tyy$y -LM$$ @0 @SPqqd -MLIM0 K0!,0 ?PHKK (I$Q@I8K4A <p?do R>XK0QX^~HK0A$UU<U1U/(W, K0K0P%0` 0/>/1(K^00!1\$ł0R`0V30/>1 10SK0$UK0Lq Q\<^P.0\Q0 T K0010X0P%0\0XK0Q\0K0/>( `0XK0/> ,HKd0A$5S A h $5! l `0S10>!d d0XK`=K 08K(0CPCHK @Q=K(@0@ SHK@AX8 ZK(LDLKD@ HK0A848 00C bPX 0 2X0h̟(K0!,T0-BKHK4AH(KL!00(K!HK 0A,00CR8K01;1 HK 00R# PU^ ^ $0ǟ0 Q$0.`0!008K01HK8 > b0Q0cP4 00XK0Q8K`8Q(K1KHK$!,1A(K<0A(1TXKK0 P5J@Q0S\V P 0S xK0KP%00 0PHK/0A>1/$01^`0U30/>11K0HK=8K010AL 0PP 24R Q$5SXR0S dj0St P8K01X K$20 $ X^a0  0 00 --L K( p-PLM@P`l0l R T D0 Rp80 v j0Sn ̞>.@@@0 > @@ @@>0 0:0lS P`,.P(0D.D<00fPH(n0S@T = ,0S ,=-K B BP =Pd5Tt5x%0%#,0104Pd5@T\͟\X͟XX-X=X id5T8 `j0= R0  V0S  C>000, 0,0 t010C@_aK0Po0E" $`PaNK  0X Z0S0<cQ0L QQ8 ' 000S  f0S} Py  00H0cQ  000cH00S rf0S_ P[  40L0cQ  400cL00S \ Zf0SAP P= 0P0 PR 0 @0i@P0S Af0S# wP 0P4 TR @4i@T0S (f0S ^P Z,5S05 FS.S \ 0a.KS>0S  f0S @P 0*\(5Qx@<@S  0(E0S e0S &P  4iH080@_Q s H0S.0O 0S < e0S0 P  hL0@0@_Q  U L0-0O0S e0SP H9 X0S0,%R0S0L%r P%0 0p/>1/$E0ࠀ1TPo`0W30/>11=L 00@UOX dGP%0 0P/>1/$E01T`0U30/>11=`L 00S Ie0S$ P  $7\%R0000#DC0xQ 0x@0S -e0ScP 6\%R0000A#A0tQ 0t@0S 8e0S,GP E 0S 5 R @ & L L3S 0X%458 p= 0000`d 0hLCV`!@0 `P F|T 00 X@0`P`/>0@@!~ pāO_P``5!?VAQ!o@4PW tpD44PW *4PM "Pp4d7 0,P4P0D,, x#8T0 ?>T(0$4 C000#S P  5 3  93g?0S@0x@tF tPfxHRh *H2 @2 020 R0 0 0V0S8 "0p00Lu 0P5?T5 V>X5P%0 0P/>1/$E01T`0U30/>11=`L 01 p1 p?P 0S" g0 00,%0aKS><0(5 H0S.0O  L00O PP H0 0 0D5S'w4ywy\<8ypy|xywyyyy,y؈8\xyytyԔ(LpT x4TLd|yy8yywؖ$zz zwwx$lyPx0y yxywؗ  0Xl4y|`TH0 0 0w<5S_sp0pP O@0 0 0045S+H0S0O L0-0O0s0 P0 P1! P P1 010 DQ0 0 0TT;P  0<0 ]x|1P 00 O$0!S{0e E7f<!Pweo*bz e"br 4we@@ -4L M , RtPp1 tdt@K `ğ0\$ȟʠ 0 oP4ğ4  \5 SS P1s@, Sς S3S0S1s 3ß:0,\,՘ڴP,Ո\%h3R T#h0 S,`0 0B RR,840L\?>\,rd0OSh" #&  ?2ŸPU;,0@ 0@!bh0/n0S ("P! @2 R,0,b1P@h00`T*0 QP@T:aAd!1\%R  1  0COL1H $0C.O (0O 0-O 0?O 0/O0O 0+O  S0LRL,"T(t0lȟ 0 ʠtP@8 <0\%40RR ,$,yyxywTTy  4Ptwy0pw -PLM@ 00 R$hd8y m -L$Mp`P@u Pa0@S pt3@  0@T , q830  00S, ,2WC H R R2!" "  0P 00C    4 0C^Q0 0C#0 0 4`0080P40 00pp, ( @| ,000, 80D 0,  ?~ 0 @ y 00P8 H $@ 04 < P U 00S  0E000D0@i  @e `0_ K @G  T0,d 0S d H08/>/1@ 01R`0@\30/>11< 0SU0 0Ŭ ũ,P0(  <0Q`,PH*ؘ@dy -0LM@H HP0T _ uedA(< 0R  0R 0R 0R 0R 0R, ,0R0 00R4 40R8 80RH H0RL L0RP P0RT T0R` `0Rd d0Rh h0Rt t0Rx x0R 0R 0R 0R 0R\5\%R -L: S  S  S @0 R8b S S  S Sy -1LM `RjP@@ 4T1 RU1 RQx0ST X1 R PUbDQXp<Nb~00CS0X0@ӤX0/FT) T 00CS00 R0 0  0 yTYT nTNT 3YT00yT  R 9 P00XG1@@ b40@,8y<py4y`y'w -$$1$!@@@L0:PP; 0pP `P`@ @pp0 `V`T$0@0P00T  RP 0X  @@X86Kxyyy00c0Q3@T TX0X  0S  R1 018ĠPt800CSTs |s @s s @s @s @s @s 0S0 #Q00 #LQ0 R0S800CSt 0t t Lt t t t t 000 10B0  2 R0  00800CSt t t t t t t t 000 10B0  2 R0  00800CS\u tu Hu u Hu Hu Hu Hu 0S1 S20#B1  0S 00 -LDM@PP @ <¶XP ( Ķ 㺭ePP fY sY !1 1 !c<p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL    0P ,P 4`  00T|밙($?ԙ | (d%,y z  x -p-L M$`K a0P$0 P @ P00 0 P Pp -0-L0PS @ CQ0 1Ñ0W000S0 --L v --L ٬ --L M((K0(K ެx0 R  -LM@FH -LM   K 0KK p@lW張\ -LM @ \K0   KpHW嘵0 鄚 -L -LM@@0S  hCT -LM@d$p$ pQLK -LMM B~KpGnK0pG`F+`F(0 m+irPÏ+PP"KAA NK@D,X  4h 0X V(Y|,`4 0X Y`L$BpDa008 ZP6KAA Zp@V0S' T 880S@WT 0S 0@T8800 |  SplJT(0 SH({'>$Ht~ ̛ |  p-L$M>+P`*4@K P 0` ,` 4P M I*10AS1 0K(0 $@ ` B(KhXd\ {Ip H<0! YP8K Yp@ #V0S  gpRT80[S [@WT80SS S 0 0R0<0 <K`!40LLL Dp>$>س0Lh | @ Ĝt? T܅ 0-LMP0@S P UP 0@DPU  008z -l0LM@ 0K $0  K$ K 0P U0 8z8 -X0L M00 0@0 K P {U˳ 8zH -\0LM K"@ 0$ KK@  P (K0$(08z p-LM@PP` HP@`pP`p错 -LM@ 0S 0S  h - 0LP`p 0S 0S,@, {0ll ppX| PPV0(0 0$`$`@(@(J0z p-LMP`P  0mpO rP@ @p0S P吨P@PpUP@ ,@ppQJXx p-LM`@PT 0SR(0@VT00P <pbP@0PS  p0z | -LM@>) r`RK !Z9P0 V 0 \鰝ܝ -LM@N 0`p`(Kpj )pPP V $(K vP( 0[ 1S00 0V% (!pP T0S T0S T0S$ ($v) $($omW0`S|10S p0 ,K,0 "V0  ( L p-LM`0S+ JP@'  # 0P00 $0( S ( ( R$0$0phoUp, ,0 p᢭php0z @ P)ꘊ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ Ċ 00,00$0 000 ؏ @ p-LM`00P 0@T PU 0sp00 0G(@T8@0S Vpd0S 0p0z -LM`@pT? 00 0(@T8@pT`/ ┻P `(@T$T" 0 0R 0 0Ap 0 0S 00 0P / 00 0S  PPa80@T 0  S (@T 0zX (0 R 00 0( R0z 0 4z 0:0 p-1LM@T 000 0S(@T6!M p6 _'p`2 P#$@K P  ` ` $P l h8I K l$! 1`T  0o(K U(0#40S 0:0@0TSpKR0S P0 0a Upv0S9R0 S5R0 S @TDx00i4p0zt?$@T>>سԞ4z | 0-LD60 R 00 0( R !@0SpQ0S P0 0 LUp*0SQ0 SQ0 S @T ,00zt?$@T4z | 82P *0P ": -LM`PឥP( @(K,pK 0  (0@S0 -L M0@p00 0Si TPP 0S nSZ =P0`0@Q ႞P QLQJ  0V0P 1 0* Y0  0000V 0`0^Q00 ,K, ?R0S@p @LQ0"Sl 0 Y000 LPH00D 0oSP  hPhp -BML M ?? p , ZK*KKP0 K|0 夐  >.WKP ʄ^AmK|.|>Q(`F`F  4p> ?0@5S ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ | < ܨ ܨ P ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ 4 x @ ܨ ܨ ܨ ܨ ħ ܨ L ܨ T T= XT=X pb 0 00cSNK@DP m0KS  KP KP{\0SK/IVK KP |< R Kr h\0S MP]Kp*KP|LKjKA|\P<?: S 0S/ 㼸:KPPP P`PjK``0P p;  0P KK|n*K Kx qd;0  00SZKxP:Kx0 2WC J0@@0  0 S ˟ R0@@ 0. @0`p  \ 0SX0S 0S Kx(0S0J0S 0PP 00C   0SڌZ0S  R1 0 # 0Sjڀ*0S010p: RʄJ0S p: rR 0S9 R00#1ѣ10)^K(iPE \  ȟPo̠0 (0 @@00 00|h0S AK(A&rP Xtp8(K h8(K0 KX(0(0K j:KZK `jK`KKZK| 0`   R@PĠ?T00tG0S K| `0S KHHt L'04xOSH7 0$8 0(8 ' W #p@s PH nK`F`F&0u~KpG"A]K0(PES PE-0STZ 0SHD  ARp P!4+sH ^ dP:K0S   XK NNK@D@D0%+7 5 3 jK ,H `0V00S00 ,0@ PN K A TP0S[jK WK:KZKx  RIں@PP@ ?4 Q49 \ڀ4{`tǏ%,!0@@0W a P&V30@!0001 S90Kx(0 S;30xr\K.P@ P0PDjK`  *Kq!NoK `NfZK < . ..MAKEDEVconsole tty memkmem׬null׭zero׮stdinׯstdoutװstderrױksymsײdrum׳klog״bpf0׵wd0a׶rwd0a׷wd0b׸rwd0b׹wd0c׺rwd0c׻wd0d׼rwd0d׽wd0e׾rwd0e׿wd0frwd0fwd0grwd0gwd0hrwd0hwd0iס ... ... . .. tmp dbզ runEemptyZ ... ... ...GjKPx Kx夠 *K:KP>AK(JJ 8Pp, K ܚP K``pWpJP @К0Sr0@0b0S \P :K8T P0pWj?0ZNMK BM jK 9ZKP!1PKAZpp K #!p1PjKtP NK@D@De/>KKK0C^x@ (!P$1(`K(K!<9 (K;9 @ 㔠@9) ,9 )0) ( K   (0K0`(PK`I@'{{ @d%,H*X{{t{X @c؟0\LD|( ĠРܠ{4{\{{,n^KPEKPE0 q KBNKP@DjK@D` 0`cK@O 0`Y*K6O ZKPMR>K0C0C``l8 A0 `帠0!S IT1K00 hA1 `塠1\   11"A8 P`芠82\  HB1 `yt2\  LB1 `h2\  B8 P`X2\  B1 `G$3\  4C1 `6`3\  pXC1 P`&3\  Cc0 `3\  r0S 3#KfD圴P$000Z0呴P848$Q DNL4J@00 `0\> x0| 1/$ŕ01\0Z`0^30/>1 10S:0 4 a PR ,ß` ` r ?CΌP ^࠳ @08 00P` @x@@0@lRCPU ?# ?WᣎVP0 0/>$101^0``0U30/>110S 8 0a0b0P @x@@00 Rʼ `C 0B ?,P`0xQ08@@<4`S84S:PC>⼀0 ?@0W BV@0> 800c0P @yx@@t0 8J{{Х(T{ {TT{{  {{'8@P`((D `{ 删\ ?d0S4ڴP%0 0P/>1/$E01T`0U30/>11=`L 0@`0xQ 0 00 0-O ,@5L 200 XPI P@5LV>00h0h0 S:h01 1< 1\ R0E> XT0P P0HU 00@u0Pp40@ ,C> l0` 0UOS/}P=` Sp`8_@0VO 8C>N0 0+S  0c, 0C@ @0?. S/0OCΌC RWڔS0S 0SPP@ # [* 08`F<  FHa`[~ [~F`@@<@TU F``bF?A F湴Fj -Fj -0 syAFߕNFߕNF Gt;CFFF txAF\$F)F6Q ኣCF)F)F) ~AF)F)F) 9uAF)F)F)F3FF:F`{8F`{8 ( !F9(F9(F9(?i!F9(F9(F9(!F9(F9(FA1q,!F9(F9(Fv2F'!F9(F9(F9(+!F9(F9(F9( Aj!F9(F9(F9(1!F9(F9(F9(H?T!F9(F9(F9(چt!F9(F9(F23!F9(F9(FN3D=!F9(F9(F9(PD!F9(F9(F9(UaF9(F9(FGI:ufY@!F(F(FGI:eaF(F(FGI:Zc!F(F(FGI:}aF(F(FGI:RQØ!F(F(FGI:EaF(F(FGI:/r!F(F(FGI:baF(F(FGI:R!F(F(FGI:aF(F(FGI:v.!F(F(FGI:zyaF(F(FGI:^b!F(F(FGI:[cBaF(F(FGI:Ed!F(F(FGI:ߣaFBn)FBn)FGI:m_!FBn)FBn)FGI:p7aFBn)FBn)FGI: CR!FBn)FBn)FGI: S"aFBn)FBn)FGI: 3zW!FBn)FBn)FGI: xs$aFBn)FBn)FGI: H!FBn)FBn)FGI: aFBn)FBn)FGI: #!FBn)FBn)FGI: I1aFBn)FBn)FGI: !FBn)FBn)FGI: &aFBn)FBn)FGI:WՂ&!FBn)FBn)FGI:߁aFBn)FBn)FGI:/!Fa7*Fa7*FGI:f-/aFa7*Fa7*FGI:*a!Fa7*Fa7*FGI:<aFa7*Fa7*FGI:!Fa7*Fa7*FGI:IaFa7*Fa7*FGI:4!Fa7*Fa7*FGI:/ aFa7*Fa7*FGI:fS!Fa7*Fa7*FGI:xdaFa7*Fa7*FGI: %!Fa7*Fa7*FGI:> aFa7*Fa7*FGI:7#!Fa7*Fa7*FGI:RaFa7*Fa7*FGI:˖!Fa7*Fa7*FGI:?9aFa7*Fa7*FGI:v!F\*F\*FGI:+0aF\*F\*FGI:9 ]!F\*F\*FGI:eaF\*F\*FGI:Qc=!F\*F\*FGI:*qaF\*F\*FGI:Y!F\*F\*FGI:UaF\*F\*FGI:آ=!F\*F\*FGI:ءMaF\*F\*FGI:R0O!F\*F\*FGI:EYaF\*F\*FGI:~?!F\*F\*FGI:$^aF\*F\*FGI:PnYB!F\x<+F\x<+FGI:ĶEaF\x<+F\x<+FGI:._!F\x<+F\x<+FGI:Nq'aF\x<+F\x<+FGI:W!F\x<+F\x<+FGI:9E#aF\x<+F\x<+FGI:!F\x<+F\x<+FGI:mBaF\x<+F\x<+FGI:EC!F\x<+F\x<+FGI:KnaF\x<+F\x<+FGI:ښ!F\x<+F\x<+FGI:aF\x<+F\x<+FGI:->!F\x<+F\x<+FGI:NaF\x<+F\x<+FGI:?O!F\x<+F\x<+FGI:za@-aF+F+FGI:?~!F+F+FGI:aF+F+FGI:!F+F+FGI:y"-aF+F+FGI: #}!F+F+FGI:aF+F+FGI: b$!F+F+FGI: aaF+F+FGI: J/@!F+F+FGI: ]CaF+F+FGI: k!F+F+FGI: ԇZCaF+F+FGI: 36!F+F+FGI: |_aF;q,F;q,FGI: mw!F;q,F;q,FGI: S[6aF;q,F;q,FGI:S\!F;q,F;q,FGI:9vaF;q,F;q,FGI:,I!F;q,F;q,FGI:gz!F;q,F;q,F6 RBu!F;q,F;q,F*G7 bEBuaF;q,F;q,FGI:Z5!F;q,F;q,FGI:GaF;q,F;q,FGI:gn!F;q,F;q,FGI:!F;q,F;q,F;q,?H6!F;q,F;q,F;q,?l&aF;q,F;q,FGI:!Fj -Fj -FGI:aFj -Fj -FGI:I!Fj -Fj -FGI:c;aFj -Fj -FGI: <!Fj -Fj -FGI:n^aFj -Fj -FGI:u!Fj -Fj -FGI:!Fj -Fj -Fj -<!Fj -Fj -Fj -(GH6W!Fj -Fj -Fj -(!Fj -Fj -Fj -(8!F-F-F-(!8!F-F-F-(8;!F-F-F-=B}7!F-F-F-" !F-F-F-"W7n0sV _.i}|}(U&Ms$R\9krEq hYFuanOI0\%4R @SLd0*T$T4Q0`\5 R XP `0 00D S0:10P&z 4 L* p,0W$p0吀KS%d{ p,0W0Sp D5 R PeP \0SNڔPG@T0*G 0P`0 0 8P40 I @@IA 0,;0 Q ,j`=0T0Q̠ d DFVP0 0 e R 000 PUP  " 0P  3030 4040 O00@`T#d0>ᥱ@cTc@#0t  P\6\ HdcP2 |7+E(7 7\5[*0'P KC>0C@4C/ @Kd p`0 P@0CH@p,P4h#/ `P80 'H 04 0@4(0 H4030 3040 40|0 00 00,00C @d+QQ0PJ?0 Q00#1t0003x0 R0(% 0,50 0084$0 <0@D000 0Xà <0(50,50 # 0 S0S 0s  ED0 xD@0 h0004 Ϡ΃H}h>{8t${Ĩ -*LM, 0 0, <ȟ`Q84S*C>0:,,@00 `:$X: d0@C<@*@0_S0S*(ʟ,@P0 0 0#   h04 hY40@9,0 Œ8 7ɟ00/0l9h0 ,p 0 t x00Sx0x9ɟ 0S0\p8ȟ 0\0/>` 0`0/>(d0d Rʸ 0,0\ 0hH,`X0 S\00 0 2$0 ` 0V0C 0, R$40X ǟ@87 R`0 0   'QTdǟ408 XH 08@aP% @7` ǟ!40040800`Z G0 S`00 0 20 $0Z0$0&6 80 0Sl#@8Dhh6 R`0 1<0   0&Q6Ɵ 800S0 X! h!400400X5Q`0 0ς 0!| $00$0 0XPX8(%00 Spz ğ0x 0 R``p@VP $0\QO P\`V4 ,00P@ d00\0S0$08 Ղ`$0x@`TV0PU@0,   @ dP0 008 `A|ßl0Px @U7l@Hß0d{H#H3 RT000T0003` 3 R' Ÿ0dapPZd;@PQ0 10` -D뀐000@XP@Pd7P5Ÿ0d-"2 RT000T0001`1 R) 0dpP%R< d@P0 0` <0뀐000fXP@PdP5,,00CP00 !  0 00 0t x0H TpT0 1X0@0$X0 0\0%,({{{( U {TT -LMIK@Pp, `1Y A RA A Pp ` 4 0,K2B0 RGoK&GoK@04P0 0L`| p0Ġ/ d4  08],00 {H{8A -LAMJK@, i_0KB/K00Q `000 00 08 A^0 d S00K 20`K@d ?11 RT000T00C0P1 RS @0Kd l ?@4 8@ PUU@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yUeb ,0',$TP (,'H p-LMP`P @5@P0/S+ /@P0.S P0S@p0S .S0S`V d 00 Q P0S0P,   @@P0/S 8T -0L 崘^@(t -L0M0`@/>@d#P000LP< CR 000Ri0 Rd \ 0R R R0R `h(( -40L R(0$0$    ]D( -L⏌<0 R4  g 0 '@ <P - L  -LV -LMhq0S \\PPL ~@!PD 4a@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0NP 0;C 0 0d@d @Bˠ$0K $ @:8~\"@ <, -0LS \|0H0  00S_\-\0S V H*< p-LCM``GOK0PL  _80 Y 0S }\p'T\ -LM$@0 S A00(d 0-D0L R 4410P@@T00hH 0-LBMdP0FOK\0 P 04 0S /\0'lt| p-LM`@?,0 m P7Uph< p-BMLM`0<@KP0 B<0[ES FS AS  R0r S00x ;K⧂0 S X[pCNK@D@D 0 <0[FS 0  'L -$0LM K YP [< p-QLMP`@00Ho @l ph0PE S U@00pȭ -LM`P媹Xဋᨋh!pXq mP pP P@(@ =!0AT3 T`7 @@P0/S Z  1P0S@!`VP X: p`:  @@P0/S Q@  fZTd%` -LpM`@pKb7@|6 00RPP4YP0: SU/00 Ô X j60S U P _60S  s:@cL` -0L {Z@( -\@LM80(0( 0  -LMp P( :   Qq00  R(  R00#R@@T;Rp 0P00 p  (0x\P`@@(X0S 0DH00S (S 0S(0 0V0 S񟗫 0 <  |  <  $   (0\(   Qq00  R( 0000((0\( ,  Qq00  R( 0;Sp( \ pSg  Eb(0\(   Qq00  R( 0\S  d*(\( 8  Qq00  R( 0S  /  (0\(   Qq00  R( (0pS0Z00 0PX(0\(   Qq00  R( 0S 0(0;Sx  ( K_ (0\(   Qq00  R( | ( KF 0S P(0\(   Qq00  R(  $s(0\(   Qq00  R( 0S  3 @T00pp#(p}4( 0HWt8S(( ( 0\SS, (tP(  L( ( (P( t  Qq00  R( 0;S @l(\(0 ( P(   Qq00  R( 0;S S ( `_QZT(@(KP( `  Qq00  R( 0,S00\(   Qq00  R( w(P( `\  Qq00  R( Z lhH*|lЯ,<DP` LlDX 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ !0xv@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 v U ZP T0S5 0S 0 xW 'бܱ -L M@X, 02 ,0 p1 100 ,0 0=P0S4P  \S  RE ZQ@D0S4 0bp00 g R APU0 00 !P \00, 0 S0`B 0V, 0S`3\Q&Q\00 S SP$ 4  0bp@, 0i(D -LMr ` 0 ( P0 (P`Ÿ  Qq00  R( 0gS{ 09S,1SUK A A ׃pP@P@(S S (0(8 0 S x V;SpSD wSP( 4  Qq00  R( 0NK @D@DS  S ( 0(0S0R0 ᧅ0PU ( p 1  0tvdr00U0P0e('H*pȲ L -MLM` P( 0\SSL ~KpGpGPP ? jK$`FP@ `FPP3 0Qq0  00SP@T 000S0S   0S(0 S H(U8,'H*<Ht -ML MԀ0S P R" 0pW ` 0@ ,0 S0 ,3N)0S P)yPJK(@DP@D *03\ 40 s᩼0k' ((0 -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@)0Sj ) \10R,0R P($0\ CR #00\P 0 C0 b\ 00`0\ P1,`0Rto)`vdP tfL$ KP2[S<00Z((H*@LXXPht@ -PLM؀`pP@) T 0 S R@D @00U00  0 0"P P &D <0S1ܱ` -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@H* -LM@P P`p W00  0 0  W P0-L@P 0wS! sS @T0 p &P 0 0'0 d[{Sp P00'څ 0CLb00 0-PLP @TT000 0-LPP@0 0R0 @@0cH0 0-SL@p  P`NP@4 U@@V@DH h0P @\0000Q00 -L,MS @P D #mp LP ?PPP|#0SA lGdOH \LL Q 0S 0S0#0S$ WP0 #PPe2p D 2`a"P  P0@ |"@ PPd2d ; 00 , D00 0<80 4 jp pP ?P VPvPp 3U 0a,0 X0?0,0 pX,00,0 0*W0S9 @T6 0(Y00SP0(U00SU W 0BRSh_E 0BSEH I I I I H I W,0*W0S 0*W0S 0S@ >E>4DP  0p00  00S& @wPp6 P`7dHP`2 DDpLܾl(gfff\ LLH* 0-@0PTL 0Qc@@0, -XRLMP"@c?P 0A`V PU / 0S 㫄0S @>1 LPl 0S0@  $0 S  1SqQ0S 10Sl> @P@Ic?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00z0@ ;0 Q m K0P@@ RV  0 ݀ @, 00>(DH`,| -PL@p` bp lP ?PmPp`t 0P0 PP =-0P0 0PPSD0fP p-0LM` P@b?P 0AT K0Q3\0 S0 1 !0l p$R=pM=Dl -LM0@P,0 #obp ?P SPP,0 S ,@3 AT #0 P 00LS!00LS0B \L =p\ p]  Qf` ᓄXIP@PR  Q8 凄P3 0X0C Sth g g g g g g g g g g g g g g h g g g g g g g h g g lh g g h g h |h PI PQP'SP0-V +V ,Q@ AP \ \ =V1h0l.P 0a0CSi i i i i i i i i i i i i i i i i i i i i Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<<3'DLܾ p-(QLM !@`a?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPp,|y P;P< (;pkypDL 0-PLM @ a?P 0PPKPK@P 0@0 SR R 0D -PL4M0p @P0 TP XP $ `p, rP' ?P pPLKl=PX L;sP uP`PX  L K<PX L <|;0T0 0P0 0!R40*X<$X e?@P` 00XPT0Sc 0 00 ,  00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0StP0;0 T0S H00c RHK[pP800c R8K[`Y U u P2 P$ R X婰 P %PX2 SP0\U00Su US 0"0  40VG 0S 00a|0`71 R,4 }P# 0SLeT0S Xu XuX^<\00 000D28D<+e  0!e U0S4V  V 00S`FV 0V0 R fPF\`0  @0 < ;@0p0H0 D 4:D (LL` -pLM P_0?Sl@ M0P 1 00S<0< `W@9DH p-ALM!Pc_?P4 0P@ P 0SPU @Zp: `:4sP``V 0-S Pp%sP@P et0S,9p0S`DLh p-ALM P_?P`p0AT K[\P 0 ! 0 rR @0S qXX~@P00`h0 R 00C8S` RV 0  9D p-DAL Mqp2P 0 (4 K 0B0`CY | 0X 2T Z P< p@10W 0 P9 pPU @< 1P7U<  01PUX!<`4,0^ *00,10 ` 4 18  00@` DA %A@,@ 0 4 dZP PpI  SU@1 14 1uP11P @T<080   0 -LR  ì/` P 00U0S0  'P "P `P =P :P PEU0\\S @T0 'P "P `P =P :P \P0 @0S0XE Q  p00  RAQpPEuP U0/S QQpppePLH* -LMp`@(K 0 {0P(0 U(0Sl,0K  P X(00,00 0 (0S\ ԟ Q-L`p90  Mp0PS@   \R% [Q*Q ?Q $Q 0(S /Rp RQ0~S  *00W 4tP  0S@ p-PLM`P@TQ 0RQ@Tpp -@TLP`@p8p@PTh -QLM@% T! AP0Q/S P /S @P0/S0S1d0/S@P0/S 0閹 -L M0K` e e 0pS  JOP P0hU`5*00L@ @dDA [A0@P0 -L$M@ @D U2  000 , H %00T0`80 4 V :4@sPpc W 80  cRP8KL@V*0 R 0PU0:/00H0 80 cR8KL@H D寷@B4  0BDACTP`0<0 < KP@ 1 1 P@T10 R` W4,  <0S 0ոp -@LPpnvn`T@X00V00Ses0S _sP 0SD@P`d@@VX -"LM2"2"22"@2@x"t2p"00dRd2d,KC,0DPD"`0e<088"Pp@@0c00B"0c0C0 gC0STA^ 1!10n 0cCPB00p<_ P91 R p|t!0@ 4@`01 !06S<1` H@l -D0D L0\0 P H LHl P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` ڴ00H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0UꀗHLX`dt -L -L -LZ 00H -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0SwH@lH* -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0-HLlH* p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0TPhH -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00H* -hP@L` P Lp0T*0V  0S 0T*0V \T - PLM@ pH 0 0  R ^T@?hhH* -D0D 0L0Q0 P`0TyH@l -D0D 0L0S0 P0<aHLl -p0 @L 8`P00Cs0 U0 T o @R 00Cs0(0oP@/LHl@ 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00Hl@L - L 0   L -$0L; ̺ -0L?鄼 -0L6  - 0L0@*lx - 0L0lx -D0L R80000 ,00@pl  -0P LU:0` pUh0P0@  `n p0 )` `01 0Rh?$ ꄼ @LxDPtH-000 0 0 bL1C 00N괼 x|000 0Q 0 R LL@p -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$*U 00eU@  '@ -pQL@@0 @dT` :%PP 0@DT*d0 XD0@]@0@^S@D} x @ 0- L^RP@ }6P00d0= uRP0 -p0xP @L@b\`00YD0 <0 40,0 !L@HTtP -0L,L -0L#@ -L -lpLMP\r\`  P3 0Rs 4"42@PTk 0c0@0d0CS01 1E D 0RI 1`V# 0@S0P0cPcTp!h0 0CR& 0R 0R>P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 00H*45 P0-L@P T t$|0 0h S`0 ! XT0hb$H0<\$40 U$Dܾ ` -LM⠢pQ, S |,@01Q 0` 0@:T+$Pp 0B,a dP00S S sYS 0S@ WG@01 R;0@:T;T 01  l[#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P (jP @, 6 ,Pd00@TTPUXxWT$#ꈗDܾ(<@ p-LM<8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPU㐄P@ DmjP80  p,djP<|X@-?>,1@LQ 00萗 -LM@Q  Q Q Q Q$ h0 H p-LMP` R @0@0R@PcPbS3@ptꀗH -L0Qh0 9ꀗH - LM0 0 p` P0@@cP0 PPt 00p 0L0L H0@ @0@p`EޮT T@DPLH -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @PP 0@ 0K @}T$0n$0P 0S@@TPphLH@\  -h1L M`` 0(K n0n4@K0K,K @P@P? X04 D?0P0,0KpC*P00T0S`T XU U 04 $P00  0R/S \P(0+ 00( ) PFLH@\ -\0\X0X T0L0 L08\000 5 h`\h@HPt0 -T L0LS00P0 S  0S0L p- P PP0PLM`0 0@R 0 R R00CRphp0DS 00C000d`X p-LM@,`PP 0S 0U p\ 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @PH*pl -LMPp0` ` K"`@T 0 0@0@ &T f`@LDHP p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@Y@pᷬP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S /P plULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs02000 r0 0  R Q DHLlH*|&) -LMtQlh0h @ PT *Tp0Q`ITP*0U@00tTPLh -tt`0@0LpU2@@PP+ P4p0mM -LM0@S`pn P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 c$ @`DA ZA@ @ $ ( ` O $ (  p-L Ml`0P0@'0 $K 0 $0 9$ K 0B #1P PMp p-L M`0@0P 0$K0 $ $ K 0B C1<@ S@  @ !p -PL`M@ ` `   /0S 0S0S @0  00 , 00p(0p 80 4 P@ Lp p p p  `K 800c R8KY>PW񟗩 ` V񟗜\ `X 00 "" " V  R X V X 08.0004, `}@[0T. @0T* @(0V0 0 0  00 , A004 080 PL=@` DA JA0@0@0@0T * 00 E  < @`DA )A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh H p 0 H p p   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP dP 0 UPuX p=40UfOP  @0T*  0@8@` DA A0@0@hu0`0  `   $00(   0 S 8  b R8Kڎ<P00 0S )00 HKPp c  000  $00(   0S 8  b R8KZ<P00 0S )006 0 | dK@K 0dc000 X^0@S 8  b R8K,<0P00S00  00@0 =c KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S- d d d d d d d d d d d d d d d d d d d d d d d d D d p 00 ?00A `@0  (CXUl4pIZ C0  0A 0  00#0CSO L L L L L L L L L L L L L L L L L L L L L L L L L ` 00)  000p 40P]  H R000 0p 40Pħ"@ 0 ]a]0p00 0 40@U ᤧ k  X 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D D3[SpO0DsF `A MF`pN 40 U B GH0`VH0 `Pク ,` ꌼLT0`LH|@D@ (Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X ll@-X=X ?X @4R44@T0@@ [0=X[aP 0@S*S0]S =X Z\@00  #0HS` p ` p p p p p p p p p p p p p p p p p p p p p p p ` p ` 2 0,0 0 4 vbZP 0/Z40 0`CA 2020@S@@^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 [0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[e`P 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080 Z2[l0`P`@aZL0 0`S`Z Z L -LMtP+\aPP@pNPcUpG 0S ,K| ,A@B`(P  ((2N100@0 R0`V 0S 00S 00P2AP@`40( U -L@P_@%Tp? #T U@` :P`T`T TU@ :P@T0e  m;8P@:p`p :P`DT*P@: s:P@DT* p-LM 0CP`CA)P @0T *00፤ TpX0 @`DA rA0@@0@`AdphS<0  -0LMpH`C P<1: S7$ -LMPp]P`2 @eT: ạ@0S PgU * R 0S  0gSP:00 L]P 00 S0PgU(0304W  ] -LM` ( $ p @P (0R000 , , 00 R00RP@$,T 0S  b RD60P R 000SP@,!0 /R T0   b R0K%6000S0 /R T :R:R - L0SX +S -Q <0P0S$WX0Sl4# 0-L@L PMP0 00VP0  50 00м -L$M, 4 0 Pp@\Pp 0{SpW 0@0S S~ 0SX0X0W0SNT 0 S80 p 0Pj l< @P 0 S Rp{Q  8 @0bC<0}Q D $ ,QX L1< 0P` @}8 y @ uD @00@4 0, 8 X 4, @0T*0,00 `t0@` DA A0,@0@+0,o0{S| }SHy ,SX@u - L0 0 R^ D 0`XVL@Q D0@ 0J 0!RPU7 ,0S 6 R /XP0H, , 00CS D | T  T T  ,4 0044 |6 Y/, 0@3,0 R,0 R @ ,0rN00 ~040 0,0 0-PaH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00P@> @48|$,,#0< <00, 0< S 0DS         44 4 c/ 0\/a,0 , 00, 000,,0 FP,00 3@  00 0@(hM, 0T F,0  ,0 R  : ,0M.B\ 00 2,  0 p00 0S B @KK <$ U,0 R X0Uc:cQuR$ =PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` u0S00p000 PU  , ,0S,P |=댼D((@H,T̼,X` ~ K Dt  p-LMP`PQP@ 0ST 0S`@0 0@h^L0 $ 0 0@<H 0-L@F 0FPP$ 0h AT -0LMp@`T P FP L 0V0R00S@R F 0 0  -LPp`XF  @0;` 000W YM0  0S;0 GV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` p -LM`pF3/VPP` @0T00SV 0 S PTQ 0S 0 U @2 Tx2x2 0P@ T2U  H.T  829000 OP2P 0 PQ0@00Y @ @ Q0000 )F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 إP 00000 0 PP 0dLO^P\0P 0 d4 E@Gꌼ@x p-L M PK`pFFP@  V 0 /R 0(00 0p -LpMPK`@ePpkP@U WV 0Sp : S  S pp@Ip -SLM0@< /0TP < P  (H1  000 , 00PT080 4 4 :4@TpW7 `eW 80 0c S8Kڒ-@ @ᙘ/0080  cR8KPڀ-@  ቘ<4 zP 0SPU4,4`, ֙p -x0tp00lL @`0PP}60D02 @P700004ȼD -LM0X pP `ጣ $ Q bP8 R 6000"` 0-LMPK $x0p\ 0d 0 P  }0 @ 0`Pht -L M$`K@  pTpP, (KP 0PS  @ ۅT0d0 ҅ ̅( R p0!h`0\ @0 0S \ 0S\`(ľL -L M$pK` P坅(KP@$  R 0S ᖄP ㇅7 hNUU  m(0! 8`Lľ -L M, KDX0K PPP 0S X0@ pT `0ŸS0``pS" @T$W0 0qX 0SB0S  z0S pB hPW00H0 U00 0S X 2 R0">0,K  PX`A00 R  0S AQP ,K ׄ(7 X 7 0,1!0  ,K㷄70 h 0 } 0< }9K,K 㔄lc,K ㍄T00 !H`(ؘܘpľL 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@긘(T 0-LMPK@ *80@0S 0@S 0` -L M,K`PD p V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  Ѓ ȃ000!(@`0ľL -LM pK` ᭃ@T P0S 0@  00CS0<0@T@T 0 H@T0" ㆃ긘`D8 -LM@K 8s00 \000i 0`Ę -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$Ș̘Ę@Hd00 000S  0S$4 0S000И( -LMP00좟000 SQr`0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BPY 0SN P 0S? " 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  l 0  <l\40 `劁P0h;0l`0P@j 0`00@0000@00Za Q_MꌼؘܼܘptDL -LM0` V 2 0S{ `VpKb뼠K  aPPhڸpKV`V 0@T 0S @T`VH ?V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H 00 0S0 0SS0000000 鸘(?BИ p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$phhԘ8Ș -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@S(  T lK@ 5=V 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,)"0 SVt  V  PU 0S0 S t\h10}"x 0P@LDTr"l0[S (!T100l Kx` e" `" p0Z"V 0SlK~ lK@ W"{0l0Kx @VT0 SS 02f 0lK2a R4P x X+"'`808@HT\Lp -8#0L` %^0?Sat t t t 2P Z0010S P 1 @T 0S @TDp1@PT 0 u PX@TX Z 001@T 0PU pUP XPU@TZ 00Q00p @T 40S 0S @T@T 0S S @TZ0L -p LP00 X R 0S R 0SRl㢫 -L,,0@ S00 鐫 0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00Ḙh(Ș- RR  RRR00Q00Q <R 0S  R 0S 긘 p-LM0@`TP 0S@TpPP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB |20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S   X X #X  $0 0$0.0S 2   hb  P\P Ο0S00 X V V0P.020c RKCp Vꄐ ؒ h $ \ H < X ȥ = R $010!X00Sx P\P ͟0S0P0 PUf U00 UPP!UK u -00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  p PU U U U P-0KT:"0R0 KBP; AT 0 !R 0(000 < H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P P˟0S00  (X {XJ [000@* 00X  " b RKnp P\P ʟ 0S  00   00X    20c RKEp00X  @00 00$0000K p P\P ɟ0S00 :X %X#X 2 Z 0`0 K r 2 Z 0 K    P\P ȟ0S00  P\P ȟ0S00 t (X A 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00|7 ` R< R 0S BR RB B+R ' Kf  P\P $ǟ0S00  $X "X 20c RKlpX 00\00" 00\X `X00" Z@ `@ K& \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 u h2 Z 0 K "`R 0057P )K P 0@S " b RKp  00 R<4\n0(20 00 < b K0) @# )X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`~|q0FSGLAz@T *Xl (Q d9|X0A0EA0US2 " / AE'2`A2&  f'P@ 0 0S 0S <0S 0( @ 0, <0T `'H* L(AE ''P@  P0R }R\ & 300T*X 0S0 0 0զU0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0xl1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "Xy2 JZ `00 K}X]2 JZ `0 K0S ꀡ X 8 X ` (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\07/0S\X `X2 JZ ` Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P ax000( `p 2 JZ ` K5\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  [X X'00C0A p-LM0P0`0@V:`p0T:  -LM 0, !B0001 < 40 0 ٤408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K` @P`S UU( P\P 0P 0R0 P U<K U$ <  b R: @P<00c R1 @P8 0 08 @@0 `0 00C00, --hLM 00CS0< 00CS0$@@ Q봼D p-LM@@`70DSp0P B    $ < (`8 , 0 4 p<408`400, p-LM0`%0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 (1  uX0001, dP  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S $<0 0 Auaꌼ8L 0-0LPp@P0@0 -0@L MTP@ T J,\-0E,W- 0, 000 L e@TP0H , W 0 08 -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,@!P@ 8!mK `F0`F(0 r wXPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄$ X x x x x x x x x  @  , P p з  D  0 T h B^KPEpPE0K,0A+K0+0Bv`XP@p86B^K PE0PE0&)5p6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%5pl"lGB^KPEPEl%0l"l:B^KPEPE<%`}0 P00{RPPU B^KPEPE0$4~KpGpG+0}0PPlh"lB^KPEPE0 c}0@p}B^KPEPElO"lB^KPEPE0$B^KPEPE +0w*+uB^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDl"lB^KPEPEt#{B^KPEpPE0K K,0L+ A0B^KPEPEZ.`0P0p0"3B^KPEPE0)}P QuP@ B^KPEPEB^KPEpPEB^KPE pPE 0` 2B^K PER$0#0pPEB^K0PE`8 pPE 082B^KPEl!lgB^KPEPE "B^KPEPEo 0P   0P B^KPE@PE+ 0 )*@)*@u`0P l)* 0P B^KPE~0KKpPE,0L+A$)* ]P0/S)*B^KPE0PE 0B^KPEPE0 30 S Sh8`8  p S \Sd80#pd8 h Y`00`8 'DXu$4#d̼@c 0S 0O -LM䡟䁟p@`P\P 1 R0P0 PV(L X ȼ ؼ #U` 00``` 00c R*@P000  V[U(K8P/ P(0PS  b R0@00S(x0₟P\P L0 R0P0 P0 `봼L -1LM  0((0 $ (0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `V00 p- LM0`S0C0Px0U  Q@@T0 AQ 0p( P@ 0<0 p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00plj@(0  0P 00p 0-8 P0@0L f @=00 -LM0@=C0 0 ∞] -LtM 0S00cS0P@$ T P0 0@TKLPx0: SH K 0S 0X S `0S X ,'P 0@@0 0-LpMP0@S|0lS`t0 TK  P|0: S\0 0 00 -LMp@:``OPP :-`PP%-P@ 0T\S T 00U0L0 R T?u-@r Dp P0-L@ P@(T 廝T0嶝ꀼ p-LtM@PHr08`KP0: S`0 0 0p逼 0-L@D' P(,0P0h+ܾ -LM0S L " 0@QOK08"G/r00 K(h@*&#&a    @ 0@S P@1PSg@0S P@1PSXgX7 0P<&8 /(0$00,Pw'00  A6 ! P PP @0 @*0SAƟ@P0PP @ *|o&`'0@/SP@ P P60S0@6T  'q@$V&F(R& '0USqUe%5Q00>&0@ 0S 0PP PT5P` `$PP,00S"P@T $@@45p 0= -ZPK㱅P2: Sx 0`@S@` 0hDSk4$02 e0L0  T$P0``P 0SO 0S<@T 0,33 R$P PUY00 0S3  000%&P %&@ R  0X 0@T<- 0$U 0S YPs @$@$  $ 0 00 g$2kp00  P P 0m 0T1X1pSP00] 1SPCp@pTW&#\+P &0S 0S0S p!0SmKPKP!$2R! 2RTM+Pq spPppmp0 @=+P`@\<P IPG@0`   7̼4м@س (4#<d @ $8L -TL$  @0 <0R4S0 h*%0;Pd -L$M< @ D0  00, 8  PH s @ R1@000  000  040 1Y]P@. ,P,0 00S X00 4 0 0DS( @ ( @ 4 ` ` @ 1D R&0 R  @0S 0 @000 <00P4, ,0H 8 ,@ ,%,0@ L00S 00 40X -,0LM@@@h -LM, 0 ,0#$ 0S 04 80  00S2 < @ <0S2  2\P@) 0@S񟗙X X L X L L <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,0< R0S, , $0$000$0<0SR,HP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0$  D$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 =:,LCy@  0 ` ,ꌼd P0-L@ 0S PP0 R @P 0S| l l l l l [T 000%0S TT ꌼLL -P`LpG&P@pP P00 Q @ -haLPp0S  0R7" \ @0 R@BT0S80S W` p0  h$`V#0 R!0 P0@CTT WU@ bh0 P\ :0P$ LD p-LMl`PU \ @0 @Rڋ~ T Ә0 0PU 00p -(0LM@T @T -,@LM0 01hc P0-L@ (P 0R @T0b( -LM/@P@r+(P0 0P0س -LM0P0@cSZ bSZ w `K 8 0pR R +  0R `V  $40"WĂ d,(0 ("4S q`Pq ; H d  L 0-L@ᅣPP0X P!L- X 00Q0ڰ000Q0  QL -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$hL -H`0DpL0f@Pi00f&iP@  p-PLM`0P l@h@P E'0p 0Q0-@PLU0 00hЂ0 p-LM0`S0 00@ 0PSPf0P00p p-LM<`P@1S@$Tp'Pp 0-LM@4P,,P$ 0 0錼,| -PLNMP! p0PH1 `AT P$UHR?K olQ?K-KAQH1`PH TP@<`0S 1<SP$U( 4 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 0'< -qLMPP0` 9 PP. P, 0S0P00S R 0V0U00S00 U 0HS0 0Q$`k @K$ kP0 _V 0000`QR nꌼ(d -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  ~0  goU<PP@ 2 V 21   N<V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S O$0S LP0S D1@S @1S``!T RDD L!T'D1 S 1 SD  0S0#0@0-S /P 0-S 0唐 @6@( E%jl@0* P<%|jLT@0@S 00$T000 HH\`0 Pl 0-LM@P KZ0 S  P00 Q0 Sp 0 0-L@PP 0R -LDM耟0QP`@$0 P$0 S $j0pjUP!P0dP@UdpK  $P40ٔp 0e't -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |e$P X pX Y X R0!S@ R0]S@ -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  "P``Fv1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  P" 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh "Pc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P 0?$00P000:S00P 0T HD0L0-SX^U0 00 LTt: 0-LP0 S@5 0  0S0h}0S 0\@ 'Se U 0S C  0  00SU0<0h\4XPUP0L`} -LMh4 4  , 00 @a4q8 cPPP@cTX` U`V`P40cbp0S0W<0 ^ ~,@\8   00@T pWP8o\, 4 0, T < 0 -QLM@ XOPp `PP*PU e*0S GO0S0@e PdUp:0h0 -L`p PPZ =0#S90@P2@ -LM @,rP 00  rP00 p-@LMTP` ᨽTP pU eP0  ⣐P00⾐0[` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ c 0 SP/R/00040 Ae @0 bRP c8 R00 4+e0 cR@P ,c,  P0 S/R/000.S0S/S  8 0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` dP0 Ulp BcT X0T L0h鰏P劏0P@@< -LM@d|0     V00 K 0  P 0P/0000 `W -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /P`dU VO V> 0/ c 0 0c RPBNK ` P@Db@D` aP0`(K P/R P PP X@,0 S ,N0S 0.S0.S U0u/S U0.Sc`0/S ' -LM@p|0`ᫎ00 0,0< (p0P UP@20 P00S 0`` S`` og opmtW@,嵎 -PLM`lp@82 T& V`0 0,0$ (` p ` P oꘀ[Dx0\<00@0P oP PP PPPP -pPLM`l@*$ T P (0S0W< 00$  `  bo\c YoP P PPpPPP -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@P៍kpl☍@ 0- 0PSL@FP qsPP0 , 0,屍 0- 0PSL@ +P Vs 0P 0 P0 0-0L@P  0S0 0  00 0,~ 0- L @ 0  0 0S[ :Q0a0 /Ib0 P0    0h ꈴ$0 0  -@L P 0 Sw p   0:0@ #  = S , @0  d0d@0 0 90   0p``V  Pp``V@ 90 000S@ ;0 0W$ 0  _000@$00@( -LM @   0S9 / &:0  P س0S0 0S0:00;0ij0 00$ 0:p  鰳$00 < -LMP `p* V# @T T@ _0 `d d0V0 pX f0;p @T |xPd -P Lp7 WpG2 @Tdp) @T!  8JP @0a@T@` _pW00 V dP  X@0x -LM @T 0S  0C 0 P 0S  0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S  p-LM @`A v" + 0`KS" PK  ㋇P P0S   ;0啲0 $0p  ꋲ$0 0\  R 0 B `0p   x P0-L@P ` 0h0 -LMP `pZ XS@T 0PI T@ ^0 0 d0 `dpV&p" VQ@ \\@`T`d  Pp@`TV  i^ 0 0f0 0S 0 ;0 00$ 0X  --LM 2 -p-PQ LP@4MH`KH 0 0  @p --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,@T 0DLS                                                                             @TYT A0DS 0@%0DSSk                                                              @ 0     0      0 ,   d  0   0 0 <0<00 <0 d0D,pK< S/ , , , ,  , , , , ,   , , , ,  , ,  Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< c]08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E C'4DXL 0-0@ LP0 SlPl0  R0S RR 010000 봼t -L!PP@`p 0S 0|R0P 0 T  0e@aP00|P뀙 -LPP`p 0S0@0 p0T d0T 0P <T2P^@X뀙 -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @ꀙ p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EPy뀙4d -LML0@S 80  Q 0P這 -LM$`Kp@H P 0b -(L P0 @`DA ZA@,@ 0 4 ,0@ @dDA HA@,@ 4 0  p -LP 0@S x0  V=QT 0SdH1@P U0`0?(0 VPp Z 000F@0@߂ P0P0 :00 0p0 p@Ȃ 0p P{  0 UL -LMq@⩂Q@0 0 R|a0$ ( 0P d1PH0S00?  P( 0\*,1  ( $ @`DA ♂A@ @ ( $ ;0P0 P@@T,($ 0`CQ 0\*@ $ `( |  w10 0 $ ( ⏂D;P00 ;`4 p-LMP`@@P`p -LMl@ll P 0S0S $l0 00 0 0 0- 1LM!1P@@ \ 3 )\0@S0  - P 0 S P0LSPKKK }PK 0t `PE\X K0P <@ 0 0b넙x$0HL@- 000x0x -@0LM@ 㛁  @      -4404 LM,@0 xt 0-0L R@0x SP 0c0SXPZ0S8 T0S$ NPꌼ$dl$P 0S $0<P 0S -LMPR0@SD2Q00@A2p Q`z T1s Tp Te T_ TY 0DSLTEQ;1  0BS51R1Ep`0T0 W P@0T*0p0@1@` DA A000 000P0 pP P0`p V P 0P`)Q``(Q``P H0`PL0Q``,0 Rꀙ p-LM@0`S0@ %  R 00P0Q* 00p@t0 @dDA ⅀A000 000P00P 0 ꀙ -0Q0L0 7(0 0 0ꀙ0S  0S R   -PpL@T`01@T 1?A1cX0P`+ @ Tm6QU 0   @ T'0A0 S R 02SP00C0gfff -pLP` 0@01@PT  0R U0Q@5TP0 -LM0Sp@0< 8C80C01P`U  0R' V0aP6U0Sсd0T@~000 P@ 00 1S00C0PdP 00 0000CS 0 0P0 000CS0> p-LM0P80`P@ 0T S0 0 R@0P@fDA %01p h= -LMaQ @ Q1!0 dT Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< oLlp  P 00DS `O O O O P P T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P ,F  `0-0L@P^$,@0h'S^$!? -LP`p@ T q q ! -PLM@ 0T0   R0 0Q [R P@L-0S00 0\00 Q\0[S 0S0 [S ]SQL -LM@P0 0S00 -LM@P  0S 0=S   -1L M p< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 p0@` DA pA@,@ 0 4  pL@T   P000L@T0 4,0Q* 004 0X0@` DA pA@,@ 0 4 Q0<0  0 RE -LM@0 $P 0  -LM@ {P h -LM@@P:y z lz lz lz z Tz lz lz lz lz lz lz lz pz 0<00<00 b0 <00 <00S REyA0T <00< <040 0<0̙,$Й p-LtMPy@P 0{ t{ { { { | | ,| T| p| | | | | | } } BPtV00XpXop@ 42 p0<01@ "@`@0<0p0<0qyupqp0<00<0D!0<0дUpQQp<:0 ! P 0Ӫ0p p0  0 S0`P-0@/SOPKtP0: S`pL|o000<0qD0 b< @0<0kꌻ̙Й -LM@@P-\~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ @P000h錩t4old0 hh<@P o00hꌻ@ -LM` pC0 :0W0 PU 0SPU 0SU 0S  n@  0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@T0Sd 0  h -LMpP%0`KW1S} @1S\ -LM Q#pt`a0S  @T 0 S C@t 1 R Q 0T2 0T/ 0T! :PN N LHt @ XQ ;A 0  0 0  R X0 Q\@X# TK}됲̺( -|XL0@ SL ,  h t 8h0Sr P0^@0[P\ XpR 0ǟS7 S 00BS7 0GSWW0 iPX  h p7 R cQsQ CQ  P  700BPX h p 6 R6  00P0S P 6  B P00 P``V10@<&SL00@``0  6p@p P 0 Sx @ @0 @SB   5/T ` `  P{ p%0 0  R8% 01000C0E0 %0@00};10@S0 D0 0$0@0T0 $00v 0rp$0 0  R$LQl4h4   PY 0 $000 w($0  #0 00 B3  7 P00 PppWP  0P``V @T 3 DTS @ 0 0b 0  00 m@0P 0PV 3'QP  2H 2 RD 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0(" 0@$ 0 0 0 00  0R 0 @ꠡ괁1`V P q0@0  R`Fp1XV P q0@0  R`F PPEU q@L 0PE0`U 0 ` 0 0` 0? 0@T 0 R`@0 p0 l( 000_ꌲxHLԙ8(@cH*̺<יP p-|0LM@`@P|\\0P P0D D0< <0@#phꌲ84|x0P0 0 .PP  p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c p> 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT- $ $ $ $  $ $  ܎ $ $ ܎ $ $ $ $ $ $ $ $ $ $ $ $ pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c= 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l =0 0d c 00dR0c00P@$h@0S\0PpH0P0  c=0  A P̺x(8,040HL -LMPP`0  @P0 04? R 0LyS{L X   H              p        |                       L  `  $   `      D   h    $   X   8     ̝  @    D  L  P   |     ܠ -0S= R 0R0B00\=! R  04=" M  mP 000k ,000,0 P 0?PPPlNS|P%< OP@,00X @< T \,0S000@L0 , a0PPS 0 ؋P P 0S  0R B>@Q0 0cc i  p<00@Q@@@pp` <83i @;+;@@@;  :@G: +:*@@ *@8J0 0 @0S0C0)UP d:P*00ePc(j@ErP00 *, :ɟ9@@: @P9)i9@ HPPEU@T 9 0S0C0U X9<9<)0)0xY 4@0 Z9(8(XP HP0 0H0Sڈ8x(l8UPe0e, 00e0Th0 RV 0   QPc\' 00^P@0@%SP@c\Uy\ 0Pc\q7l'h7H7g0WSwS0 q@70  00S0GN q00  RcRP 0 @ P㭬PGUFN @P t r0 0  R= P; Q @P6L%5 0R00 Q q00  R PP ?P  0S0C03PPU0 Q q00  R ^^$ PUD! R r0 0  R PQ q0 0  R PP PUP @84$4$ 0#S0 00Ue3P_CcP  00 {CceP  eh#t3弣\#T3 0dcS000P PPEU eX 0Sg 2"2\ 0 0SXP0  Pֵ 000C] -2 R@ \2H"D2@@ 0Qp"`05X  ' U 1 R1! 0b0P0U1! 1P@;0 0P 0000AA 0S 01 !1 0QP`!0T00 R U@`p开P0 |0  0  R4 0P0Q 00 00CQ00P000x<|P@@H*`|&),HL(q00  R 0P0QP HX@ 000 59  0 0 0 00P'9 Pb 0P0 P00S@K -LP0Lp`tS񟗀괧 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ H X @ @ @ @ @ @  @ @ @  @ @ @ @ @ @ @ @ @ @  @ @ @ @ @ @ @ @ 4 @ @ @ @ @ @ @ @ @ @ @ @ @ 4 @ @  @ @ @ @ @ @ 4 @ @ @  @ @ 4 @ @ @ @ @ @ @ @ @ @ @ 4 @ @ L @ @ @ @ | R3 Q PP3 P@0P 0U0P`P 0U V P 0U0 P@ pHXWVPPUZP P FP00fP``aP@@P2,R@$0 PPWT R2 Q CR!0 0SgWP 1 PR!0 0SdlP 0CUx0 q00  RPlR !0 0SeRࠟؠ0 RZ 0PSTZR㬠0  RK QE 0PUP@hh0 sRD 0 0S3-0 PPPUPE%(DH* p-PLM@@lPl` R  XP0@D S<0 0S0C000pp`8x0(-n$0 Q 0t7@@([P(P)P{P]P}P 0-4@4P0L O70 0 0(ȲȺ, ,000 0 87(ȺȲ p-\`LM@cPc 70 0 p逼 0-@P L7 0 00h 0- P@Ld0hcꀼ -LtQM0l!d1d `1`@$K@` ```@ ``( 0 Q C$0 P0b!0 !0lq00 c`R 00CR@ 0@0C 0c0 c _8 [8 0 0bd 0C0\0T0T P0(,IJȺ p-QLM@PpR `0 Q 0Q 0  g6 000ppD`  0S0 cQ6 00 0( p-LM@`@P 0S d ;6 0 e0b 0p(p@-P @Q` L| T  0P 0 QL|VT @pppPZ(E-@A`0 P.`Fv+ Qp0 0  00  0P0 q00  R 0 PP0`Fvq00  R0 0 q00  R0 P(LH*@- AP0P+PEu( p@P$0 r0 0  RP 00 ` PJ 00 PPEuPJ0 0 |0 0 Q (H*LG-$P0 P1PEu. p`BP 0 r0 0  R 0LP0@ 0  P0 0@PPEu P0 0 q00  R (H*LA-@P0 P)PEu`p# r0 0  R0 P0T q00  R 0 PPPEu(H*0@-@0P%@Dt" PP J0 r0 0  RTP 0 r00 Q@ P@Dt0(H*E-Ԁ@ 00CP-@Dt* p`P 0 r0 0  R 0APXP P 0 q00  R @P@Dt(H* Q-LP@,0 Q()0P `V Ttp@N6 0P0C 0 T4 ,0P匩鄲($ -PLM @`; 00CQU5 0U@@A^S`00 PpXƥ`P@6 0P0C 0 4 00TU (P鄲(Ȳ -l0LM` `0@ 5T 2404 00 w w꼲 0-PT0P0L@@P8P 00` r00c00%IJ 0-pPL0 0S0R@@0 P0 0B0@ T( -LM̠0@ `T,@ Ppᨐ0 g?R,`,@ 0p0@ PT0 h?R0` 0 0 `?R`( -0LM P@0 s0 -L M0, p^P"0p @7 0^40U0 ^00S00,0 0 P 0W PPĄ^00 pW@0 0Ĵp02 0^U Ÿ000C,0 0W 0!^0  ^!00,0 0W000   0pW 00PPEu`p @ 0 PER` \0 S S v000u@p 0 00S  R+@S<@P0S 0 1v@000,0S o"0Q @>@h0 Ru M00 pW-00Ĵp k  0pWurꬲ( p-LM`@PT# 0dR 0@P0@pjv0S0C0 bvt 0S00Xv0S00<0 P bPHv0S00Ꜳ -PLMpA0S_ PWa$K@0 (K,K @yPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,03,0 {0S @TYP p300(Q 0pp (x|L@  -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @ yPs Ve `FVV80S940qv3`@M,03,0!0zP00SP 1T0 S/R  P4qy|1|!x1l1l!@@4@Pvy1UpU 4@ly0P PU48 1v4?y540P``pyx0 @ x00qQk D0@@ P[  00(@ x|L -L$MK0 K @KK @]xP@ ux6 0 RPPጼ -T0LM @R 8 TT^htt@@$t@ꌼ@0P00 ꤲ -Ltht -LM,@0(S]0000ꐲ -LMp@Pb`p !hp s1 @bTQl@0S.S p10  00SS ! \0 B2?@1cS@`F0S.S.Q WV$` p $K&P w0P00P p0  00S 00Aq'BQ`U@0Q qd00 @ 00S 0S T d%H*gfff -0L `~@(D -L7! -GML M<2 88@Pp`, $"hp fPp` iPp` 1 @bTQou1IKaAA⮦Pp4: S Tc;qBKHH+W P: L<10Y/S/00@Tt p/ᓉP`` 0SP :0/S$ V:0/S `FV:0/S`f10 SV0@T4 P  g/P40`FV:0/S 'd%X -LjM M(kKH0 H`p,0 ~GP;2Q 2<P2 R2 RV5P,0 S ,Y0S  |l6: S" KA AJGP L6: S ҇P $T6: S Y 1MK@D @DẇPnVuKEPKPaV;P KA AụP]NK@D @DL~F DA P@A1( K ! Q@10 `P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`A>;PRL 8'`|MTP (,'xx -0L$M@  H0 < !H@PPD@ <_@-!Pp BhPb0S| t -@T ]WP @@劆@P@@@ }a@D0SFP=V00LP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , /P@P @LN<ĆP0<E$@@$0-S @8L0S @0H@@ 0 R@"@0;0<lH0\0*P@q @H D ^@z`Mb$ -LM0 4 参P= ,K $p# ,00#4 |P ,K p ,0 #4 TT|弅|@0xx x0Ihᯅ@40(@4,8 ,06T`h` 0-,@,PL $ 㹥@( -LM@*P 0? 0-@L)PU '0S?000 -LM0@S h**p@-0PS00p-\@@T \ P`r00 P 0 R0ATapH* -LM0@SK P ) 00 -LM@08SK  "p 00  `?Xu 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  PP e -LI9  0-XPL0S S 0@ S0 00 -LOM\0X,0 0P S ,0 S ,,OKKK`VT UP W?K+yPW?K \!QH1SD1 L1@_0P S Tb818S <3 8'0T` -Lp`@T TT#6P0S! P T0  0S T *@T TT *88L -Lp`PU U @0S P U0 0 00b0bPU U `8L -L MP`p@T T T TT T$KPKP@ (KFP; 0D S 8 $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S ( Y*PppýR*PppK*F*pPp@*PppӤ9*p p-LM^`P0S p.T@0S 0S uP0S  p-LM``@0S pP0S {@0S t 0-@LP|UTp0 \0@ R0S<6PPTp -@L8Mp` M\l2` N\X2@ L"ibp5&LKTpK`H P K0T L` )P@P00P0 &PP7 P +0H P0 T @@)P |<<K *P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \wC0[SD[0 CR 0R P 00xSlP0 pW@X D00CS00  ä0 Spx((` -0L @( p-0LAM @P` ap sP` /0 @bTQ!P a+PpGOKPP V:~.PP<'(d% -0L ˡ@( -LMnQ@0,T  hf}00000 0 000  -LM0p (0 PP@/UoKK/PKU  S?K\ $0SKK,L1 H1 D1 @1 <1 81 41 01 *,K-L0* R;(0 S (奡'(8 -LaMb>K0C 0Cp( @ᮟPv$6: Sg  S*PW(0 S (y/PBnK`F`F|!|1A*0S*@aDPP$[NK@D@D  P5;2W>C R0 RW W ;庀|0S N*@PPW d妀BnK`F`F+5Q0)0KW '@XedAd` -LM@KX C0s aaaT0:at -SL Mp@PH|00!1/P`!  ?Vx 0|0S@ 0P P* (W@|?00 \@a` X0Px P* W@|?00T -LM@ K K 0K @@8'P -LM8 < @ P`pm 4KP@h 4 0R SB k$P`Z 4 (40@##P0PS ,KL ~PP 0 P@ U10  iPP 00S0 KP 0 R ;;S SPP 8P GPP 0< @0T ;PPV @$ -ML M0$ , p( P`:F{?000!c1 ,0S ,ϟAP@ PP 0  9P #{0S08{0S !07BKHH F\'0@COfPP- o0@S" 0S 0S+ 00LH \ 0$ 0:z?000, 0e$'$H$ -L`S$Mp0K,  Qq00  Rp0+S-S-S +S 0+S-S QLq430  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/^z "00Z Uz 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PU*z"00 pL1  0P81@@K1`E% 80 ,,8 2p0@0KX0 4 W$0K J40K5 B"0@Z$$ `JPU *0 K0 P00KU:@ K00K ,@ }V`-V`H*8 )@  -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sy"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0 0d|8^,Q@00 K00cPE: UcU pP/gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PPPڌ@PEUp pT00  0<0S000PC r0 0  RH*x  -LMp`#0P@ r _\P \0 P@  -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 Px 0 P0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 g? -L Mp`@P@ <K4K0H0S񟗦 ( H h X    8  | 4 X   H    | h  l     H  \ ! 0" " h# P$ %                                                            ( H h X    8  | 4 X   H    | h  l     H  \ ! 0" " h# P$ % 8D3#cX Q0@ 0 KD0  DK5P0S s!000PKp Hs!00CP3L#cX Q0@ 0 KD0  DKP0S s!00 Hs!002cX" 00D0 ?0PKQ@  DKP0S s!00h kHs!00ŸH2D"cX 0QD0 @ 0 KH0S DKPfs"00bs"0020K00!1cX! 0QD0 @ >0PKA0S DKPpBs"00l>s"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLs"00Hs"00D00K000 0cX @ 0Q@D0 00K DK\P,r"00(r"00$G(( 08@X`hphx0* @@0D cX 0QD0 @ <O0 KX@0S DKPx0 R r!00 Gr!000_00KP0 cX 0QD0 @ O0 KA0S DKP01 R r!00l mGr!00x1100KQ1!cX 0QD0 @ kO0 KA0S DKP1 R ^r!00 ?GUr!000200KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R 0r!00Z G'r!00Q200KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R r!00, Fq!00#300KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R q!00 Fq!002y00KR2"cX 0QD0 @ 0 K0S DKPq"00q"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R q!00 cFyq!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R Uq!00 6FLq"00v000KP0 cX 0QD0 @ 0 K@0S DKPY0 R 'q!00QL Fq!00HD000K,@HPh0* ?G?PJX @@$8XU*P*UP0Pb+@7X H Hb a@@7&41D XrXP P !X'8,Ƞ HXAUX @@ L *P*UP0Pb  @L 8#8HT*@*T@0pbV#3T< 8 @@K00`K0|T*T"4 0 0 0sH0 @PWU:Up@ 4Qe @ 8p < @0KP]HPH Pe@ 65L725|$8 T0 DP P P TPH%X @'8XTP l@ *@*XI20bPPPT 8#8XU*P@*U@2P0Pb 8#&Ƞ ( Ȍ"!Ȭ\@ 00^00S 0^4@T H D@@`Q p6247r<0 8p @PK`4`T#3w`l 66+*'* p-PLMP 0S 1. @ p0 CR 0S/S- R0/S  BR0/SR  BR0/S 0e` V*p@ 700d@?008 /P0.(@00 BR0/S 1 xB 02 #4xB 024=> 0&v@-O@d4xB 02d @-M0Ѝ@4=> 0Q k9, -L MQ@0K00#  0 d0T0P00S00#0 -LM K K![P -LM K K!OP -L 0KM#M( -@@L0MP0  0 L0  00S00 K( K P(&d00 -LM`Rp @t%  P`F @pT`P0AS3 Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á?P R-LP`@p0V  :00@@@@@@ 0@-@TP Ž0P000 -LMp0 S P%0`0! @! V@2CP0@KPUN 0 S  岇'<0S 00Q -0S 0  0\\00 PL L L L M M M M $M ,M 4M KC/JK X1 0Q ,Q J _?K A xA D0 bKd1 t DQ c 0S Sp'` QQ *vv * -LMP -LMl"  2 ,  " !H p^0P2 0 PP 0Sx P P 0S ]$481!`)!\0`X0 `{0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ   51  /1 OK @D'1 ~P-?(K R!  ~0S 1?(K R2S "RK K \Z0 40  MK0iPMK@ P+ 1MK6 P[4  b [0S [& L* 41`[LD 0 h[0#S [ ߹ R@]K 0@,"|@B"2@@&P 0S"2P'T"@5(X`h.Xu$T 40 -L,Mp`@ KD0K< 8 @ 4 0 , ( $ PDP@  0`4PP @TD哦D另  -LMp@P `p08K8 (P , 4` p7K0 8K (0S ('L -MLM Z,   4 `a V $ 0P@Q ,X1X1 - &Pp' B^KPEPE0$!O@~`~V INK@D@DP 4: S  R 0 0 ,0S ,QPt $R 0R\ 4 L 8孪`' Xd| -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $ '  -LEM@pKK, 4! bK081 P@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S RPPUb ?? UP[|,0 S t,J~0S @S 1P K?K,`0S @S K?K|,0SP @S  4.P`8~ 81S  K?Kd, 4t8 0SP @S 8~ 81S  K?KL, 4\8 'H*) -LM8KKPp <, PP `P@ ,0 S ,}P/K%>KH D LB @B KH L @B 0S I "00V:`P@ `8%0==0` 0 @ a0AS"괴 ̴ @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖Ե $ $ ȵ $ Ը ܸ IPI< @\  @ R  @0<@0 X V:H   ₑ H P@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H ]P@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 BP@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H P@  j 0`@C80@ =`< R V:H0 0qH0 P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 G 0@'͌@ G H*@-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!!E* --LM p-P0LM@`P8 4ST   hk@( m - 0p@L` GPP0S @TP1@ -L 0Sp 0-0@SPL(( 00 00 0-0PS@LPP PP0P -LM0`Sp (KmPP (QC 0#S@ S> 0 S RA(  #P0e(0 (P@} ( (0PP2P@ P0 S S0 S S #P0P0,K /,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @P@ >PP 000  b*F0@N%F0@00P0#P 0V0 -L>0S|\\*;;* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @  -p`LFPP ዐP @P აP 0S0S  0-@P@0LS00z$ 0000ᩓ(H -LM(@0S0 00( -LM0St (K Q@`Tg ( 0 S RL0L(  S *(0#` @Rq PU`@0S0T`ÅᾔPP `0 S S0 S S ᯔP@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\傔PP 00PP@Ņ,,ےP(,0@H@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0LH*k*AϠg* -PLM@` RB00P,K0K 0, ( PPp VT000Pp  0 PP|p  ᗪ B0@B@* 0-! L0TT!P@BT @@ T 0A0 0 -LMp`P@匀T ;0S0d0 @ȥX00U@ <:%("A! -LM@(@T0 @!   B00! RA R0000000000000000Z* * --LM -L@`plA`0 XXP哟T  8]8 $0W᪟  傟e@( mt:ܾ 0-LMP@ 00"0 ?0-1pQ LR@` 0S ?P @@ ᘩZ0@< 剭0v000S@@5 ?0-1pQ LR@` 0S P @@ dZ0@< U0 000S@  @5 0-LM 0xr.0l@hPTX0 RP 0 PP@ 0LD$ H p-LM@hP`\ 0 @4zTp`0@ RD\ 0-@LP 00c,@r.0 ] 0hLD$  -rSLM"0@P` :g@p 0P \@0pW@ p-LM@hP`,M \0 @4"Tp`0@ RmD\ 0-@LP 00 ,@r.0  0hLD$  -rSLM"0@P` :@p 0P @0p? p-LM\@0PSP`PP 4@0PPPpPpHdX` 0-LP(P0@P @0D\ p-LMDP0@S8`p$0P@@@Hd` -@LMhD -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KB\d QR dPPBDBPP XK X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,cUT@PPh@T P@K0h LK@{Ph Uh  LpLP Lyh00fs`V tCDK0\HK P@KLK @ϙPULD0LP 0H3LK2 P@K@P`ᮌP: h0S@- h@ )R ɌP  T P@ 00CS0 0Ӥ0 P p 0+S:P P P ]P TKA\ d0@RSA00Vh PDP \QP!00 DQ0SG d0S7 ,0d LKP@K@ȘPPP LLL/P0T@KPT AAAPP d@T XKX 0SpR`@@K` `0ᒪH0 P'`hdldlH@5|]]*p*IϠ$ * -LMğ !  \ ,    !4@R@ `h4@K K 0  K K,K  K K K K KV0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0pCⅠK  D`PP.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00^=L0@X XKK, PGK EK AK =K 9K 5K 1K -K )K %V0S :=x!,>l0S3 0CS/=u@41 ,0S 4,a KOp=0S   WK{P7KXKL00L0 60[S0X K60K#:<00Hp`< 0'P H*)|&l 0p0 -L0Mp0P 0 `@ LKL@KD00D0 Q Q <00 0 S 8 'a, eQ' t,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0dd*KK **%*%oo* *R0S 0S0S0  R00 -MLM00  0PP `^@T T 0T,S 0S ,P   0PU  0PP  0PPP p-LMP0 S0 `@0 P P0Sa0X S0L@0Sp00P M J!!X  -L M̀0`Sp(` +P@# P\  0үP x$ K10P(K,{P ( 80  $!X \!L@-0S@ @ 0 0 0 ! -LMha ^( @Pp$ < 0傯PD ( K100P= (P8U00T00S*0U0T00SW ᶀP` "P 0 $@J$ 02P $ 03$KzX \ --L 0-<0@ PL,,ˊT 喙 0h@ m( 0-0L@P 0SP0 CR 0P0 00R Pk, 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``zfp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' ,p"00@40S\00pgS \,00E0XSxS@`PH* -PL4MPL p` 0 S@P X 0 S @P L0@KEP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\)H*{} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 uH* -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h mrP & P0S1*8  `rP+ 8000H*$, -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi qP0S PP PP  000   PP0S &0PSH*! -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , pP0 R 0SH"px0   0 R PX 00p , 00  RP H*)|& p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4 H* p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00SiLKTKTKTKLLLLLKKxLLLLLLLLL` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S \  -LM P p0 0@W` 1R V[@0S P0 Q0S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ P@ 0^?>1  ^0C0@dP@ 0@04p@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p~0 00R0ePU@  P g i& 0S  Pi- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 0S @ 00h 0-0P0@L 0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0BP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<Ph eE -LuMp0 (, 1 P`_ PPQ 0@p1 0$P}K@{K 0oK. ̡ ȑ q uKU#P! 1@p@P oK 00 ,0S ,jD 0ɳ10SD0 <嶳 0孳'H%4(DP0\% -LbMȠ0JK(0 jp! @)@Kp~Z_K`Pl0 \ TjKjK11 P 0L(0 S (D'\%d -$0L!00  -LMp 0:S "0 R00 02"00 R2 0:S 00 S0!d2 l2d"X2Q  ,0:S D<",@0:S:?0 "0 0 R00 S0101! Q , 0:S !,@0 ,0 0@|-TT0 R, H1 R , 0:S 4$1?@0 R0000Sg0S4@0 0q0  0 0 a0b0000d@h d0qTP0 @P0s0`@aPx%d% t%p%l%T`%h%H -LM 0c -L M@@Y -L M@@O*tt**PP***33* P-L h/00 -PL`0\p \=|# 0 0  R3 @  h P1@rT%0\ \|h3  00SWpG3 /\00\0S@.\ \|3  00Sr0 0/\@- \ V t0j T ڊ>j1!W pG T S(00 0S @S@S@@@0j!T@QQ10  00S V؁P@ ᐃh P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ :dP`a\ h000X0 WpGk 0002XpGHH*x) -LM0  xl( -L M@ 0@x\( (RR*ZZ* -QLM  0K  0   0-LP@Gp PKp U T 0\ hpP UZ@c{{P*L* -LM@`p(PP< 0@0@@@@@@@@@0$` $0 P tP@5 mP, 03`P1ZY(ʐ \P ` 03$0 Y  < P$00$0e  `0S $ )@TD0 003$  3S03Z`` 0SV,0`@,@ ,@ 00|0 0T$ -LM( Dp$ ` V/UPP P P:@ F(@00 00 0S p-LMP`P 3@S0S0@B3S=P(P#5$0 #10#0V@@T(0p#B0`KP`$05` -@LT` $0* 0QP3 Q# R 0PU@G 3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` P3ա 03š0 #0$0@P$0 :.$0P3s7 0$ @Q$0@ 0 S003P $0 :P3 $0p P  0@@$0 @2 ui @@_Q $@ 0 0R 3 P0 3L00 P  *PP$0   30P0K0 8PJ3 03 PU 0  PU:$000# 0B8S 3S  $0H 'P3ԡ 03ġ0 #0 $H R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h ϶Pp P6600$ -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z :PP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DTܿ0{ 40$0:$0?00puP  W $0 P T 0phTP0S 4 03$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 03`00 <0 |@X400420#4 0 BH  L ,0S V4 #A400H -LpM$0@0PK@P0J 8P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`Pp` p b 0 0pP 00 -0LRP@` V P  0X @T` 0@T000(00巾PpPppꅾ -LM$0HPPp`=P@ 0 $ 0I00D @0(`0 -PLM@ @UT 0-00L@ :0S00b?0 00<0_PP 0S P, R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL00UP1S -LpM$`@P R KPp 0 0R, 0R p00V@@gp  PP -P@0$pSL$0  0` 嬽 媽0S᤽h=0S ' -LpMp㶳p`  KPP0: S 0 0 p# 87P@ (0 0P (PP 0 PުD0@000$P `p$PPP.7 O -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ Tѽ4 , d/ʽ  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPA?TPP\5 `@L  0%0DPc`H0S[`@0\ PP׾p -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  ώP   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|H* -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0gH* -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hH*G-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@PpP$ 0 0( 0 0, 00 000  4 ᥹ 0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$tqoTPPYe$c $d@L  0'0DP^dH0SVCA$?d@0\ PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|H* -LMp, 00 Q,(P4 0 8 0 Y50000AϠ0 P0P 4 < 0Y04 `_<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8塴0 4圴0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0XH* -LMp, 00 Q4(P4 0 8 0 YM00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< +P ,Y 0 8崳0 4寳0 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YH*G-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE117* -4L|MHK0 @K0PԤ1e/ ᐳ@ \ \ R *0S0\  \ 0|S :S 00hh$@``$@X: @PX0D0L K@X0pL0<P K @(0P0T K @00T0X K@,0X0@\ K40P\d K@p00, d0h K@80}p408 h0l K@<0sp6[>dp K@4kp7[0Ht K@4cp7[0,x K@4[p7[0| K@4Sp|00 K@P0Kp00 K@T0Cp0: K@0;p0,K: 0m 0Km 4Km. 0 XRxR @@00 :S0-LP 0:S0@0h@0- 0 Sn@S$ -LM K"ϚvtOO**$$* -LM0`=S`pPᏭ,KP@; U郭 P:0P00@S=S 0S=Sg! P,@\P 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC Q⍨P@ 0 0S Ϋ0 @0@, 0 p-L@`M@PKyP 0! 0S0 p 0-L M@ H0P (0 $ 00K K(0@  0  ,P ^P 0餍(( BBG*A``A*##=* 0-Lъ@@-@0S  S 0Sd@(*(*Q0 =L 09L$hh*$%%* -LM< 08 rSwS@T 00  ㆧ, ,0SZ 4K>PTpPH P < 0rS <0ѕ@4D,0@, P,00,  4忕@00@T 0+@T< 0rS 0"4P 80M㩛 40@4T 40,e,aس -LM☀@`T 0S `@TT $pK pP]0S V00003u$ -0-LMP0 S@   R1 00 cQ  R!,0 , 0S "0'  -0-LMP0 S@   R1 00 cQ  R!  0S "0'  -0-LMP0 S@   R1 00 cQ  R! 0S L"0'  -0L 崷 -BMLMh#0P,0 0L4  0S 00,3 ,0S ,#"/ePL$H$ K˩2P@@000 cBK J JH eMK@DPpP 0Sr`0CK0A S A P2D4 H2@ K0C0C0  A  ;100C=S񟗗0 S  1S!00 c0؏ pC0L4 dꉪPnL$R 060S3/' $  س@-@^  0 S SS00N0 --L i(( 0-LM@Pe0S 0g0S e0S  e\ 0 @@Pl| -LM@`PeP pW哦W0S `U @YT :0S #000@0PTP:@T TW̤PP  㖩 0 ( -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`YT < h000 Z phY@ m(t:ܾP 0000ӑ|& p-LM(0`S/ F   P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ uv0 0 -L s* -2MLM#0@,0 ]0/S  P BKAA + cp Y W3*WY 0P/S00@83 ,0S $,/ cP<P"P@aTnK`F`F l0Z0pd  ئ 0 S/R  Rm/0 0 x2(K RW\cP LcP@ Y 0C/0h@+@Y!PBKAAݾP@L<: S< S0< ?nK`F`F!ݥPP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +Y Pp* +cp?00^ 0@C/Z0@h>00SZ I, D\+b>00S8 B>K0C0C+< b!', $H p-Q00P00LMSP@`P 0s p&p[P@`;00p 0S S5* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0ꁍP %T 0S 0S0 0C` 8,0 S |,ccP 8P@pzT|DLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLXXXXXXXXXXLLLLLLLLLLlLLLLLdLLpLLLLLLLL<LLLLLLLLLpLLt L(LL<Lxiz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 ʲP MTZ  @ T *000噌P d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `\P T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 2P XZ @&43@4 0qL9  00S 0Z0C0   0S P 8#0d` 08# 0\0q8  0 0S0Z0C @0 SP x8JZ!3Kg @+0DMSa00DDDDDDD\\||||||||||||<3S<  @00CS0000TZ I@XXTxT@ ;6 3K<# -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#Hv3.KXXo"P  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SF,88@00CS0000?Z  /@xeTET& 3NK0d@3K2s =K43@ 4C  43 43 K83083 43@84# 4# @x3KXx3.KXgP    9 S9UP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@o'H*8 & @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ 5000zP`dp@V % 0 f0 0  f -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K &0KP@@K 貊<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N@"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`IH* -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 ֌@K !@@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S }p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `H* -LM0 @0pP `冀GPP @ በ00@P0  ӜPP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0aP0000G% 0-P@LT a DA0DSR0D@TP0 \(\P.T.Q0p  -EMLM@H$ 0r/, d'H4 YL h Pl4 Y 7 ,0S ,!4 $pǟ8(<,"(S\$ D ` 0 l 8PpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:6 D 0 l 8Pp\DDPV `V)* :` VX !*:`V H*9`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$HtD4@ cTH*[D4 0D$ YYX^ X Y^ X P k@@ c@t X`@t0%<H$G Y[ XY d^`` D|?PC3 WX^. `P! D4 0b3 Rd%D "d %o*3TP:hQh fdT4  T4 Q`D40D4 D4 0D400D4 <K 㔞<0S80S40s@2 D4%WG9YDl*?P%D4H$D 0 l 7PpDdPdd ``QD4 "0 ,2P^D45p#04P 5wz D巟pCNK@D@D 0^7Pp;Pdd សD4 cPdp `d OZD$pl$ 0D4 P1PP*CNK@D<@D 007PpPd$ d$ D4P0P jD4 00D4 cD4 cP`p ZD$p0D4 L0 D4< 0M,00H4 D400D4 OY'Dt l  X 8@  0-0L@r/tWP80s 0  0S 00ꀽ -L Mr/0P.k8p X X0c. 0YP  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn ,0[S6 `S@ 0fS+ "bS @TV0S 㗙P Ƞ 0/P 0L` ὙySX`{ ?Y,0[q0@T t1  0 D0S:R .R 0P.S  <P,Yh!hh1H @0 p@@81  :XPz0P.Sl  <Pp,X < 00 @p@0 0x@v+h0K ^/PP'\0 ]/00c0[ꀽDH*X  -BMLM3@0r/, 8 V7p XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn 2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,s~P< Ƞ@ <4-PP&@$< 02Pp Q<堘  ᵂ!0X0P 1 8$0  0 0 <傘ySX p  b0 X@tP. K`g0 , ![P@p PPUZ.0K gWpt00 0  0 @ [\`/00L00SS (  h'     0-8P@0LS((C?0@0t?& & 0-,PLP 0@T 0S@&& -L M0r/븢4 0S ,K >P@ ,0 S R@0@,  S*h G,0`` @#R #WWP`,@PP r` :P], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`\@PP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4+@PP @, :Pn4 0 ,  P H0 DDu>P Wꀽ&DX   -pL` 3P@ 0SA;P PP 9;P 0S t0 -pL `P P@ 0S 0S 0PD -鬁L0M 0嘡0 0` px1Z>*p?P@P7 P p90 S S0 S S ?P`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4U?P@ P4VP $0W`4DX -L(Mp젟0 S( P^;P 0@`8PK P@YP00,XΞ    t@@0p!lL0\S@0 !$ 0^A(&p)ppt)p p p0G-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝp0pippYppp -LM`0(K\p@P.  _($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ 8s& -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ oPᯕ@a 01S &&@-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P: p-@L$MaP2 ` 0( TX%X@ ph@ -LMp0@P 0 0`K 08#HT UPUP#08  0 S   m')H -BMLMr0D`K@P ,0 宓02S0$S aS@ l,0 S \, @0$S2P 0KY @ P TKDAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 ASTK ႔ tK @TK  T:m'X&tx)@(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000|E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` a|H0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z& -LM@t@ğ0 8`, 倏 .P 00 0S$S 00R5:0PK c c ] K P  F 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,@''! 0-PL@U !", 1#80!"$ 11PX 0h}0 -LDM@@ hKN p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆU*#Q*# -LqL0`SK @0 T P0S1 0@T 0R 000 00 @0S$0PP 0P 00S$ 0R @0S$ߊ$ۊ' Q-L@ 0Q`Q p 0R /0勊0 0 0R9P  0R0Q 0-L P@ T @ T0  R 00d0R0S 000 告P@ 0 p-LMD`0@S$ 0PS$pkh' -LM`0PSp"P@   ⶈ0ST000$GX0S 0SQ$:$6'O*Π0K* -LM0p@ LP ੉00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'4hhhthxhhhhDhhhhh4h0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 n0 SP:00*' -LMrt0p Rd0`V @@TJQ 0PES@TZ`xVxd*` 0-LtPM@KT 0K 0 %  @@Xp 0 S 00 0@0@' p-0LTMP`XK <@KhK0 0h0 K0XK< K0@0 dK`0 \0 d0 3NAHx'!"0 S0 R0 S0 R -LMP LL1R00 ^m@` 0@T1@0pT^ mP` 0@11 T!@ 0T p`PPCP_00 0@T0@Tlpk0@Pለ0SHp0TSCP00*''+"lB" -)MLP|M0pU K,0 $ P 0:S /S . CP PU  0:S0/S XhV G@D@@ T*BNK@D@D+B+8+8.BPP 4Pvyp@+ )K(JdJ'  *KݘP :K4S! K *K $(P2U ,`^ ^\K\P2P :KPP K0P0P@@T00<"  %# K *K0 K$ja0Qy T PXy @ T`@ T 0 0@Q_ T@T^ؕP` 0^- S@P0L00 SGT@ Tx 0@ T0 T5Q@]PX/ `0@T`P@T"^- KQ  0S 0@T @T^- KP 0S0@T @0LT 1 R@@@T4(K R K0j c@ KT$00 :K4@TXʈX KQPڠ3(K R4 @2T00 S00 X2> P 0SP @ß2D0  R P,0 S ,!1tPPP nP0\ S0 S3K0(AA 0LP2(K Rp" 0 02Sn-K( B B@0@T00Z,2( K0@T{KNPN 1@ T 1(K@T3K0(NN1 R @T1Sڄ1( K0T p \3KmK(N(`FN`F Q :K 0 K@$T0P Q0nK0(A^ A0 0nK^ 00(A :V^ ZtPU/@PTr P0'#@cHq+[[#$#H0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ$"*gfff$I -RLDM P\ ` N\0<S< \0@0cd0 0S TKP@ ?P00 `R <R `@ ~` @ bh 0S,S ;S XKP@ 0V0R00SD ;Q,Qv Qr@Q`PP001 R44 `b \\(0011 R\\̃ṣ01 3  RT0 0f   0R`c\Th3d Xa\3`T#L3,#<3  h0 Sh00 0 0 SM@ \>d h0^@ `>@<K^P@ 0,SPKUP@ @Td0X0T8"0,2`$"$2nK}"2`p@@@0< K {X0@P K uT00@0000@01 2` 1 !3`1X1XT! 102c2c3 S}00KSTwT0>CX0 @>`@ 0@>S`@nh  T0h 0c0h 0d U>\ f0@>S\ @ bd  du\@P0` ^!@d T 4#@#Q" -@LM $0S h{ " -L@08S 00Phd* -@LMWhT 0- LⷁP@< P0S=P2 PP%^@00 , =0h&l P 0:S H P 0 ,=00hP#* " -@LMh -L MR0S@(  \ 0S` 1 \[\0$ 1 l bH2A<a!/0C,b `11231113c\$0$000a$0 $Q01 Q$K P  (0S10&O@#/ 2!Nc10&O@#/ 2!NQ (0^& 0S@  RA 0@ 0S@A^M@0t (Kt 00=01(0\0!0^\ 0  A*Q"' p-T# 0ST Š ŖP@@TPZ@တK?0/0S0 P S@ ňK 0P0SÈ0S S UP@P0CS0 @0S0 Pʶ TKP4^C`0S@ @<<"\0@S1PQJ0 R @TJ4UZ0`S1PQQJ0pS KPE`V4UZ10 00n0  0S TK P` 40R00 ?\0#S a0 K P00:TKpPT;0 T0 _ JnPEDP0\  “2a1H`3a1R1R@0!^H PPKTK< RP lnQ"$"Y* -LMp@P`\ 0 u -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 ^8 8 8(0QBKL !80Q80@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <K@1$188 P 0S <@(Q< @XH KN18(1aH\ठ04(D8@X P @dUPP P_,8S 0 0`cR   Y* 0-4PL@}h  W@}00 0 I` 0 0C`@0  R J1 0Q R@Z* -LM@K$0c -L M@K$w0@K 0 `RA 0 `RS  0 `RS A -L,M0P,0 P0p А R0<@K0 ᨠh& }0` PP   0@T P`;00P@@T 00 ,0S 8,3W00'S#o#d3### -LM0H @0$|PH  hP -P`LV@|p0S  SP@D -``LMwPp !0@ `0`VQ0@JDX ({0P00SC/D|`VX@E_Z霊 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/ |0!( -LM:L@0cP0S @0cP0SP(:e2 -PLM\\`p@P0SpC/0p{PUX`EOZdd0 ̐$x -L0M0 @00 R/긟 (0<HĠРܠ ,8DP\ht0 (0 $ (K, K00Kiyp, 0 0K0}Pd 0 K0 (0 $ (K, K00KDyp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z M-L@M@ 0p`2vP{ 0 p`d(vPPk 0`0`KX0唱0S   00 R 4 40  1@ 0 (@\`$@TpPVw`8@ X0pX L H T` Pp l/XK.P* <0 0PS` 00.0 @d@  P0 0d Kg@@ 0000UuXu0 D0D a ,0$@(a 0000(~f(# M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0.nP0S0S 3`0K KP L 困 32a/@#b! $P pj `@? B7c011N0 d 0!T 0 L0L " D(/u<0684Eن:2(0)0)P 0-0PLr/8l4@0, ,lB@0S0逽hH -0PL4r/k0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S kPp 0@W0 0 R@ 0TP 0Pꀽ -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $, P'H& -AMLM,$p(. , "h  V, 4  P 0 ,0S ,P`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S'\& -LMH L p r/0, jH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢 p)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 厑P00D"PpPOK?K@DH2L42  p70 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑH*) -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ) -OMLM@ 0r/ , f05 - 0fUT U U U 0O`= K AAH !fp7 To!4oS* I>K0C 0C000S000@S0005\ =000@Q dY/0`00n0`A ` kP@ \ `Ppa  H D< (K OKAPPF $ R*EnK`F`Fd4@@ ;P@(K R  ;P&+(K0 S S %R0P S S \ \ \00\``V`@, 4 P`e  P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS}D PW *(PK0 S SQ\n0P S S \ \ \00\@@T\`, 6 * P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  xPx((@K0 S SrUUo 0 P S S \ \ PP P 0T r0 0  R  0SMKL LL@K '50  #N.K B0 B0C P0S  R4E}c4 R2% % P kecT ,d P&(@K0 S S U UP 1115  \ \ \ \ 0 SS} ;S`z 0 SL KP ;Q Qq6  0P NKJ J  FPE %4!@% h1 %P`3  Q;Q Qq00  RP 00  PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώhO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  APt P`#(K0 S SHY?P  E " GI`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D[PPV:00ٶP0:0 000,0 S <,q0 bPP ENK@D@D+P./P ,`2bP@ `p,(`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0Sw1S'h)( (b(((H*@5((J(((( -0LMP0r/c0pSD Y@ S S@0TP S S  P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S P  P0:0t P0; X P0; < P01ꀽ(H*` () )<4<("4 <1QS0 g 0-L@PP@]T0] 0-LM@ P K 0K  P @@_p0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S P0^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PPH* P-L \hB/00h -LMP@`T,`K,pK 4P 010jP VX`@TX ,K `0V0.T00S` X ) -$"L$M0P@ <K ,0 a0:Q]p0 Q-LpP@00S  R 1S01pW   R)`R@1@!  H\ 00d0 ^pW0 00 @f0d0 ]0 0@EP  X -p 0LP6]P`P @Q  P 0S Z P @TPD@ - L00S`H 0-0@SPL((_ 00 000 0-0PS@LZPPZ PP0jDP -LM0pS (K P@ (QD 0#SA S? 0 S RA(  #GP0d(0 (ZPP ( V](0`<`P@ `0 S S0 S S PP 00,K ,0S ?R0SP0("("48<#80 P R 00(oYP @ D `ePP 00U 0S  R00 RZP U 0S 000 ! BV P;PP YP@ 000  b`ꃰ0@7~0@0 P 0G00H H -L.0SHp 0-H0@SLP:0DUYP0HPD0 - LRPE $GP@ 0@`c` *f@ `PP j#D q\CP GP@ 0@pc`P D  X\0@0g0`D000`CP  00 p-0LMK`mGPP0 @T0|  NP 0 ıX0X $0, P0P (0 P@ 00p.GP555P6 -LM@ O0`00ᮯ00 -L|M@K\7 ( R / Z Z 00`PpQ 40 S :x4P$ ;0FP0K 0 p 0P @0P HX0000 0 0q PKRqP0: S 0P ;L 0Z KW0 v P0`00PUoSf <0PUo0S` 80P< paoPU`p60# V0 U   0 SR0e c00 P @0P W000 0 0jL00cPo  0 p 0p0P @0P W0p0pX 00 IuBPZ RW:0 g0 0qN0paPU`p 0 p`P }v7KpP2`0K0K dCZ BE " P0` 00PUoS <0PUoK  0p  0S 0aPo 0  p`P v j 050-@_0 0-\ @0S  S0S\ -L M, ,P0 `@ t00  R-T@ +T@VV0Tg V0T ``YqqMXcXYp XfphX t0 0Q0@Dt0 0Q2 t0 0Q7 DW D@T%^Y \ 00T00S  d ߭"00@\00T00SL, ͭ00S ^,00E 0XSxS@`PH* p-LM`K$P PP@ 0S 0S @TxU p陭00P 0Pp -LDM@@KD`KH @  0P < 0 8 4 , XP PpL T DVPP P0 XPD@0U*0S 0 @T:L 0 0S 1gAL  UPp  ZD\p 0pU 0` \`T0 @*0S 0 @T: V\ `FV0#0%H0% %:H00\U0 S2 S00T0  `T  0T0  \`VY `00p ` T ` HYT0S00pp0pP` p D :Y D `DpT R 0ST0S 0 P 00   X  `62` V`06` V  D `0S0V V p QX ZXp X pVp p 0SV X hUH@@aU0 S S#00T0  T0 S000T TL000pDL0 T R 0S7T0S   X p`6 ` V`6 ` V0S V PX0 0S V X WU p-LMPY@TP`0  eX0p M-L(MPP@0P HK0D0 Up` T LKP:L0P p`R 0S  0SH K1 0߫D0K!X p`PW UTv W Vw0"S꺫0"S0 -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K B0KP@@K @<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N-"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`IH* --LM 0  )0 ) ) ) -- L 0 -MLM@P, `T< p 4Q& #$0K$K0 S2|4 ,0S t,-铪X 0H$@W KHH 0($$4PP4 `W \ Q\ #0S0 0 #P PJ `0S ZJZ:00 00J žKIIR PK %R| T @D R@T<@ s 0P PJ >K 0CPcT RL K0 A ,P@)t W~ { 0  IP`K> @u>K 0C1Kc@@2AlA H D< L @L Kth07S  K A 0P@07S  0\KclA18 A 4< 0 < KmQ T00%Q00S  `@Dvr `W!X< PPD@`PeX  0곩 0  P PJ `81 K@@G 0| P PJ ` 1 K@@#@ ' )0 1,1@`>*41@1H1T1 -LM0@s g0000 -LtMp0|@ $0 " 0jP`KS  $0S $Vth KPK叀K \pPgP ~p +c|'|11 -PLM@R  ?  000 -LM@~g 0 0 0P0 -LMJ -LMp@`P0T@$K P,0 P00g Z@$ -L\M `\, l Pt 0%S U 000S,0 S ,B@zT7X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X57X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5X5778085L8 :T8p8X5X5X58X55X5X58888 :8@9L9d9X5X5X5X5X5X59<<999X5 :<<X5T<h<t<<<X5<X5<<==4=<=L===`FmƟtl 0RPgl0S\&1|T l0 S010l$ 0  tl 0l 0l5 Ϡl0BP lll@ N 0C`l R 0L0b0 B`l $ l0 0l(Pl 0S 4 l0S䟕1`|t 0lt 0PR l l Xl (t0Ϡp0 x 09x3a#`!1!1"I2Gq#1/2b11Q3b11Qdßp嬣` !,0/C!b ?@1c!bb1cA 0c0cs0 0^I^"XpGx3l#a1!1!2I"G 22`11R3`11R[[0a Ba4P P 0VS$ gS  _t 00  0 l0 S5l0S p4Ÿl  P1l l0cl1 l l0 S|ըŤldK8@KdK!0 :hl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1A'31lL33d<*3@3$I'3Qnm33 (Xu3x\3 -LMTp,@KP` 0    0S '3Q *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Q3d< -L M@KPT `0 -L"ɠ2l3c13@"c1MP 1K0  _G C -L^M⸠p`OKPC/MK@( h < 8 )SVat0V$KOK`?cKpG 0@FfKq q A A 1 (0S (+'3 -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @O$"(0K!48<#8 S*S 0H T H0L P J I@O  LOh@hA Hp\ 0L0p4Slgp PBNK@D@DhL!L1=Bp@) QpP,0#SEKEKALK 0 LAIP4 \ X T QX4P$0P ahPaap$RhPV0'4(4@)\<)44D4zx{(T4444 -LM` @0 0\ `0V -pp`@LTP W P `@T` 0V0000hK\ -LM$@0 S QK0ꀧ -LMPp`P@b ,K0,px!0p  P @\T`E,0S NNNNNN`ONN`ONNNNNNNN( 000,(0 $ p P@T` (pP0P (0L 0 (0 L 505D5`P5t5 -Lh\(P04|7 -L  hBܾ( -LM`TPpP 0 S S 0d f 0 0 @0$ U@5긵X7 -Lh(P05 --LM  -LM@$ vO0$0KQ \  0  K 1S015 -@LM z鄧 0-LBP|@ 0S L| 0SPeT 0S \00LS `0000O0 -LDM@ d JP dJP`} 0Sh 0S0J0@ @@`KoPKLpP dP00 H XP L T@ fXKP0SVJXJ _P0P0H0STTA 0@81H  uP TP0@ 0000p0d  N X%4 40II  `0X@\4 0000 00(@,4 00Ԡ00^ -RL4M`T  12l/A#b08KQ0 2KHKX PpK 0KNS@ᜟ0@K岃<04 8 c@0Rc=9H =  AH 0X H0bQc=9 @ =P P 0 0P/2a@#bQU@T/ ti0S (0$0 Tp P0$06  ( O0 $0T2[  C00? 00Mb -RLMp`P  tp@P`` U! 0$0(  p-LMP@@T$ < 0R P0`K( p   1.,0<,00S #>P@ ꄨ\) -80L0S ( < 0 鄨 0-L@P4  P@>00h_  ) 0-LP@P0  P 0S S1P 0h+0 0-L@P P 0S S 00h0S 0h  0-LM@P0S0P  \0G 0p) 0-0 0 0LS@P 00S 0S 0S  0S 0hP______000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ ))@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 I<4(<"4!<0  -LM0@SK C < 4 00WZ=P 0) |C( ; -LM@pP`~P  R 0S  RV  -LM0@S`pP7 S3 KP RpW :W =00<PU 00 e=PP 0 ,0(U dB C(  P  (0    -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*700B 0P0XR00S @( K @  0IZSx((((((((d(hx($444444444((((((((((|((((((((((((((((((((((((0((4$|( (((|.(K0S 0(K0  00A SP cX˟1  UPb #U0PB 00@ S $P7 2S"12 202 2 02 PP ` " " ] 0 0" 2Sd P ?KP f02 Pʟ,0 S D ,lb\ R \ 202 b  K).K?K b+ >(K *Y 00I SP 1UPi U0PB00I S$Y@2R SjK).K?K 6b 00A SP =ɟ0! UPc0U0PC00@ S $P 2S"12 2P202 0U@@B\ R \ 2PB  K).K?K P1UPi IU0PBF00I S$YR   p 2S"12 2`202 VZTB   00\0S㬀K Q. :Q  >`>(K VR  "202 @"PaUUژ&0 "2 0RPEK2 " pUT6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTc PfUU[E00@ "2 0RPEK2 " pFU0 "2 0R2 " p3ʬ" `` "2 0R2 " pNʬ" "2PcUUğ00 "2 0RPEK2 " p/Uʤ! "2 0R2 " ʴ"1Q0lQ g2S 0K 2 KP 0@ XKP PK KPKeYV K/ PPQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCU}UC00@ "2 0RPEK2 " pU0 "2 0^PK BKPKKPK"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 t1 0 2Q02  K4PCK/PK <AK&P5K20 "2 0R2 " p!ʸ0 0 20Q2  p K 0C0K@ "2 0KPKKPK'\* 8C*$ * 0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q^KPKPK \AKPKKPK2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0KEPTK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " PK ,$CKP%K00 " 2R0KPKPK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pxڠKPKqPK lDKPKa^ K00$0(0K0 "2 0R2 " LKPK4PK# % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 ?'0h0 %`PV P00 U- >(K Pu`  2"S 12 2`0" 2  2S12 2  Po " y2 "  2S 12 2 Po  d"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 6" ^   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2"SK1 2 2`0" 2  >(K t@ GYgYT@ 2S"1 -K2 2202 -KP K/ P- >(K ` -KP㔃2̌S 3KL -KK K2 +GYgY |\ggYEeeY"fY \  ``y?(K R- >(K \0l``\`T ` 0`L K N2 S``2 2 KS12 2  2@02 ʌ lQ  " O Q 2S12 2  2 g@ 2 KS P12 2 202 S  2 KS"P12 2 202 ?   2S"12 2 202 )  2S"12 22 /202 CCD2S 12 2 2  02LS1x2 2  P`" 0" 2 q2 0Y2S12 2"0X T "  !P`h`F8P`̌:@ Y K >(K`2S0 2 +KP % FK PK0S"\ 00z -LM4j @PK  4pK, 0 p 4K3K2K1K0K/K.K-K7 K 0KZP*ڸ0@%SP@D0p! @ 0BZSHH HHpHPPPPPPPPP`x 000C S`K1Q,0!cQ00C& 00B S$R 0X0  0Z|KK0̀ Q0  @Z0̀jKKꏉ 00^ 4 K^ 0f^00 f,0 S ,  *R 00B SF 00B SA000C S`"x1Q0!cQ00C 00B S$R0Ѐ Q0  @Z0ЀKK 0ş1 Pb0P0C 00B S$R0p  0X 0Z KKW 9  0X KKJ  0X KK? 0X KK4@ 0X0  ZKK$0X KK0X KK0pp  0X KK   0X KK  0X KK 0X KK@ 0X wKK0X nKK 0X cKK0X ZKK0hS0{@pH0lS0pC pA  0X BKK 0X 7KK@ 0X ,KK  0X !KK  0X KKt  0X KKi0X KK`0X KKW00X KKL0|RZ  p`0 5ppt  Pd0Q0SP P>P0{'\* C -LM0@p`PW10S 0 H5pP  g3\P  b5pD0 +5p ~p -LM @`PfT40 p ETeTpG/  P090 ,K0K0RgTGTp400  fT@ o P0@ 0 R*00SC 00 0:0 g 00S 0@8  P0h0-0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  儫'gfffD p-LMP4 0Ae10T0d1 P40 00p <00c1S1@0`g/@꘨ * -@LMT( 4  10Ah4阨 -PLM @ 0S@@ 0-@LP0 S0 0S0U 0 0@2 -`Lp@P8#8S"!"81 ("((^ XU 0V1`P`n !@ 2p -Lp B/ bR@P`0ڃ0RN V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@00@ -LMp`PW, `pP 00 R0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp3EQ ܀`V@" P @T `3@T 3Z@S0ph@3<?`@$2 0 1pq$* -LM0b 0PUp@ڂ U R0  R00@ d 040 Q2 :RP 0E0 0Q0: P!0 <01R\3# -L@PP`9 @P``p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@3 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@94Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :C -LDM< |0P|C00KHP L L  q0 0  RLL 0-S +SL0L0 0 SY 0S L`/RP T` p9RTW1000CT0 10W0`CLp /RL 9RRDp C @EReR@@ 30 0. L +RL @0 -R- 00B SL #0R! 10BSࠃ@ L0B0 /RL0 9R L@10 0C/RL@ 9RL@!0aPS^@ `@ W D @R lT@ D  T@WT0K ZD0KHL " VP@0 0 K0W`0 @@0jPU6 0K 0KPd MU4"000`0@KP X5\3d1`/h-<@TLH^ 0 K00KH*ND0*D||@??ER+ U@LT`@P 0K 0KU`,056C,0 0@K 0K, `0`V0V,00 56,0 ,0 0 PD T0H` l `0@K`0\  l! .4 K80KUX @d \ P48@ 0p!`n`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQdXd @XX@ VX>X X\\ U\2\ Wd,d \Xv0h 0d1 hdE/O P@sP/O ZP@p`p`AP/O p`,  3PT _ T0 S3.O 5P /O  Zp`p`0Kr0 0K0 0 K,0c`T0S X\dh< 0 ZP@00S,046S / P/ Pڷ/ P00K,00K56C,0 #0 0K0 h0 K,2"0S,056,0 2Y ,0 000 x~Z %N0p`h00S,046S 00S !N0!nX,0S"0 K]`0S"00cr/ P m/ KP@7N0Z1 ,0!46S! 00D Z0 K0@K0 0K0K- KP10@K0K0 0K%00s, 006,0 0 ,046S00S, 00C **0, 00 Z00S,046Shdh P5?55?5???|DDA8Pe ,0 K 00KP+ ERU`U@lt`@P 0K 0KU`ʄ10K0 K0 0 00K0K O P`0 o0K0 K 0 00K0@KM/O P0,` 00 !Pp@@T #Tg@0PeʔA0 K @ n@ l0K@A 0@Kd0Kx0K [0Ko@~E0 KL g00Kc/O !P@+/O  PWL UL 0RL L L L0W L0 60R- 10BSL0BPP QP U ETW! pT 1W`^WT p1Ѓ0T0 W1Ѓ`PL0 L0 00B SL@P 0RL@ 0B Q{L@0 0SL@ SQL H L E -LM, 0 0 S0 J 1P,  4 p*P8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LdM@K4 \ 80 ̳00 0 1#:@":SZ @K/ gP  @K00K, Kp ,:ც᪪Z K0K J$6E0ƄJ l KY/  .  W/ P@ R/ 0  p` P RPP 0RX0 P@K 5PP 0 BP X0 0j@SP`@ U@dB@SC<@ U<@ E` EQ`0 0@ d `0 40 S0S40 0C40 4@\ @Q#(P0X?aCoc?`(?yPD? DD PR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `x$hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hhT$` 0 Q 2RhF0P13P1 <2 4E-(0(   8%<*D*P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp@*D*8* p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD@*D*8* -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`pD* -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";@*Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0  D* -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 !-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00 L*T*P*X*! !TM0( 1S Ѝ0SM0D #2::S Ѝ046S0S Q0 R0 P0000S00 0-0LS@6 00S  R011( 0PS00 P @0P 0 00DP0000 0y0D0tPP+l 0 0 -LM00@S  R 1S01P 00 0 0 S 0-p1L @RU 0 P0#<2 %000S 0 $0P:0000 0@0 00 0P0P00Pl 0@0000 P @0P 0 P<0S0 8000镝& p-LM@ P$K, ,0K $0 (` ` P `#p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000P P*0P` 0PU:ZP 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^P], P \0 0e 0  R000P E  P0g0,0 j 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 00000: p-L M0K K@C 00p!`:PUhC 0 SP P000pP` 0 0 px p-LtM@PP`Kf,P0@: S  Q  SL  p( 40R p; 0p0+ 0 p5 -LM, PPpF0S@a@T 0 0S00 p@ 0S 0000 0E#10 0@S000,!0 0 Pp0S P '`d* -L M`CPP쀟0S6p@T 0S @S 0ST  P ` 0So`0 [p@ 0E#1, 0@S'`d* 0-LTPM@KT 0K  0  @@p -L4M4@0@K0 0 S 'hJ Nt,@ P-L 0 hgi 00h*2 p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`(R @0S R Mp-LM0`0 @`KJp p-0LM`KuPP $ "P@  R 00RP P0 0<0@0@ $0, 808 `(0  ph0 0P555P6 -LM@fPP/0:0 p-LMP `@0 : 0ph}=H -LM@?pP  0:0q0:0& -0LrS aS ph0 0 Ϡ0+S bS 00 0+S wS ̠  -pLpMW@` wyPPN 0X1A  <p  3"K(*P`O\ K 0SJWH  P`P5 Z QX0a0 100410$1$P@ 1!01 ! 01 !01  P0 g0`g`g`UZ&g`Z 0S 11 !A/|@}t AT O` 0R00CS  @0P0(P !D010CS1!N1 g`g00$:@\:?8@C`>h*apJ P0-PL @[0 -PLM0 0At 0jg00 -X1LtM@0 00 8p̠ 40$18p` DP @ V KP H hU P0S400S 10SQ l `0QQPg00B00S 0h* p-LMP@4KP+@0 H$0D @0`D 6R@D0C ,0P0320<00@(@&0 03S0php -L4!`yPpGP/eP W& 1PU@8PP@UPP p!%W0f0pywu1fpn10Cs1 1!0C1c10Cs1\zfp -QLMP @4P  P P0 \f0 0 -LBM`4P0 0  NKQ@pS0A/pp AP@18!0R@T,IP fO00f0,1apJ -LM@S0 h;f00,1 -LMSS@0  \h!e00,1e0 -LMR@ 0 he00,1e0 -LM4  4< 0 @ 80  0 \PpZ 0@00P`V R0b<0lP @`V0P$BAA$B 4 80nP00000@ < =P 0Q[pBB$BC@ 0S 800 0 c 000  80bP  yP 4 80*P  kR   R< @0P`p(Kp!   ,  0Pp @ P`~,p~ -LMSS`p@ S$!S00/ 0(1 !$! \Z (0 RP0 0P > (Q0S R$1 !0$1^ 0S J?P0S) 1S$ 0P000Q 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1Ś 0:P 0S( P0U(1( d0 0,1 -LM(0 p7b00VP(pVAv %P! @AP 1!0 1!( 0P1D!D, W00  ,0i -L`p@ PP   d P -0LM@ ,0( P00 0-@LPIP UQ0<P Q0!311Qc0@"c@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0P 00 `P@ $ PP    P@ 1S0C1H 00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0 AT  0:P @-0@0 @0!00 Q'  0R!TTTTTTTT 2 2 2 2 2 2 2 2Q 0S !0S: 0-PU@L P :^ PP * 0` 0 0 -LM@PU 0 0 000 0\0 p`-p  0P 0̲ -LM@PU 0 0 0000000000 0\0 p` p  0TP 00Ȳ 00̲ 00Ȳ -1LM@h p R 0#P' X R 0#P R8 Q5 0#P: 0#P  0#P* R 0#P*  R 0#P:R  0#5S  R 0#P:  R 0#P*P P0 0 S0 0#P:  R 0#P*l`dth p-0L,M P@ w 0< @8 p 040 0@ k 0,0 (P f \0`@K $ 0 ` 880 00AR`pd @IJp* 0-0L(M @RP#0 R0 < 6 |08 4 0 000 ,P + 0(0 $@ & @0 <K 0  X0p*|J@IJ -L$MSF`2 p< ` P0 0(6,& 0Q4 80 P8@r n x"4@0Th2@P,K8 PhP@P P@P @pWm,P X`pBU 0#V < F* 1Š P,P @,0p, ,0 R,00,00,P V0#03V00St 0 0 V( 4T!L   000 0V,P @` Vp,@ P@0Y:0 <@i 30,P UP0  V p8@ 0@`040@ 0 d"6h0< P@`0K p< 0p4Pg3^ 00<  \^< t*lph`d -#LTM0,0 ^3 p R`V V @TQ 0SN 匣p<0C>S񟗹`ta_tata`tatatata```ta`tatataataataatatatatataata atatatatatata(atatatata0a@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  B Z&fQ *6 p,K(2,  R 2Pi@0T1 *aP,0@ 0, PT1:0S QP,0 0, P11 0F0 Q 000S P!0S0 0 v P  , R0000@ 0f00   R,  0#P R,  0#PR 0#P L\0 0 0 ,0 `xt*`ldJ -LMp 6P`J 1PPW WK0p0@0@0001300` P1@P" @0d!ST 21 @!T &6 ` K?0 @ T@0 0@xQ 10 Q *02'70 p ``dlt0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0w &P`VP@@`@P3Ptt* - 1p LR@? 1`V=P0S3 T00Q00SJp t!* TyP0 RU 0 RUU00S  # X,[P 00T b\p*K -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K72,P UP2 2p\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 c0GP@ 0 ZR Z 10 % r P :#:S `5P PU,P ; @$ET P, UU` !@1SpWPU,P   @$ETP,p U0 00 SR0 :JR|0 R0P@   댲\K8Kp`dl\KxKKKK -0LMR@0 0 80 t R h:#:ST,K0[,@(< <00010 pPP,`,0`V,`   @$ET @`,` 00PVP" '1 S01p7@Pp,`,0`V,`   @$ET `,p 7 F RǟW0 0d aQ0  0 6 Y01 @0D0 6 R6 RvP 0<& 0Q@0 \600LP0D 0 ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@ThU -LM@\Pp` h^\QU0SD R 0S=W00  00CSꐆhȆȆȆȆȆȆȆȆԆ0 0pT00 1 0 0 ;00 0 0 R 0;S< W  4 DT 00?T 0, @- 0-LMPK 00%0 @( 0ST 0S @S 0ST 0S&TU  TU00 `x*100*2 $P@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10 -LMK@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR -LM`@ 0pP`30S  0Sb RCA 0\R! B Mp-LM0`0 @`u3p22**"*xx*JJ** -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b~ Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ )PD p <0 Px D0@ 00  0 ZH P L *P0<S`R0000 l , -@0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0PX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8( 40PoQ P0 00S"P@ 0S 0 00S 0P  Q p-LM40@SP`$ 000`!H 0 ,Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W + P@0P1p  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \NO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0Pjp  P NO0 0@0@0< J PpBJ@ @00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 "M001 "Md@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`SL -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h&}` -LAMp0P 0 NANK0AnK @D `FS@D `F) \0 0 ᇹAK A0A $4 ᙸ0s1 Q   0 pS $ q@'4c$M4M -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap R0 Rp8! ,5P8q8wp -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < 'X0` 0n0C 00,`0 0X00 00C8#Ƞ Pp@00 0E8X#X4  R 0("X0e8#h 80`0l0C0 , ` m8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h< `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00PU@BPT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 UU800C80 0 R -LMP`  a("H T p 0 ʲ0S T0 P  `Q0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0tP  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,OP   04p  0 S \1 0J0 00 0S0+P 张@`0 0S0P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0  =J0 0  pP!P Y 0(10S$1 0 ! 0S 0P  0P$1 0$1 0-LMP @p 1 00 -L M`@ A nQP, p'P"P 0 P 0, S 0  I0 0 0 0S0`P  0Pp -LMP<0 80K0 Kp `P@Q0, l0 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<PP< 0P -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6lessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknoddisknamesreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shsleepmvexprdmesghostnametxP<h@@L̉ =@@0cbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of input@LxX\dpx|userquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rs:cd9660%s: Filesystem not supported by kernelsession number is %s: %srealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] [-s offset] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-h and -i are incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %smsdos%s%s=%u, %s=%u%s%s=0%oshortnowin95direxecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfrsuvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix please@LxX\dpx|mount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/trackwarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track \d lpx    n,:  #3#$3,243<3D#L@T@v@\@dlt|  @@ (08@HPX`hpx  t(4<DLT@\@h@p@|    @@  C$CC$C ,8DPX`hpx  @@discarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.15 2007/07/31 03:03:12 ray Exp $Ffhnslinkit%s: disappeared%s and %s are identical (nothing done).%s/%susage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.118 2007/06/25 22:53:45 deraadt Exp $س\\# LH|.Ht\{sqO+PrreWŵ+9Jn^ٹHC`@N8 W׼Jڵ% gߜ]WzQZQѝۗ7ٛ#^fɌMvSg*[L4*sՔ7KcoN7yV>:.޽Nj>NȊo9MfȆtY_eU\e /_e%Wg,&;eQc*_eUutn)h|gYak?6*ElKh;F}pCpx #WYKchEdC|,RWpZx\x1YڏO;'҄~}9F^yxG9:@YvS}7E %fjG|hsA2wjk>߶$kuCcٛ["F>e^͠4~qFto` /Cgѩ~0DV{dj7u3rcy+^JfҬsv°0SxƭB%'+Sk~Ƃ(Rla׹yu;2@|նzJ-Qj0ۮ6!Slbs _`m ScO( LaO'vݫ-Im@o|oX`R}Z #0f!#fqM^gV}DAuDdQ?cW!_)ŽdmsFt4(76 z7(%M>Y#rMƒ~uiNLX cmIp&$LFo@2'LJ-?[Np*i&0nzcA1II~O{79\-Li}mRfav%W V!Y/{-^L:! 'p?7E݋:@ ؂EfKU /f234msUE^49,}}$ݑ2x+4p:VʽM杲^@- CӅH6֍yGڼ(NoH@\ⴑS QF -rŗ 1A@A?m \4S#VR~j4M_OM<85*d]{0ey4x;78q'~VrIbH2 `u vIm !5#K1fbÆ}8cvOlwLӌQ%Ȅ F -nw[dMt 0z&TXe05t-"g[РZmGÐI`ͤ<^Ae8^uUl)ЌmhuxJ8Y̭G B}+ dfmóy6k!K_Rؒs[!|npU úb)q"Aí\t:f2GTvSƥ@\FXiPM}G1˕#-gxin$Nh9d{p8{:6K"B i 1['q1w;U V^bN 2̙"!qTI1?ld>(Q |j D=? IrRf@'⁴XfVl6_eRf>ʉpL^` OѺ VWvXw1䝥>nuD5U*N|rB0(1b+1w۱!W0- ;`[ٺ]-np+/ۭMK,>FL <Ԕ[ 1KW7!g{r&oݺ g]L`?A&PGx `=oB.7? 8'nf- ͙c j91@5{~/>=^uq8F2,HC s'?,s_h: V_!6)kb^9C$ ?b zKe\I2nfsvdt%b!ɜ=#-K^G 4S80 g?!{S FTH]qJ2J=:BJl>I3E[N("Mdfe uډAS͈S4uaQ@tB/nA׵}b;q1'o&of hg0ʘ@QC`ON-5cʮ7RdwMW Q6Z___{+z|P-4}̥-/YȌ6t7i#FTH$"Pm5;LtM pЙΜb./6S:ꄱs~hs5]DmđH*x\[SоHv=2w.phrOQ V[5BsJ*UyvV=zbpeaXK.-8ATfag"+tw\û֘]}B\d<$ $K2f)ļ独: ' ApBa=LY-m"ğO-n%}Oo|]`F(r^}e۾*ٚv?9Cq5ynu n#$)Y9 ҄D&7X;#$I| *r$mU)fɧdo.E[-r7o\Kp'S bgA!x&mBϑH7TaT`9޲ %y w`)AUr/_$O⢹՚XM5"$cL\8gQ'I?ʈ4p=Y yiDz 3qz?C&\ :Sf(Fmz%pܶ7qPGƤ  ~L;]a̩O#Ԥ} IN䞹A)ƖyF8:.^=^ sDK.)iGh5;@s8P s! nڱ.U}UszIcP/- K^l{|")߇݅f;Vx,4JbbGDAd9c6FElE=Xl @;zbr-1>#K4O8!D i?Th1nP>iY`$6Fu5YP߁Ta jL8Ȕytز )-;vEKyF!OȪ1T6:ta];ښ"}U,W2JYS8{ԔobimAۡ==HleɎ>fx)DTTI]$jpxrHyZ$q?xNDi }bsʚl9yoށj0C\Xb\U'N%mwDg#_KŎCδ{@)S,8g.Ⴢf#XӪ+\Y]h0r*NȻf*߻ 8''i>Dp$2ؘd$ǣCQ9ߥi { NБeran$e;.˾L^l>SK+x.'hi%U8m|3O.>?}tpf4?0rn!d3!c'GԷP>hW!=Uzou|~6:GZj2Oxږ/^<q|,dzkV1S8KB&>.˖2(V(V''2tSp"UZyAKnf40gܶ @隊H/]KhgxbQOCq+eo"vKNqMhg ˯Z$hgqACp3̮`dkhpfS6b7Y/f&3D{ntqc]r )u]FaGie^0H&sy8W;%2  j̀^x > Tvבf#uǒ >MnNʩ6f%-Z\{Z.m@.$6pdzĕ LvՑ{ߞ8ųg?6wVPYadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgtioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)warning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:%srm#%hu:%sil#%hu:d%d#%up%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %15.*f%c %15.*f%c %7.7s%7d%19.19s# %s %5u %5u %4hu %5u %5u %4.4s %c: %16llu %16llu device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %16.16s %16.16s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %llu total sectors: %llu flags: vendor badsect # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cVISUALEDITOR/usr/bin/vi/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: warning, unknown filesystem type: %sline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: too few fieldsline %d: bad partition name: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lldwarning, partition %c: size 0, but offset %lldwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk.Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?editorunable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %llu sectors but there are only %llu free. Setting size to %llu. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.partition to deletePartition %c is currently %llu sectors in size (%llu free). new sizeSize of the partition. You may also say +/- amount for a relative change.Only %llu sectors free, you asked for %llu 'c' partition may not be larger than the disk Invalid entry partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%llu] Rounding to cylinder: %llu getuint%lldhas_overlap Error, partitions %c and %c overlap: # %13.13s %13.13s fstype [fsize bsize cpg] Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %llu sectors (only %llu sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk or a user geometry. It takes as an optional argument ``d'' or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [d|u] - use [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %llu, you tried to add a partition at %llu. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %llu, you tried to add a partition at %llu. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %llu sectors left The OpenBSD portion of the disk ends at sector %llu, you tried to add a partition ending at sector %llu. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %llu sectors fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceYou must enter either 'd', 'b', or 'u'. BIOS geometry not defined. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.31 2006/11/17 08:38:04 otto Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.27 2006/12/26 20:58:25 otto Exp $$OpenBSD: gen_subs.c,v 1.19 2007/04/04 21:55:10 millert Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.67 2007/02/24 09:50:55 jmc Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.24 2006/11/17 08:38:04 otto Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %snext_fileIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == -> %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdiknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sadd_dirUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.78 2007/02/06 15:25:18 jmc Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [file ...] %6d T؇@؇<HT؇X؇`؇h؇$pxč@``ę0̙0ԙXܙXЗ 8 ؈(؈4؈@؈LT\$dDl؇t؇| ؇؇@؇؇(PȦ@Ț@КؚDD$Hhi i@4 \|i ixL  `ĤФԤܤ\9####$ $$$ %(%0%8%<&D&P'X'd(l(x))**++,,ȥ,̥-ԥ--..// 00 0(041<1H2P2\2d3p3|3444ccdd̦eeЦئܦ $,4<DH$P\dtxħЧ ԧ    $`,`8<DLT` hp| `̩trailers-trailersarp-arpdebug-debug-aliasdeletegroup-groupnetmaskmetricmtunwid-nwidbssid-bssidnwkey-nwkeychan-chanpowersave-powersavepowersavesleepbroadcastipdstanycast-anycasttentative-tentativepltimevltimeeui64destroylink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrdescriptiondescr-description-descrinetinet6interface name '%s' too long%s: bad value'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRSIOCGIFFLAGSSIOCGIFMETRICprintgroupSIOCGIFGMEMBSIOCGIFGATTR carp demote count %dprintgroupattribsinvalid carp demotion: %scarpdemoteSIOCSIFGATTRsetgroupattribsstrdupgetifaddrs%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCSIFDESCRNote: trailers are no longer sent, but always receivedSIOCSIFFLAGSsetifflagsinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressmetric %s: %sSIOCSIFMETRICmtu %s: %sSIOCSIFMTUsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPsetifgroupunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPunsetifgroupbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xSIOCS80211NWIDsetifnwidmalformed BSSID: %sSIOCS80211BSSIDsetifbssidpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYsetifnwkeyinvalid channel: %sSIOCS80211CHANNELsetifchanSIOCG80211POWERSIOCS80211POWERsetifpowersavepowersavesleep %s: %ssetifpowersavesleep ieee80211: nwid chan %u bssid %s %udB %u%% nwkey %d: powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_status no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECTSIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX4Single-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types? media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%i%i: bad prefixlenin_getaddrprefix %s: %s%s=%o%s=%xin6_getaddrusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtux] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDfFm1failed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDFmemory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a usage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_RECVHOPLIMIT: %sIPV6_RECVPKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_RECVHOPLIMIT)setsockopt(IPV6_RECVPKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't allocate enough memorysetsockopt(IPV6_RECVRTHDR)setsockopt(IPV6_RECVPATHMTU)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Received Opt %u len %lu Jumbo Payload Opt: Length %u Router Alert Opt: Type %u nxt %u, len %u (%d bytes), type %u, %d segments, %d left pr_rthdr [%d] [%d]%s segments unknown, -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncatedpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPAH ICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops...] host ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off@LxX\dpx|884 @ ) ,@4T`tbgdumbtimernfsv3mntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value %s: %sillegal -R value %s: %sillegal -a value %s: %sillegal -g value %s: %sconflicting version optionsillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[o:~+$N,ߝ<,&6&9EmD͐Ns`a 7(r83_Ǣۨ\ōLRe~2n`zōw{"ȋ'q"n}QX(U"@M.3>8__x]~_N<)O^_y$1󂙷y̋f^2™f^6”I~aXϼԬ1=^gޜG ;mcX+0_z =x@!.Jh0 "S&d\y)L"])iyJf#d@ MrM4TޢΎ Xzh8%&zok(3{8N_a=+b.'a*p0I$}I*AӃB]݋8n0^G Zl*NEJ:\-D MEN,s:> "tnͷ|jĴ9KG`akQQ spo>tgb"&`Ev*4x,]c 4+v"P`e1l%2;"0 VPkݧkOQ=1wYdT v+0#? P)wVaIgnX䀦"i\$X7H(D,Y_*02϶,/m+ R໭݁BqaEeddǬ-:KǤ"}P&*H6"I|ĸ\>AlA r&#je  Yk sua5N\k"=T֢8QfW+ 2hBQNuF R=}X( Q:2cJ&+Τ%/ ܗd~6I`̻yw33v] ~{P Ks5F`|͈]BJ"qI"J叇`[p ֌B!2K?AFr+% $A |_kmDAB J*ފ>% 6YPȺmiB%ZfSb8AN%y:nui`#Ai+t!$Q FodA `߁aX zHA( *gOF#u21Rz-YrUaG0jQHT^Ar8jDp*Wp5Mx|Ft8ݦ.( 9I#M]}p>r k 2&yM:xiDDo&`! E(fF"7 1BrO'H(~~$ x 9~eG,Fw VڐPe6BEA'`F9=[N@\zi?2~oÃ"v p1)A+!''{cӻ XEzt.p \G,FZb>d p>% 6TEx`P&p_Y?\<\|ΧI=\@K[_YHDg.Cd4&eEC3Knh0퍆7&3% X_Vi\s.Iw9>FfLI u#U蛉?Mn}-^ 9<&MzScgZFZB8õ7H8t_e3~l#$f&^)lEyT CLQ؝)-` %zzYEj (ıEӒ D᫾qQHeUe̺Z`w_7"$7 |\qɡG{_9}]&KIp+2C1o2 w)6r ɧX2gt43QG;wqڗz ABX”p4i9 l3,{bm M_G<&ZUxrM2A\ }mȆP~I+=ۄ,8eݝzsJe7y5$*K\(/E*oq>r9 +4aQ|LReW橱;Ӻ(2L΢HuD gcѳu>"k `ҙöȥ&%.n(%p>ﯮ@ȁ tjN?..?^Ϯ|8T!vPFH)q+<v.9gw+j|j_AM UmYÉ CϓzA,ޫ1JIFͰzYjC%?zU{'PN18ڪ r^jApXh/ ~37ki az? j> %F9mПbmLGI ^  p&lY /0q|jі 'L6zd M?`p,p:'t0 p8L~px;{%l߆8}` /jUNWϗ΃?V7V ^Ƕ}mz 17Sa}gDƽiEoo<@=7+X3٤?'3x<ΤZpU;/HrS|8QڢT?76 XttCAN7s-+y4gwWHH{oi(zGV.Eޕ-Y?zhof!7*5 t!16uJt;һn|/[Cl`t{#߃E,mWmMJ=cUt8``]0!\9jdRGɉbͶA59[抵)䂐-QM-|-rLS?G|:lw ĸ Ǹ*Fb7\q TxZ؜+H82E+k +UnQ CQIUuy׬˖ԎsiʾDaM,Y'5@TU4Ln@>`<*VZuŲf]۫n[Y\2Erj 4(5jtY4DMo/( |pO*K2ih2;LR3+=0~lI%7|ۤQUfVs=kw^{HkTNAD!q,WkA;oBKQK]f atHۧ7Z/t_e i#,I @EjSƊkL5o)We:o[g~ T^v @j֪' FJ.j6fi!ú5c`_u96=ZՐj9j"jLIM,޹Po(O]XG9AW>&ܢJ1"_~7כze6HWZ9.HdL=֒IW~>\{ןOƦ):TAw=tck'gdM";̥7+uNꑮ/VOpjM@6As'릜`y=D|$cdrAxaU\U̜G^U{ W)W %U2tQُhFAy- ~Xpsnv2,)bx?FN:XhWžEb;D3<7\`E-Xusage: %s [-ieuy] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. ieuf:c:h:s:yCylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].error initializing MBRCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Writing current MBR to disk.error writing MBRUSER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s: [%u] Rounding to nearest cylinder: %u %s is not a character device or a regular fileDISK_getlabelmetricsDIOCGDINFODisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %6u %3u %2u - %6u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinarybyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]aFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]@LxX\dpx|sl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node $OpenBSD: fsck.c,v 1.24 2006/03/20 19:50:09 dhill Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p  `̩UGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstencapgatewaygenmaskhopcountifaifpjumbolinkllinfolockrestmpathnetnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing soc@ . .. pppAfirmware-Fgroup9Gspwd.dbH protocolsIservicesJ disktabK fstab+L resolv.confML hosts+A .@..B . ..C binDmdecqZsbinqZshareZC .B .. ftpgrepfgrepegrepgzipgunzipgzcatlessmore sedP disknames8D .B..E ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _hoststated:*:89: dialer:*:117: nogroup:*:32766: nobody:*:32767: ketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, table: %u, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s use hopcount mtu expire%8lu %8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: sodump%s: inet %s; %s: inet6 %s; %s: link %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s p_rtentry%-6.6s %6d %8ld %6ld %6s %.16sInternet Protocol Family %d: AppleTalkInternet6Encap%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %slink#%d@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword:PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroUser-Agent: OpenBSD ftpGET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s GET %s HTTP/1.0 %s%s GET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s%s Writing HTTP requestreceived '%s' Too many redirections requestedError retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_getExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Retrieving %s/%s auto_fetchCan't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXX 08`F<  FHa`[~ [~F`@@<@TU Fo8( bFoo?AF湴F2F2 YAFߕNFߕNFߕN XAF@F\$F\$ ˓AF@Fq,Fq, @oAF@F@F@ "uAF)F)F6Q )F>F>F> DDxFFpFp8 @ H P X ` h p x PJ)F-5 FZ FZ . pF F F / QKFc" Fc" Fc" /tmp/disktab.shadowFͨFSkVFSkVFSkV/tmp/fstab.shadowQlF瀊F瀊F瀊/tmp/resolv.conf.shadow F2F2F2/tmp/hostsGfz k*mRs(_ 0IXv8P,RA\Svgdf")C.%AR!)|@( E::kO~^EK7}R9'UGղ`I(qj$1NƆ07DdtbK h"7j#7PKM%G\;0p.^Ҟi/&:e[r? =;< Ek ޹woh]B1Li6)Wbs wu]nIG#zDXA)XACCT ACCT XXXXNo control connection for command.---> %c ---> %s %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46Aac:dEegik:mno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-c cookie] [-k seconds] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] stringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@Name (%s:%s): Name (%s): Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] @LxX\dpx|@8d@8reloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node $LI"]]t]]]%t]^^ ̳$^ ,^&Id<^#D^ $L^T^\^d^l^D$ |^ ^!^^ mT` `8```,``@``T`````p``|```````````a a ,apiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read (connection closed)buf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input filenewline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory dlp,z{ `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@\lT 4DT%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.21 2007/06/25 19:59:55 otto Exp $$OpenBSD: inode.c,v 1.30 2007/06/25 19:59:55 otto Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.32 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass1.c,v 1.26 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass1b.c,v 1.15 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass2.c,v 1.27 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass3.c,v 1.12 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass4.c,v 1.17 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass5.c,v 1.36 2007/07/17 18:54:40 otto Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: setup.c,v 1.37 2007/06/01 23:42:35 pedro Exp $ $OpenBSD: utilities.c,v 1.34 2007/06/25 19:59:55 otto Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddirbad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory list%lld %s I=%uCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld,%lld blocks missing %lld files missing phase 1, inode %d/%dcheckinodeINCORRECT BLOCK COUNT I=%u (%ld should be %d)bad indirect addr: %ld bad direct addr: %ld convert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS FREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE SUMMARY INFORMATION BADCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %u bytes for cginosused cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d NCG OUT OF RANGECPG OUT OF RANGESBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld NCYL LESS THAN NCG*CPG%s: NOT LABELED AS A BSD FILE SYSTEM (%s) WRITING %sZERO'ED BLOCK %lld TO DISK CANNOT %s: BLK %lldUPDATE STANDARD SUPERBLOCK %lld (%lld),catchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNO:S:T:b:c:e:f:g:h:i:m:o:qs:t:P:T:b:c:e:f:i:m:o:s:%s: can't figure out file system partitionmfs:%dwarning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: maximum file system size on the `%c' partition is %lld%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: invalid ffs versionsector size is %s: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size is %s: %sinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk labelusage: %s [-b block-size] [-c fragements-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-t fstype] special %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/pax%s: mount (update, rdonly)unmount %scopy %s to %s failedrmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfoblock size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %ddensity reduced from %d to %d bytes per inodereduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failedcannot allocate I/O buffermkfsfsinit2 failedfsinit1 failedsuper-block backups (for fsck -b #) at:%s: %.1fMB in %jd sectors of %d bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each file system size %jd < minimum size of %dcan't honour -c: minimum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size must be a power of 2, not %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldfragment size %d is too small, minimum with block size %d is %dinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacefsinit: inode value %d out of rangerdfs: read error on block %lldwtfs: write error on block %lldisblock bad fs_frag %dclrblock bad fs_frag %dsetblock bad fs_frag %dilog2: %d is not a power of 2 dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] directory ... $OpenBSD: compile.c,v 1.24 2007/03/20 03:50:39 tedu Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.11 2007/03/20 06:07:57 ray Exp $$OpenBSD: misc.c,v 1.7 2006/10/09 00:23:57 tedu Exp $$OpenBSD: process.c,v 1.13 2006/10/09 00:23:57 tedu Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'ae:f:nuusage: sed script [-anu] [file ...] sed [-anu] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."sed: %lu: %s: \%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be emptyS ;  K tLA $K t@ b ,[ x] Z 9LA P)? $$K 0$K <4Y HG P\ T\ nd xj |e  $t , 8t Dq L~ Ts \|e ds phv xe @y r l l  |e x df lw | -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$0tfcdslmn>p Լ  \  p ش 8 P@ d< x0   < Y0 D    X   |  T)( @  $ 0 @ T d| p \ P     ܺ  t  ( <` D P  `|  x    t $ hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDUL++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }$@@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $ a$c,(68HePXdirk:lpX`m|Cnf8buprسtsh)vxlet(  t   D4n{}  ||&&!()]]<>P 4c     (@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}[]?*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. inet6_rth_reverseno errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: sscanfrcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s Resolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_afABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6lx|%8 $Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2س$4@LT`pxnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.dbttyname_r/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling probleml ,@P\ht4Ldxl ,@P\ht4LdxHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" b0b1ncdtscilcshssbpxbxfxoxtxdxgetenttc%s.db:\|:cgetnextexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Padstack overflow in function %sGMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3clntudp_create: out of memory clntudp_call0$D$,$@$gethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~,,,,,0T.J,,,,,- -0-4-H-L-T-X- l-p- |-- -- -- ----.....0.8.L.P.\.d.t.|...-.؟r......./ /,/0/ T/\/!|//"////////00d0080eX0\0ft0x0#00,0INCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/0"S"too smallsyslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/logH2L2P2T2X2\2`2d2h2l2p2t2x2222X22222222222222223 33 3,343@3L3X3h3l3p3JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding555556 6D6`6|66666 7(7D7d77777 8(8D8\8; errno = %s; s1 = %u, s2 = %u; why = (unknown authentication error - %d); low version = %u, high version = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATH::::;;0;H;`;t;;;;;;;;<<@<P<`<t<<<<<<==(=P8=\=p=====>$>D>\>t>>>>>?0?@?X?|????? @0@T@h@|@@@@@@AA$A> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)``a,b,@|L<\B,|c,d,AD`e,dxf,F,l(g,Llh,hHA  i,`|<\tj,XJ,!tlHL,(m,@P`n,"lp,HDP,q,\r,",Pts,!pS,!u," 8TV,w,"lx,(< X,A<y,\tz,",T ~,!x?,< #, 4.,ATd (press RETURN)... (interrupt to abort)| 382@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU(@t<Xpȍxx\9 P,H P  P 3\z@$,<ALBeC@D\ElF|GUVabcepsfhiLlnqqrsv,w8xDu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.18 2007/01/28 16:23:58 bluhm Exp $$OpenBSD: mount_msdos.c,v 1.22 2007/03/20 03:45:54 tedu Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.15 2006/12/16 08:49:18 jmc Exp $_(4<xDH P X T,  `̳lp t| 4` !8"#$%&'()*+, -.T8Lh$Dd( pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL@c(008$@49QT |V du(  [(  T 0) r s H3) H3) sP" R) g ) e9 # s() Pm0) K<) `IH) Il.  c t1P) Z paT) l]\) 9d) 9hb Ql) t) tn|) $a) \) ps) mD$ t1) 0I) ]T q A) 41) m  o@ 0) `G -) ` X) I SX,NOOP @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.29 2007/05/11 01:53:07 tedu Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.19 2006/08/11 11:47:39 pedro Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $I( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.17 2006/04/25 15:41:07 deraadt Exp $i$OpenBSD: cbc.c,v 1.14 2006/04/25 15:41:07 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $t$OpenBSD: main.c,v 1.30 2006/04/25 15:41:07 deraadt Exp $$uH$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.33 2007/07/26 17:15:46 deraadt Exp $( T$OpenBSD: utils.c,v 1.27 2007/04/06 06:50:00 tedu Exp $dhlpty ... ...@HLT\dlt|@ ($(008TTTTTTT,`TTT4TT0TT<@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.39 2006/06/22 00:25:22 deraadt Exp $ | $OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $@LxX\dpx|@@@@%s: can't read disk label; disk type must be specified......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.21 2007/06/06 00:08:57 ray Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.29 2006/06/14 02:14:25 krw Exp $l  ȫԫ\0@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.19 2007/08/06 19:16:05 sobrado Exp ${}abcdDgGhHilnNpPqrs tw xy !:#= P$,$8@$L<$LDPX$,<P`p|$P4(6ĵ|س _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.17 2004/09/16 08:35:49 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.34 2007/07/27 02:49:38 ray Exp $d@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $@HLT\dlt|@ ($(008TTTTTTT,`TTT4TT0TT<BKMGTPE@5MS7) Xxx:xx:xx:xx:xx:xx0@\hv  (4 P\ t|f TTTT$,TPTX`TT9TDLTpTxTTT `[ (,8 < @  D H X \ h l |  !"#$%&$'0(D)X*d+p,x--..P/`/D0X123456789:;<=>?(@8[L\X\h]^^__`{{|}}~ ZZZ|[\?T@HLT\dlt|@ ($(008TTTTTTT,`TTT4TT0TT<*   ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz!0123456789abcdef '''P6P555̵((P6P555 (P6P555''8<|& UpX$X*C* J*Q*Z**ĕ_*f*q44~*m+#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 random wskbd0 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; hotplug) M hotplug c 37 $U 400 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 hotplug ptm R local wscons pci0 pci1 pci2 pci3 iop0 iop1 uall tuner0 R radio0 audio0 uk0 random lkm tty00 tty01 tty02 tty03 apm R crypto pf systrace wd0 wd1 wd2 wd3 raid0 raid1 raid2 raid3 R std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs . ..MAKEDEVconsole tty memkmem׬null׭zero׮stdinׯstdoutװstderrױksymsײdrum׳klog״bpf0׵wd0a׶rwd0a׷wd0b׸rwd0b׹wd0c׺rwd0c׻wd0d׼rwd0d׽wd0e׾rwd0e׿wd0frwd0fwd0grwd0gwd0hrwd0hwd0irwd0iwd0jrwd0jwd0krwd0kwd0lrwd0lwd0mrwd0mwd0nrwd0nwd0orwd0owd0prwd0pwd1arwd1awd1brwd1bwd1crwd1cwd1drwd1dwd1erwd1ewd1frwd1fwd1grwd1gwd1hrwd1hwd1irwd1iwd1jrwd1jwd1krwd1kwd1lrwd1lwd1mrwd1mwd1nrwd1nwd1orwd1owd1prwd1psd0arsd0asd0brsd0bsd0crsd0csd0drsd0dsd0ersd0esd0frsd0fsd0grsd0gsd0hrsd0hsd0irsd0isd0jrsd0j sd0k rsd0k sd0l rsd0l sd0mrsd0msd0nrsd0nsd0orsd0osd0prsd0ptty00cua00rd0arrd0ard0crrd0cwsmousewskbd st0rst0nst0 nrst0!est0"erst0#enst0$enrst0%ttyC0&random'srandom(urandom)prandom*arandom+wskbd0, apm-apmctla  un}of!NI u p + & H  H _hoststated*YYHostState Daemon/var/empty/sbin/nologin2&_afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X S   nobody*Unprivileged user/nonexistent/sbin/nologin2'_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp fa#A< r m & ! N I   { 5 { _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"yt:5 _ Z  z u , ' _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_ripd*XXRIP Daemon/var/empty/sbin/nologin3X_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hoststated*YYHostState Daemon/var/empty/sbin/nologin1_hoststated_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 [ V   E _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_hoststated*YYHostState Daemon/var/empty/sbin/nologin3Y_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin$vm,%KB f a   p k ( # J E  j _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & W _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplf% >9 J E   p k * * _ripd*XXRIP Daemon/var/empty/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_ripd*XXRIP Daemon/var/empty/sbin/nologin1_ripd_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . .. catchmodchgrp cp dd df edexprhostname8 ksh sh ln lsmkdir mteject mv pax tarcpio rmsttysyncsleep ...all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b  .B.. .B ..miscqZkeymaps . ..termcap . ..chowndhclient8 disklabel8dmesgfdiskfsck fsck_ext2fsfsck_ffs8ifconfig8initmknodmount mount_cd9660, mount_ext2fs, mount_ffs8 mount_msdos mount_nfs8newfs newfs_msdospingping6reboothaltroutertsol$umountdhclient-script dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 08`F<  FHa`[~ [~F`@@<@TU FhbFAFfF>-F>-MAFߕNFߕNFߕN έAFFi Fi AF@F@F@ ~ZAF\$F\$F\$ 䇠AF\$FF L/i FFR FR -K Fi FA#F 0:J5e|Y~WϿ‚_a/Z %3~O sg.|mlɴ:2<Gp{Z K٘0I + {"!\)|eho̫9酦RY9^Q7Luq1eJ/;qtzYiY;$应V6^-na* DhQ9 }FzW r4ER&="%FU*"]ZdўP:$9Ʃ!cO+V1o) l> x>ЛKI [Z PzF{`3XbNEü>}]50Dyy@ywq,S?7TpR[QOc<3K4n] F~R]Ӽ#!f>?O'88N4Ikt";ʿN5*%[j\i>X{4gCPPbC#4J/:K7P&*wTidfO5#!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.* . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD. At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C, but exiting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_ifdevs() { ifconfig \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev" ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" "$_parts" [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { get_drive "CD-ROM" "$CDDEVS" || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask "NTP server? (or 'none' or 'default')" none if [[ $resp != none ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $resp != default ]]; then set -- $resp sed -e "s/^servers /#&/;/#server /a\\ server $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf fi fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=42 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable 0123456789abcdefe)y0,0-00e++|0|++e,(Q+h+++++eW1]1\1,f1f1e:40]1\1,f1f1.0d0u0e<0e+h0e, 0e)8+]1,f1f1@+e8+]1,f1f1eW1]1,f1f1W1;eei)@/40@ X Xd$`lepeeeeeee|eeeee ʚ;5ym8@ E8(@AAA==(A*e e$e0e,eXe8e#$?#@#&A#A#v#X"""&"&"&("&&&&&&&&&&&&&&&&T#t#H#@##&T#&#&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&,,,,,&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&0"8"&&@"&&&&&&&&&&&&&&&&&&M&&M&&&&&&&&&&&&&&&&&d#(####& #&&&&&&&&&&&&&&&&&&&&&&&&M&&&V3hW3W3&XX3&^3&x3y3Hz3&z3&|3&&&&&&&&&3<3&&t3& 3&T4484 4D4&4&؈44ܢ4&|44&&&4h44P44&4&74<4x=4>4>4F4>4M&&M&T55555&d5&5HM4@Q4V4Y4tf4&g4&h4&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&""&&"&&&&&&&&&&&&&&&&&&&adG\b@;;< ; ;;G;; ;,;8;H;X;h;x;;;;;;п;;<hK2pK2L2L2 <\[2@[2,\2$\2< ;`2D2a2d2p<2t222;T222$242ȳ2D< /HNT22<2h2<22<022< 2<33<330< >?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyP"<q3q3r3q3f:"<"<"<"<"<33'<<3833L33@333(4333D3p443344USB audiouaudio)<044X444.< f f f f f f f f fH fP f8 fx f f  h f f f f f f f f f f8 f@ f( fh fp fX f f f f f f f f f f( f0 f fX f` fH f f fx f f f f f f  f( fX f f f f fH fx f f  f  f#8 f'h f) f+ f3;d/jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-C<{{C<C<55Ԥ55Ԣ5T5|E<l55Բ5,5@55LF<55ܾ55t5`F<5<5x555F<555`55G<55555H<5tH<H<LI<5hP$$J<6`686 6 6d 6@6@66H666XK<L< :5hv1! !vvvvvvv3 P q q2vqqqqCW 2D k"{"{"3" dAdAW 2]\ \ ;  LL~1K@l"Yd5e$7$\o3LЪ!`z)< /\-@0,@$hY*Dt3;#Dl;9<7</'7ܸ=$H&S>9_0l=53X Bi*|3#t'9* ``4-"$ =$L!2 hB\=K <]"|m5x40Dh*=<7@w#LS3("#<p#$" f)$,49J0(_{1iH"5d0$<f88|="y6` 82:`=(7 0&H'ch0D)3:]h GnhSk'eTohvXoh|R%h0=&$fhP$?2H%;!43.<'D* "f |9& `=5 -D #X] P72r 9 x= #d {*l f X'| %90 9 4* " (4, H)1\' 3< hJ 3"` 0,l H # ة)T 1 (F* . x  D#f  $ 4-8 2` 0!* 07> :`Z TF: g =(u ذ= 7!0 ai 'l 7 4Xi $+ d* 9 |= <: i, H*HL "D\ (3r 6  ,` + ^3 = '0 p0&0 hi  l&h 7 H6 =x hh' |q%44 e ; 5H qhX J%`c "x 0`# X#@ P6 tg/ <9 5h N= 4$P r3\ = ;:  1L0(x#6! 2hg: [&E8"N?(XWp5kxqh/`K$-L$X%9t3\25%tE9%L60D A2:K=`T% ^"trv+%p86 2*D($P$fD7d8/"<3X2' 3X!f6!+p@{4MQ($\H32p=3p"8,:"w%D(^$T`a7$2=4"p4-`00d9H)8M'DWl5pdthz7%2T2D*4%,"R/<(!P(`i%22#+H$=44@`9Lo-Y3Tn47($@D+t"4d&'9(:h/t'# L"f"/3 =$EH>#O5e.,s' ~$jh`=h*Dd%d'P f(l#,p#8* O$4 \"$rh.Tf84"O X]5k /{43@,!xp%D\h "\5:N@#=F18=@=#ti.&;L,0LS&<T0/];9pd@3y%T 93#L M \J.,v),#0 6hfԠ=XD3$t9)\4&h1 5,<o)I6t[80tein$4i3x4=(h3t &l$dD58&Ԑ=34;X5@J4W3$lh=v5|<53l*L#<dS$3hT*1D4. =H)"0$$9ī4TH0XVTf`d.p3}C4 (d(HJ$lx'T5 =`=($hhi!H 9'!1\<#fIYiW*xc'@n06tz"ti 9-h#86Ц37C*=L! 5+U37,D!V3Lafj0,y=/d3ih1l42%-*T:&%TFghR.h[$$gt fu)8h2%%'txg@f$p==XH.$P29,Zi6#T>3PRfY=h$*{ȱ$74=x=,4D^)2h2@=x T 6,+duh:nhPH8W(jh`=jb6t)6D=t=82@ 1.h?*T+2hg#A#d5T(xi9(o*K.TU-d=r853$*'418_#%=,4`qhe( 7<4U(C%OԊ2\H6jO38wui Ȗ=5M/dT]h@6Е/@3H8(T t47 5+ 4; LP)<E f[ Ti0d $6hp ,7:y P= L5\ (= 9 #x |4  i $% $ ^3@ /! dh!s#!,56*!S58!̴,XH!88W!e6e!p14v!a*!p)t!p8\!4!Xe!#!5<!$f"\3\"82$"h!%7"f@"x$LL"dQ$W"r$`"ؗ#l"="b! "|S%"d#"="%"%"3 "$x "e"H*#H6, #9#&L.#(6h6#5$?#.P#*4^#%r#E2D#"p#^h(#/#4# (#4#E#`#"@$,"$ =0$p74D$!$V$\f)i$p5w$G5$3$!$_i$$<$ "D$&$H+H$/"$$(%8)2%p"T%\3p?%08$Q%i_% 9r%0Biz%5%,f%g %Zi%Аi%$j3%+%T(7$%@N'%Xa5&Ի'  &8$&H:5&$+8F&(K$(V&p= ]&B*8s&2&@9&+&-l&H5D&02&h69& k7&=&]4'8=$ '3L4'M%hH'$"Y'PC6e'$+ o'(x'|3$'%L'=',55')'ԥ%'/'(`'%'& (: (%(4q")(L"7(1XB(44R( _*j(%|z(D/(nh(=("(,(=(|#(=((9(- (T3P )@2d)t{(/)2tE),R))d)l3L{)mh)G'x)D(')Pe)#`)x%`)4Z!)20)|.)3#)()\4*g*@6 "*5h3*eB*fJ*/5`T*dqhb*Ĥ1x* *6d*$#8*=*#*@78*f)x*3(*/l+*+Lw#h*+/,:+D+H+"4b+4p+ 'w+f+=+Ƚ64+X4+H?1<+l#+ج!+hR h+P8+xW' ,5,b& ,x=1, %!A,iU,35`,)v,5'L~,H6`, 1,^i,0f),,f, ,<6`, v!H,t6-2T-="-2'(7-T4tH-l&S-p$_-̮$j- ##u-(D/-9-$0-!3-ai-.- =-x$-hh-6d.4.1p%.T-3.Ľ5dF.n3X.89p.̴#.=#l.[4.$8.h/l.@" .!.(T.968.2.{(/ch/1/ 4`,/eD/@$\M/4<+x\/5i/<*9 s/5\~/'\/2/x1 /=/((\/8$#/,"/<4$/.0380i "0i704E2H?0 =K0y0 X0,=e09u0 D/0 $L0 0G$0$@0"0100=0e1c/1ix1(`&1291*R1" e18=u1X 818L1T=1mh1'1Ԝ.131i2-2,$2Lb3/2i72|oh?2"T2(=\2T'h2ܫ-u2:2+5p23P2e2W 2&2%"D20 "2D3D2HM42m,T3=3<["X+3i4<35LP3@6@\3tf4f3'w3(2'3&%T3=3@-D3x=3f3L# 3#`38'34=Y4$dn4s7H~4 4344\1444B4H4$ 4t'4+!84 4=5F()5df557(O5"0d5 l5/x5'55T5=525#@5Z"5%5dW6$5A45Xe 6.6,=$6U386$eA6`!P6p 'xg6?$\n6d6{6|46t&L6*l61`6846`K7`6X 36lf6=7L,: 7W,7`oh78Q'27"L7p5x]7ܱ2e79x7(#7$7$27t/X777 x" 7 =7|f7Дi7.7<" 8 806*8"`98؈4F8'8S8xP$^8`, o8M*08М.802:8|3H8"8/8'X8"8,)\8D4899X'%9 =296`C9 J*\9HD*p9*9o)9e9H" 999x49h49%9L9P5& 9]14 > $)>!*>hf5> r&=>q3(M>)0h> U)r>('X|>K$P>=>#$>4@><=>hh0>c%|>8d80>1(>ܞ& ?3$?Њ3 ?*p(?(2?T58B? 3Q?&[?D'a?8<q?9?).@?|0 ?'?B: ?:? ?1?- ?J$t?p!H@(5@d5,@tN3p7@pI/@D@/hT@<*td@|U!|t@8"f~@,9@lh@^h(@P8@P!@!@7@[5@X'<Ac%hAn&!A=?A'GA:TZA.gA!vA=}A:BA#AfA"A=A1(A"AfAH/XA9AH8BX7B|i!Bh+B>$2B#L=B,@: IB.^B8TioBp}5xB|=BK3B=Bp[%BdeB@*HB.,Bl*B&C' C8fC=#Ce.C|19Cr!JCE: VCT#fpC8&,CW,XC@#)CX$CT3 C6Cpm5C.C 7CO3LD,D|Y!D0=*D##$8Dl!tID3[D2HbDD'nDDn5|DV$D=$DL5xD4+D=DhK"HD| fD :xD#4D*2`D~(H E=EG%E25*E=6E7 GE̓3LVE̜=H^E=$eEfoE%64xE= EH"E8f Ed~&|EW!ETeEt,: Ei0El-E@R!<E4gF'F8!F\6.F %4lYJ$dh`J"tJ6@J@y4Je&J#0J=J\g@J5P|iPy% Q<(HQg'Q51Q:lFQ5XQl?.PiQ7|Q<&PQ5Q.hQ4!8Q<=Qf(PQ<% Q(=QT.$R, R4=R'9<%Ry2p4R1BR6 OR=eRȍ#hrR^% R'DR 5R0Rp R:Rf5@R!R<=R.lRX*|S 8P)S@4<4S|fBSĈ'LS=SS#LiS- {S$!S̿4S/S/( S_9S %S8$`St#T,8T 7`'T,">T,OTd$ZTL1kT=sT2T(d)T#xT,:3TiTP,TTI$\T,%T@$T4 'TH  U +U5h.U 3lDU5QU=iUfuU|)UfUeU)U%$U5xU"HUi8U#PU@iV@#<Vf V'V9#VP61Vi@V*xhܼ)8'h13h =:heMhF/\hp*eh06hoh"h=hx#h .h3Ph@[2h%h4hh*h$ ifi$o7H0i,=n:|Mn I. Zngcn5onЯ4n+-|n4=nP"fnin 9n9n $Lndfpn:0oH%o=+o|.9ol*0Mo5Xo\~7hiox6$oX*ho'o,50o5Toeo|eo=o5o\/do@`' p<:<p&lp6t+p67p85Gp#[p("gpy |tp1p(Xp3ph3pd0pk.pl(p"hp$ xplqhpx( q^hq` f"q`/2q"$CqchKqPL.PXq|1eq|,{q"qċ4pq= q70qx9q\1qhq#Hq("\ri4r*%r]#\0r6pEr4pVr)nrt=}rt6r=$r2rh"Dr1r+|rP=rD /r"hrl5r4/st=s2sfh(s0P=s,MshhXs46has=jsī* zsU7s6\s8xsT5s,2|s.`s]iTsis =$s" t $8t-\&t(4/tD4$T9tt!xIt %]t6 ktH68wt- t%t%t=td=tĴ=t8)<t& tp]hu5\uf u.X$uT=2u$' Bu4>7Wu=gu&@nuhi8uh'Dud^iu`0uiu=uC: uh4Du47hu.u"!\u{2 vX42pv"$1v0eDvx"8Mv<= XvX1ovT.}v8lv`=v|59vN2Pv@8$v$=vܔ=v\&\vhv@|#wĀ7w/2|+wk6h:wh5Lw2_w8#8pw$=ywl6wd=w=w!w#" wjhwؾ/@wl*XxPf x x, 4\2x,=ػ$(E4#\L4|Z(ijD0lvp"fJ4+Li4%DƋx!Ջ7`6f  /30$'%T%,!4/Aph# N:xjQ.|xl6Xp,,@#@l#6,(.T=Ō(]2\̌0+ڌ<44 3,D  e/ f"$$8+9A4M#(DZYij,w7:D)llR34*,9Í48ӍPfݍ`+d"4\G"( "%$!3Tc/pA$NP$#`|(xj,5uX(>% 3(pfZ8dҎ2D=, (8&"`45ai@8Z,Q#T]"@egq)0)&M$e6pV3$ď 2|؏\#\^9X(x 9 ܌),p^h$D"H8;!B$TM2 T #eX'"p|4<<+2=\s5 2X-ΐ$%Ր@(%< fXx72 =<= 'P|)41" Ep HS&Z$b)\rH=(='DD!49M=b1gl-|t_*HA8 36Ŕp/הt,h@$8h88Ԑ*-h"<B8DR44X`I 4i2s7|D4|(h==$<:|%xʕx=ߕ`9p-<Լ'` x.@P,-а%d;8Sd54`hi9sW1}ai#,%$"p!Ж@/lږ,/&h&$|` #o!@/#p3072A-N"\ 9$c/@q<9,y̖3d,V'&<74?1ї.ܗ@Z.T(TH$4. ,h#<$"d/@=7|3@C&lL [DK2$e0%v$~t4LL5 L= ,=H(Ƙ,=$՘pfݘciH-< (T(Q'i 'i&|P7<.(T3t;2I,TSH%DgTn-td"4TG- l'pж68f x4XÙd"0ՙ2(Lp'lh~65 ~2H*( *8(640, B$%lO8_Ĕ=x`=0x6(,5&(,={(ĚXe*p֚gh( 84L#H,]5( 95)C(S$=h,6 vx%H2.0d.Ǜ)@כD&,4|Ĥ/q8Li!l43 (D6(50@H$@F(2OX6$\L+6p}'|389dhd=˜"7ڜ(!3*\`#fPN#2"I@XiY&eht#0q70[282t38۝|2=(8Ԙ3T%q7d9.TF=NG"cܵ'm 6y%t7P3!.˞(ҞE9ޞ7@.$&d,"",+2$+ =T6I<1Z2$h`3pt.+444D 3y-Ο'֟(Y('@TH%t"Hf&X)48X~4C`*(]<%qM${&Ԥ5'@-t#8h d4֠-8xW4H`)h='%44h%,BX:Y:|d(o4^'Lvؠ",\218,=T*=$ơ"ѡp& ١f 908ܖ=ع(<,.7`( 9:0! @d"K6,XD{5aPJ4DkB6\v'<) +3e(`7<p5hʢ!x֢'DߢF: 4\e4i610P$9r!@Ja/[X3m%h=Pl2̲)L540£l)ͣo6`"`g#"=$ch',.0=$Az)Q|448p'\~+9*<P#DH6HäViԤp#0/x8 # z)$\= ''t8;mhJ89bЬ=j;3vPe&xo6|=$H#f})@ƥ<$9<ХP'#\3L+={)\6"(8#@2/=?,=L:5$U|9jm)t#<5\%p0 =9¦+&0ͦF#٦8#Pq-q(<.e(H"x= );9H-|6<ԝ3Ux-Xc|8Xy@ 2(J14l"pܝ&43Xŧ,TͧN)xէ['tڧ,i1=h=d#,"p@3PP̔i[-j- q=6d39@H#d9֨84,p*T|.6$5 4hh;9hG`(RO(aL\hg/&LqT3mh!t-4*p @˩̖6,֩6,-6H=#"(T+p)D4=Yy4px=g0 7(3Ϫdg^h@#7x|s54\!<2,[.>=N<h0WL2L^X{3do=87h09/9@J!x2 8r6īc5<Ϋx#ݫ3<"0 Ȏ"LXt)&99[iML-Zp,(mlh<vai4%tX;9&:@: 4B& 0=%ɬL7hЬ|=S&=68 V4s-l|=x2( 4H|eWX- i9x34f0#04"Lxd%ݭ'= %9t6,9//=X"fCHO(HP6\3hiyę(&H&x8("Lʮ"lԮl=ޮ,(}5p=\&=6/#(*"\8!dNhY!lf z,'H-h<"r"\T=ү w&ٯДiݯ6$'DDflI5 =$./ ':آ%,G5 YeuiL* D'h4"0T7ȰL*ٰT 84p!<1$c6#I40̠=H'<TP"]/#y<7p" P5)ű($7,ֱ&h`i< D82,.=C()]l)v4(+%4<'4!\2˲8 ݲHQ `,a3 ܾ:l=$T60@*:0t7G0'LS,'l[!il3|a8hK2 ,('@"ij`6Գ-D\G%t8!`(f &t"xJ"1XQ7A eS,`$)#dkft8>%d~+pH*H4p@iôhfʹe*@i( Pm5 Զ+P(T "$.d7-d :u$<@@I"tLV'St(e`=mp2{t#p##tl5h042<ӵ=@0h,"8LL.W,=h&t@+\9'd$D$G*tĸ PӸH%ݸ53v5@Tigh 'x.1;y&E8XiS\']8#k*xr"4p"@(#5Ĺlx&x͹`2hܹe',=`#,:e##,0C(>F: J1-[`5Tk#w.:< 9-(+9Ϻ9 غ3`5t= "!33=B=$Q@: `<38iz7~<6tTT5\i\=$%hĻ\B2hֻP&޻q3$.h== t=&(,4)9,;/TJj"`6mt6y0i4=4%t32(eɼq,׼|4D0h5<d49+$! &+!@<aiJ"xWj6LkP9=3y2@4Дi½t~#ɽ%<ڽDXi*H,$hpx8`g##T0;:=X+ PL:|Z@93h 'v'!.H959D¾ 9վda"P߾D92De7(8:1xfAB' Jw)DR'<_=bB4Dk|9~=89}4d.P+pſp(ؿ *"Z! n7D2t0r!8+؝69G A4Pe2@W!\eH!|x'$x"``,Xf04|&d==p`$5x(50hh)$7`B6P/(_`]hg!xx53*T $4l 2Lgp3.l=2|2nh D=7($N23#4DeQTeX.k(-z(wh'9f'L@6ܷ,|* 1X= 2Dp3(Է=$8"D-P('[H2is)Hw"~2L#0"fP2ThTi4%|2$u6f2  )55(l6A: + -<3,Rܜ%$Z\6h b*D'$&7D h3!744p 3|B`2 Kp/pZ{(g'4qG+8=(d)<d7p%[$ex8@{$(heP."i0p'L:4H*]eg&vd$~* e%$3.|364.h -h @f$3%Xex5((J1$]){934^*d(Q%H"\66 &"4H342#H0f84`3LEd&%lMl"X#7np79 p&l1Hr)ivh=6l 4-D28+td=8&469$/0=T=H=QV%p_f#dk4!&6@4h2x$`W%Lt1+`̐i(e0 $X4H 34t#|@p14QG2t^31hkH&-hx\9 V&96,*(<9d(#0)p 3=50)3LA|}.PPP_$^<"lt(0$=50X!$$759D8kh,m'p|&Li*X9#x5-qh;L+M(\e<g&,vT.@}R%,"|6*=4ؖ=D.lpK2HTi,5$?#Ai&9!\)<2?pgNiY8V)d3}3x=0&x(:\h2&\\#fp5H4lohd=|"4,f 20V3:!LM7Vt=]5<g0=~%1p}&=3`9X3X'T\ %L4|3  ).p'd6S7I$:]=h* $v0`'|| 8ih+l$"$p3l-P1.T d44ܮ*=1h;=G?'|S!7Pa3t5T=ih7')0&(T!\& O"p3/34@Դ=P#9LX,<_X=rpp1|2@te&1#,T(H5pN3R'TX4-$ y'H4=!P\h.3\D(T=`d20jlht !=<9A*p:X;9.ث3T/t+'P$h (%E= /$9(8/FiP8"|^l7o0id.Lx&l#$7<=\J664W%`<(<\%M"5)6 7%TC%OtZ4,[2mX&{f =x!"43`+\'@\4x(%dg=Q T(96(T'hA&4P!^&!,gx5rs4cigx/p.xd'9X7'@,:  =hy6L"̄//Ă"4Gd~(XX;h f$(rai~t#d`k&j&H`"0'6<'l/802-r,)@k'#t50x.@gN]h[0=b /-dq4+|w'*p+$#(,=y6d4)@(5hd6|@,T=$+X[h8Lg>9T\5T`fq\%wL99d6dM65|{(&  :`( *tq-kh#&,0T)dGĞ P$%dha.r9Č$p\=P-3@nhLb$T=f+=I|7\[4=`q@F!<~,4=6$(P'@9\\. 2@i, P7tXh5),9)'H$P 'x]%5l*Dx|(%<959H4H"P4V243+[(D"12TBpQ"4 L=!Tx)7g3TwS*0*7X69ȳ2py3pd=l5h5t31\(^$lx0 M+!8'+h].7X)`Fh=RPZ!$\ m- |"|,(94;1$0L=(3P<#HH`5p-#P=88?5Al68RP")l_<98f@m3x!3l5dR(l#H=N!D",D=, #4 =iLL $= 'dDi7<&`A1@P`'0Yu8i5\t%=p@*Dx,$Htg4L6`$/3Di@'I6T %, O%0" 2T0ih8gh? & MЬ1e2n40}<# \P*tdh-3T.@2!$,(ȔiT>&5:#f6(+5AfJ8b,Lo5L}`G"Tpoh=$'D/`-@-dnh%ض$$38\<3(!$5/ HfPL3\h-9!L&(p+0*'=4M/h"0w+X>40x, 6H-44$6fD=I7\[=kfy0"(121dk*<ih8#<Ȋ-08",` tf=+ '`:13LF1W+i|=yX$(it(dfr0(4l7<\-<50\K%` 6_*,n&2إ(dA$&L\=$],j|*~&@d&@/=0'k,#X!"D|4 =dZ% ! .DiBfO=Vh(c48}85h4 s6=l#hgp"\(T3H() ,# |4.$$d:HS-E(=U!c'(n'H{df\=$`=t8:5&!\/3t(< [" R6#*h-P;,G %tT7kD2~*La65ih75 B(D'D5%%!`hhL36(.#4C PG"4h(#u(<5 '0u"T(\`2@`8p7hԂi .x=$-X=:v#hL$$[|4teF!@n$5zX'T_2,,'l(lhĀ*hf 5N&!pqh 4l'1$;h'C=\e<d=4l=@{hel" 47!,3)t2/7hP*8 3!nh-`[h:6K 4(Z z3<h wxS6$j5d6|:P36#=0lD90`6,DTib5| '+-<4=PIh~$lW!m.@v4j"36,5x 7x/j6$C+L #Ud)Dh95r`9!d~X# p L.tX1H7h2`(*0=+#p4|9-$t5>/,O$,[=e[#pp\'v"7$54" )`8H: -V @ohe ($0t L1!} f 2D 'D - = P= 7 . X' 0# 8 &x) #80 "$< Z7P 3%L[  hf &o h8} TZ4  \%d Hf r& S  h7 k9 2 %p 009 f f Hz3+ eF @P%O  3pd  !r 6 &x 4    d 8: f q- p14 L+L Ȃ&8) =3 8F 3 c fm T=z #p "H o*t X3 M# ih +T  h =Y#i3*-80\L`-DYܸ3i't O&ĭ$|H"|U! 'L#""p/T6 ,"1%!5,9?@4dS,$d02\y/||)<5Le<6X<):f|%s/xf t 3tP%)x~'t43TK;2S4y*dl"C!<f$p&2T4H' f6d '9T'xr4t|=*=:+\O49U86_,/nnhu(f~\f$0A: 4t(X0o-F4Px1lh33 H\i"h$55z1G8%S\fZ"TiP@: u50d\0\9Щ.3%xO53 4i|q)M3=$}6t+%i,p"pAx`&H*$Uh>*8h|2'}\=x4\e&$؏72\-,Ȟ6X7*x'9$4<%Li99M'V<)"my0vDe%xoh74Di0= $2|,X4X=& #L".3-pD3PTp8<elhunh\n5@|"8=-HL'2<"<(Tl6/<f 59882T%h'$1$f=2C2\K,e d, uDiL~d)$`2d,vh.LxZ!P9Yi'@T3Pr/#|&X.H=8Խ:$J5V-\ $ht/t!' #$؇ h:6 "/m)La$d\/#(,,: =$=5p Ȝ=*-:Pd*@L\,$] Lg=vh4h4/X$=/z54=!$L2h~%Y320"=(g9x*B 5N0vhYh4 l*`{m(L8$d,!"r%* w4h8gL20tZ!4pX=$\,6l0"6 x$90  :<@2&dm)L16#L=1$Jb6ZihO#t#H<9<7h4"Pt6X3`+*$!p,E9d "$D9'5`:68M5\['|b XlI"{78$|7hX=P$|.h/xx8`44/@ pf C1t" )%2 H!PF x=_ d20f ('t '@ ih (#X D-.  T( U=( Ll. 9 81' q"@ |'<!\3 !a*L$!d)4!X$LC!("$N!m. \!4vhk!w6x!"(!3T!Q&8!#!D5!P f!f !e!D$!Ժ=$ "@G!"\4T%" r-;"4(|K"'%dZ"z6Dc"؍2ds"@e" 88"t06"5"l/"2'"\50"$"\"0#%#=2#,0B#Ѐ2 O#t1\#|(1Ti#{3Xx#܁.#X_6l#i## #e"@# (|#Hh###5l#ih#/8$X<"4$s!|0$Щ*?$ 5I$D66S$4^$,l$G*l$ .&p$`7$Dd.4$h 2\$3\$4X$X=$$f%#4%'$$%*#,%n&6%ĔiF%fW%,e%Piy%h%%$%34%!%#4% ,% ',%x7%?*,%.8%=& E7& 4<-&T1>&Ȋ)R&R3$`&4hj&2& |&X?6&`Y*&4D&$&)<&`f&02'- '+<'g ')8'2K'+V'((c'94q' .|'.(''P'g'(4',%'`&'3''X(ȟ1(p.(l"42(,"HL('`]("m(- w(6(0'D(!$(T;$(h(;9( $(7(T(("(f. )*$)' )u"t0) 1\?)\{0G)5TV)5c)@3,x)!p) t)F/d)`5)X=)7)-)9*+*!$#*640*D)G*,Q*d&Z*=$j*(v*8*"X*1|*/h*8D1P*-*/%$*h*D#*p9+'L+l&#D$+8h3+5@+ 0 L+d)"c+=s+g-+^*@+l+D+d&`+!/+PXi+lWi+l,+x1+(#D ,6,7,,(9<,d)8O,'8Y,?$a,:0u,eT,2,,a2,2'(,%`,hf ,Z',(*,3,Hvh,'"@-"-"06-P5|D-5\-x4xl-fv-"-X"-T$-=-1h-Te-89-5 -|3L-?/X.hW3h.,/.x)h).lf5.&9;.1$M.f%(V.'Hc.%(E01W0H%te0 @2Pv0Q30<f01,0@-08- 0"40$7T0<604T0z)1x+5l 1K* )1h310) A1{0 K1H"%_1fi186Tx1`91=1'1,=1P*41(H1 F3l1=2X= 2L&T2L:24)24=:2=F2p.@W2%p2"026p24P2T= 2`:%2|q42п$2 2+2L(2<2X83<0p'3B: 33;#D3)Z3:*m3|R5$x3%$3@1<363P)393x=@3&37\302'< 4L1t4,u54Pf.4Ƞ&\54T$D4#LQ445'Y44tf46:m45Xx4|#4Pg4$2D4=4=4t'`4 4z64hoh4@7h4%4S#D4 65 3<#5f/\35==5@a.(K5e0S5=_5 m&j5@)~5L:5T*D5Yi5K*5t)P5H7>6,'>57>|2,F>=N>ciY>T3h> x>5><0>"0>HTi>( >v&>">$ 0>2@>ؓ=>4f?5\? 5@?@=7?*M?8=d?`,:m?88~?`9?6'<?'?U&?q"8?L ?$(|?d=?t) @{%P@ @f@x":@j9O@4'Y@x7i@Ȱ"L~@2L@=@#P@e%(@Ȍ6@ 5@@&`@=@И40@A5ATi A`,A+ %Ae2AiCAHXiIAP)LUA3p_A2$mA$-yA"$AF$AhA A=xA 6A'Axf(0A9A=B=#B|qh$,B"7B8-EBh}'L[B9jB\#zB*BP;hB"By Blo7BL5<B=B= BHK3BH= CS5PC4 "Cci,C0&5C09$/-G\"hCG3RG?*xgG@"pG܌2@Gc'tG<9G8LG50GF%G[$G,'G)h`G$6*XG X#HV!  H|s!xHPu*|1H&8H !3HHD~-TH4^HB+oH#@H/dH2HX2HrhHohHV&H;6Hi HmhI' Ih:IL'<&IXi5IEi CI1(HI:0\IfeI8fnI!\If9I4%\I4 IiI@$I#hIX#,XI86I5J5"\JLh%J-/J|3P?J$khKJz&XTJ]6_J$lpJ,/|JL2@J jhJy#J9J*J= J2<J(00J$N%JT/J($KX&KH"((K==K'HKh QK`f]KcijK\ewK: KD6\Kp68KTh)<Kj7K9KH40K1K-LKhhL. L1$&LP&@.LD"4HL,=ZL ebL<=kLfqL85zLd%$L 5L'L'@L$TL$fL9LiL41L,= L8J/\Mt"Mi"M\"7M0 GM!8[M,iM 1xvM4!Mx2Mhu9M\vhM%8Mة(LM5Mp*<M@*NjhN" *N`.;NohHNĕ*aN|!oN6lNԠ3DN(&N$XNd) N`K*LNG7 N%@N((0N`3`O4J O5$O8P60O |@O$,LO&#]O!`qOL3O1LOH"(O,fO8i6POxc#OQ)O:TO/x P3hPx%0P0e$ ;P7@MP<70]P,9$(eP04zP!4P82PX'XP$P1%4Ps!P#$P%"P@=P1Q="QH=+Qmh5Q,CQ|F!@KQ4TQ\/aQ"xQx4Q.Q,LQ=xQ/|Qz$Qt*Q$QK$$QtfQؘ$ R!&R<[# RH"05Rt(=Rܰ'`HR=VRԛ3,fR| 1vRTC+R8&R3hRH3R\iR($R&6@R4R-R-R= S%S`iS=&S,4Su$$=S9CS3VS4\cSHv*,|SԖ&S|,S,Sc5S|4Sf!Sx S$=S Si S0{2Tx5%T(5d"T8}+3T'H=T\l&KT6TT7,eT #oT8T6dT(khT%@T 54TeTj"T6T3$U2-Ue7U9FU7:PUL=_U`"0yU"4UD7hU:xU9U#4U5TUH?,@U=ULeV$,V:V5%V2d7V'<CVN2UV`f]V5llVN XV/9VlSiVhV~1DVX5V44tVL PV%`VS'0VL=VfW@3D W%0WH-`'W*81W|]7BW0/KW,,UWLc'`^W?*uW=W(Wh8tWd#7 W$W=W(<Wd+TX4'X0=#X}181Xi)hCX5PXpt$`aX7%|rX@=X( lX)X^'XH4"hX6 Xv2XT=XT8X,$ Y@'Yd'!Y`3>YM2pNYhph[Y< feYT.~Ypa.xY@=1Y' Y=$Y2:YXA6Y8/Y=$Y@)Z|"4Z@y5Z$%0Z{'P@Z05RZ XZx[hdZȴ3qZ: Zx'Z&Z 9Z,Z1hZv1Zl9Z %dZXfZe)[l'\[*P+[4Ti3[iF[DohW[t;%e[#p[5{[e[Yi[8x'[6[&[54[z-,[&#[ 8L \|4t\X#,(\~#l0\к!HE\ܼ4[\ ",m\D"X\&\X1\=\d]'\<#p\l#P\q3\:2]X7P]f1\"]9,]`e1]<'#F]'O]&\]p"Lg]|=v],#]-]ԫ3]-@]'$]']h] D]/L],*]<~2d^ $x^8T&,^L4.^L"X>^6|K^-3@S^(=f^7^.^x7<^5l^)^!^2\^K+H^H6^@+_0#D_=(_9(_#91_|]h<_= G_ R2W_1Li_$'s_ +5X_%#_H8@_%_) L_"_6,_$l0x_0qh _=`f`=( ` 6T-`+d:`f9T`f]`}2i`1x`+`0C-P`'`$8`&\`~!<`D4l`2`03#Ha "a̓"(ad=6ap#`@aR2PLa+`\a(0ea=pa$$\~aD7aT~1a`4Da,aeah!a=a&aV-ahw4Hbu6b08:bdT&0%b0R75bD fFb %[b Xpb(/~b]9btN"Hb3$bK%|bX'db@5|bZ5bl4b/b=c<3cL-hc'0$c&3c0jlgLj \Vj `j2#Huj-j 8j@(j jHu jt3Tj'jp!j*jX"Hj=jr(0k4' ku0k,o&$k \%|4k8MkD#Pbkfsk3(k06$k#Dk"\k.kd6pkd_$ ktohk1l)<l%8&l(:l"DGl/Zll1Pfl)tlg}l\=!l l =l H/dl/Hlil=l1lr- m=mܾ5 m/3mL &(?m %Lm"cm$whgm;:smP|(Pm$B%\mX7xmI6Hm"m"hm8)tm(Hm'hmfn.8zl=EzfNz= _zf nz .zP!#z<#fz,74zLez87<z &0zĶ2LzXf2,{1{1X{,<6{& D{x^hM{|9%Y{d"r{ܹ={(3`{.{,'{TW3{,{,kh{DJ6{2X{n/@|c)X||3X"|t2'5|/D|l)pQ|6d|*z|)|( |H8d|)|+|rhl|f|=||*l}& }@=$}#,}p*9}*!A}t!J}*V}*p[}d"4s}-~}|0p}<(8}(L}tv' }= }F }A+d}^9} 4L}(&8}@', ~=$~\#!~HE*l8~9J~l.1(]~=s~1~E*t~Q(T~\9~mh~(h~6 ~^*4~eT3T"$L)d=$746HT3HTtidAi|(U%8`# 4,,\h:+dQ+#$)h%0e)<)<5`9fC0*JdC+`T=gH Tvh0 4XxF3L=Px63P݀+ b5x%|h:$'<+0,== TS6`=lG00=$H1(f%"ρt=(݁-d /|~#! -<Ԡ" f0, %7t3hCXgOfZ\&\iL(Hw'$<$F 4'! 6Ăx2ւ$P jhaibh(-6!4x3- A&LL"W8 7ln74z#@`19j4D,V(Ƀ\"h܃Ԕ&)2}(|pi(L8($8&$3Ԋ"tJ(6,U|5_0 9{$$ !6r(8'6̄3f4&3P.0 0&*d+h 4E9B4V,2k*6 ,\6x9Tgʅd"م`5TD%$C#!?*%(%-`3<=X-HO=gx7z,h#f% x"t&,"hd-Lʆl!p߆42@ " ele&f1̟%$>%tL3XZt/dj$lz?:8: He("Բ5ć%ևH%'TdT.<$D)"&h~42-<&H*pY^$h_6'j`|&8wl6Ԕ$D325 $ƈ<_4Ո'-/%p"0T2=,$8̺5F5lR,4t]p=k2uT5l$&u1-L!L[5̉44؉9|&f\j5Ai<X $*e2؛1dGfNl: ]