ELFa( 4`>4 (  DpDp55((`>P^P^m_DO! "&@00Q_: 0/P>\@/ XX@0 6QQO @@( @0 <  B00 R8Р -LT WP^4aX^main() returnedpa   ),@@(LQ 0/,] a - 0LP@pi`a[`VZ -LM`P@pJ@D0D 00``;4.@ -LM`p@P 0 0 0 000  P@XP 0@TZX 0P -LM@P`p? 0X0 S 0N 0I 0D 0?i -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0PU@ PU*00 ,*00" 4 x0\ \0@D P g|p00 é PL5T5P5\5X5 -4!L01 M, P@0 w00eS4 Z0p , 0 Z 1!R,00 )  㒩P,00  @0S0 0@` V *H0zP$ 0lP, 0 043P5T5X5L5 - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `xpQP* 0 P(U:p p-QLM0@`  `xpQP* 0PXU:p p-QLM0@`  `xpQP* 0P\U:p p-QLM0@`  `xpQP* 0 P,U:p -QLM@0 4 4@ 4 -QLM@ X 4h 4 -(L  -(L  0-" _  P0L @ 00hD p-LM@ P` 000PY YR` cUpp p-LMP@`V0 pdp0H@  0S' 000K  c 0H@ 0?' p-LM@` Pu?XP 0s UP(0Sp(00PS 0U 0 0 H0P 0UPp -LM0pS 0S 00 87 "0`%`K% [)0S ) %0K ~ 0@P&PK& [)0S ) &0K g0VS UR Z   Z8,0X12hZ(1,@0X 0GP0 0000S 00  000 000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU000ڼ00ּI05 p-LM@`ͼPƼp -|2LM PRh2 J X 0SH200h0S 22  B B^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZ00,0K,pK !0(@ *pK+KV 0< P202202" -P2$00$0d0 \`000P w],5 05j`50 t 4_ p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@P`}@ֻp 0-LPϻ@0hȻ p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0LS0@0p- 0PP00P=WP`U L    ( 05j| 4(4 4 4 0-L@LP 0( 0( 0h' -0LM@p 00 ` 00 PZpd3 <# R00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pWa0++'0K 'K$0 Y0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 0V D0PT -PLb4p`V 4hW$0( 00$ 0  $00 $00 DPT$0 0$0mi4H4 4 4 4 4 4 -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,?0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 +P0 0  0 S   50S0`00`0 P0 VE00@p x0 Pk40Sh@@j0H 00OK p,P000/` 4,5 -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|Pk00 `0 0Ta2 <Z20V1$R2N 4 4(40 4D 4T 4 p-LM@8P@`4  00 00S p  0S > S 00p000 d`p 0 00  (000C0 h 4 4 4 -LM0`10#0P8pKP@0 00 0000  0 0, 0 004 P<`0 0@ 0 0 @08 @~0  @ $ |& `' 4 -LM0p ` P_㪾0ST  0 PE0 @ @00$00$0 00/A#bJi { i* t 0 P(0 0S  0 Ph ,000i? POMb5 -LM0` @2c1RP,p 00 P 00 0 (0000  ~dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph.000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,`4 M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`K 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,`4 p-LMP0K`Pc @?_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@P(X@T` 0_ p-LM @00P $0`0$0 @R 0$ 0 00  0 ephϵ\_ -LM4@0S @440S -L M$X @R0  l0@ $@E h?$404 - L  -LM 㾟@ヵ 0S@0 @z_ -LM@q R000 ih& 0-LP`,0@T 0U @TT0_ -L MPP@`x &`006 &006 , &6`&`d006 &006/`P@K0 5K$KPT6P6$[  D6QW BQ/ +>4K5 05KP4[S;0;~  ,0} T#`5%#K #K<KP5  [5\# P6K 00 Q0.M@D%D5} 0ア 0}; 4 4 w4 N4 Ꮲg qBᯟ;$0;0p匲3h$V 0A 0$<;   00 0* 0$; 0; 0 0;  `0 0H; 00; 0 0; v 0p 0ڡ; 0ӡ; 0̡ 0bǡ; M 0ỡG 08嵡; 0 审;  0᧡/ 0"㡡;& 0㚡;1 1@ \`0+;Ũ1\;0;Ř1Qx1|1 P0+;h1 P;0;H1 01+<1@ Q41}>; 1+ 2R1R;<;;0;0 Q; ;`"\4444X44+   ` D (4~ 5"_e"Na'(j) -+8 L#8 $ː R2 d X -+8 L#8 $ː R4 h X -LM;`0 5R˖ R2 d 0X KR4 h 2Xxrː R2 d 0X ;R0 ` (˖ 0R4 h  X2Xo_  ;R" D ( ˖R@4 h 0XH;$HT@ 0  `1˖ R4 h :X41˖ R2 d $1X1S 0˖ R4 h 0X!0˖ R4 h 0X ˖R4 h 0X  ˖R4 h 0Xp -40Lː 0R (  -LLMP 0 `<6 0pR(6 R @ \PP  !1 01$0  1 U @@$߰$ R 1 0 +10 ,( 0b@  D P 8 5;  D0 ts$[Q>K  8K  *K  0 0D Pl00l0 $ R간[>0S6[¸ D lK}0 <0 < P ~8 \,<00 0lK <" "o`m`p`44  4<4|4405;505t0p000t0p0 p-0LM`a~ 00@Q5K pOL0,0P@@AT  ph5"4 -LMA0P 00K  00"[80 41R; R 3[pCX#}mW`˕   20K!0˕ R8 p (K#[0 R3K#[101pW0 0 80xL@L0[a= $0   "ptx -KL@DtpP ˗ (0  @DUtTea˗ 8R  #8X KR8  #8X 0[R8  #8X˗ 8#8 XA ˗R0 ` (0P@DtT8< 0  ;R  (˗ 0R4 h  X0X  8  4@4 p-0L M PR`0 PEu @0@0 0S PEôuU;0;d`01K02K01K80 K p,p;P"h4 0-0L PR ;+$@˕<<+0T〴˕@+0T0hu0 -2L M @RP 2R 2R 200!P 80Plr; R8 p (0 hVu ;R8 p (0 Pe`\0  R L8 p {g0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0ASP P P P 8P 8P (P 0P 8P 8P 8P 8P 8P 8P @P  0P 0S0S` (PK?2K02K]< <0(PK U "*D "#(( -L8MP`? Q 3\ 3P [2P7  80Pp.؂˖ R8 p 0X KR08 p X0\  R L8 p fP2 Hp0P0""K0 2K"K 2 R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kl!@0p2PTKPK&U?G  K5KU0 Pp@W 0"K0C "K SS S S R T T T R R R T 0[,PK2KX0000000S>L0,PK0K2K "!(  #" 6S-L@p6 8S `,P˔0S8 #8X0˔S8  #8X|Pt0˔ R (0  PE▲uU<  `|4 p-LM@80PP`0 ( R8 p ep -LMPp60 P a 0? R6 l e ˕R6 l 0X KR6 l 0X 60mP@ ;R6 l (P0 S ;R6 l ( 0 S4xV -|1LMp00  @PHQJDa˔ R0 ` (0PEuU4 ;R" D (  ˔R4 h 0X 60Po?PPl0˔ R6 l 0XP?U<  "4 -LdM⌐Kd x108K0p8K05 -ATP @ 00`W ʙ0S PTp`@00X 8K0 5<5 dB0 " p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 `T2R L2RD2@@{ z <@0 l" h1R 1R 1R111R 1Rz !11{ #1RM !ʄ1R x1R p1Rh1>\1R T1RL1@@1 @ 01 (1$1R" 1R 1R10 0R 0R} R0`y Q0u p 0D 0v 0     -%* C  4  -FML Md̟0`\,0 @ ٩ ; 0`  0ᤓPp ڈȩ,0 S , ;T ;T;T*;T 4;T ;T p|;MPp  pBPp!RH;(K K<+A(0K APp5 ; :TJ :T > = S( =@S : 8C8p;;  : R x x:( KEKl*(0KA04:A ; : R :( KEK*(0KA@ >505 0S9  RÜPpL { t  84PpA5@p< ዖ 9T 9TN9. @RI\0S\%8T 8T?㐜Pp ^ A㆜Pp@]KPE PE(TPpt8(Kp \$8( KT(Q* _H8QU  Q  Q G0PpPp5 0 j7Q7 Q`7(K'Q$ 7Q 7Q x7Q x7Q \7QD7(K R;  ;  ; ;@ ; &(K6 p 6Q 6Q 66Q 6Q6 R6p R 6 6@T&0kܛPpeMK@D @D%TPp[z 5TA5T9*5T2 5Tj o r5T 5T`MK@D @DP%SPp65@ \5 R  Pp)%KTPp".- 0?G  C >4T y4T, 4T(5 4 R{  4( KL$̠(0KMK@D4 @D P 3(K RP@K ! OPpPK! |SPpP [ Q30S{O@K& {]P s GnK@`F `F@&@@3@(K@#3(K 3( KB S {O@K PP [ $3Tn 3T emK`F `Fx"+SPpd(K0 S2( K"QR  Q 42Q 1 ">(K"1岀(KⳀ} T +(0K1Q$ 2Q὚P Dㆹ D 1Qx1 RAa $ 0(K0!0岀(K (KⳀ 1(K 0 R (K L0(K <(K0l0KA AP@0(K01 ʦ`x`4i2i 1i iii" i i i i i i8-71%C i i ii5i i i i i A6i(i881  -LQM; `! 0d 5@970 3K?3K#K<K ?;'K4K DK$K 0h7h4K04KLKK @7 0%K5K?5KTK 7'5K K%K\K 6&6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK; |@l]XvPK@&@‸@{m46@`@K KK;KK޼ 0@T 5 R% 0S R UAoK@@@&@W@K@ "`@ቼ 04"0K 3K03K| 4K84 R 5 pp4( K-K00QK3 ;Fn>PCP 0nK0  P+`!0+  P;`! +8dN5~ @05%p3+%0a><0((3( K$S0BSKR/K00"2(K UK >K 0 2"#00 2P 0S P W_KVoK l2 0d0`2(K!0p<2<"Q1 "W_K(KVoK01(KOKN/K00 0JPK&@;@,1@K@ =KMKK᛻ 0`10K8KKK 0010!8K 0(K8K 0K;10/K7K'K 0|K;t "   : 544  *! -  -LGMA0Sp!, 000Y 1 Rx10 S<0K 㮹8K ᪹18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[9,0K 5KᎹ <L40 B(@$[I4[Q04KD 0  0000 <  L(@ B0 DPp 0 P0 0C0 0 d0 R 0 R 5["NK :tPp 5["000` 5e=5" 0-@LP,i 0 t00t0084" -LM8@@ ;( 0+h5" -L\M4@KP  03K2K [ R 0 S  R R2  2  | pb0S  \23K@2K 2[[3K2[K3K г2qK3K0"[2[b1!1[!12āP/ 1Q# 1!1nnDF`d N`<p1Qc[S[s[ϠNP!l H 0@["[2[ ! 1QQd@K&}0 6K06KP`0[@S^0[.S[0[-SX0[S_[]0[\ [ac 1Z[1!!21Y [00:C5>C  0"Lh3L4 Qh`4X4h44v'N$ -LM;`P(0Bp S?l ( 0 @ 8 @ @ @ @ @ H 0H S$ꠂ    000.MP@+eP ᾏl0l 㳀pT0 R    p-LM@!0! 1P` 1 R x1  , RT BRP1   R p41 00S 8 D D D D Ȅ Ԅ 0 8 0 \ 0 *dp0 ^0 V0 t0 h0 \0  R  R40  R; 0 0 " 0-MLM@P800000|1 R;  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽̆ ܆ 000000000 "D -ML M;BKI0 I| 000CSu D R0T p0S^XPpڴ8! #  1  P`C P`=04H8( K81BNK0!@@D(0K 1  P`# jP`8 0(K 0$!  0  P`   QP` 8L0  @ T JP`@ " p-LM;̀@( 0 P `  000傒 0S`V@PpR 0 SKP pppx` -<0(,0L0  "0 0   p-QLMPC  R;`:; ;!:;`000 0P@ V p 0S`+s է 00b=C4`#hx0  1> 0P@8p, 0, ; `p""84 0-0LM P0 0> @P`0˔ R  ( P, 0B=C01; 0000" R-L  0 0C SE` ( ( ( ( ( ( ( ؍ ( ( ( ( 0 0 00 0 0 0 0 00 = 0 00 00 t0 0` 0X 00 L00< 00 00""""""""""""" 0-LM0@PSh   @ P P P P L T \ d l P 0 8 P  P X h1 \1! 00,1 @ 1111 @P 1-@P0 @ @0 000 00= 000 000 x 00p0`0\0 @ P 0@P<0< @P"""""""""""""" p-LMP\` 0@S0\0S p  d B 0000 0-P@0@@L ˳00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S 0`4 0-8MLP@$t0 R 0s? X0  @0p  R0Z0x0 20h鋫 4  4 -8LIm(P"L(@`p"`0  S  O K밠 .颈(4 -8LIm(P"L(@`p"㿮`0  $   밠 s(04 -LM8p{s/000, C`V( >8c@0S91!@P@dDFA 02 S&h1b1 R0``00`Y `0;,o@ R }2y@TZ㒆 @ @dPʛDFA@04 Sʄ1d|A R@0 @000@0 @ᯛ@l,L  G~L"`P"`84`t5L4l4 -LM]㔛P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  o`Z00 1+ 8`  1R010000 0 !0*0!00 0@@" .`n 8` 101! R00:`O 544 p-LM0@] PR0000 0` !*!0S00@@@P2 ph0 Caש5gfff -LMC0ID`}@DpD20u? @$ R00000   R 0 0 0 @0S(("@P嫚@dDFA@04 S1d1 R0``00`ᓚ10C1Mꔀ匠@@dP党DFA@04 Sʄ1dXA R@0 @000@0 @ j@'P"`L"`84` -LMp0! 1?2c!c2cOp@mP0`P0L BUF D㴬 @0u?   P@0u? 02#u 0 @,?@0 0  0PP0@S0 0 0P 101  LH0– D *P~H5` 5-0  t0 a1a2cP  0Q P 0S!0S~H -SLM]` 0 P ʴ8U0N0  0A 0  pK0K@K @y0 SK 0K@oPZ Pp 3• {P P; (3 p,\(P3   "NI  E AI- 0Z $ Ӳpڨ K0 KS& (2 R RF R (pZ (p@\ 0  @K!1@RTں1H"01@<2P @dDFA@04 Sʄ1dA R@0 @000@0 @0@0(p}@㱃@0S @E@00K@Tڴ( T(ט@AP0S@000 ̘@0S  @0 R~Q1ᴠ01(s? ( p9!0R ʴ8 㧘 @?p៘W(p$X= Մ 08445(4D4 L"`P"`84`t45`44 -LDM`MS, P` d0 @+ھ00 S0 Lh `0 d dpK [K!`K 0>P\K`K  80K3Pp 8\0[ R 82 ,0S ,凩{͆ 0\[ { ᶰP:PP 1 8K Prh  p0S#< 8 /L(@1I͆ "^`   ܮ خ`0h `K `0`0 p` 0`0 1岐`00`0 p& h8 <z01 R' h0 h  0S !ᴓ 8 0 12 ෦8pZ!8 8 h 8ppB8ڃX;IRO0 B`0 d )`44 4( T45|444 404 0-S@P L0P 8  0T4 0-S@P L0lP 1 08 0|4 -8L`@P80   4020! @ 40W1I H  !1"2!1"2 0\" R03S SV㬂夂$  #  0T2SL129P?  ,0 S ,pƼS @0HQ@Q xp 0p0 R, 0 0 H0S H00 lK H @TP0 @TT000 T0   0T0Hp0H`5 4 N -LM@㣊p0  0p0 p-L M@㓊0pPt`x0p0t0勊880V @U 0@@%pK5X44 -PLM@D 0R@ 8pkP堀`U UJ +<W0  p0 oR0 0& JU*嬠`0 x p0 0RTp0x 00 h `P"U:@0a#0400 T555 -L M`84PP㈠ $8 ,    $`  $0@S p$@;0 , 0-  , p0 0p0| R,0HA, h0@"20S  $ 0  `0`S  0Th0!20, h0!,2P0 000 Tlp @啉0 0SA 0厉  $ 0@.0T:x t0 0Rt0x  $@s0Tae0T, 0 0 000 TD0 R +000 0pp0 Gꄧ555 -LP `:0piP $  $ @$@ 0T_ -LMP`p }N $0 @T ,P80 T00 0 }N $0 @T | P|@ mЈ $0@@T f 0T 0T_ N -LMP `p@᪈ 0To@0DD @T0 T 0T 0T @0T0 T $ip p-L M0 K `0  PP pd@ T \0\@PU HPH0 0Q S00 4 0_]_]( p-LMt`t0lP P0P@HH D0 0S0b$0@pq____ 5_,4 -LM℠Pp@0 `V 0 =8808 40P( (0p_5$`___5 0 __0 0 __(0 R 0 R__ 0-@L 㷇04 00P0 T0h騇 -0删S@04p@@00  LT5 Q_  $  0P T  0T0  T 0Td R  $ P0 +P0% 00 R  0 T R R),  8 p0 S0 00 0 T  $0@  T@0  T0@ 0Tß#00 S Q0Q3 r 夯T < x ~Pl 8S080m(0$04 40 Q00t000Q 00e0@ 00 ~]0 002  R |o0t 00L  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0%0  T  $0 0R 0  T!0  T  $P  0T  0T $ 0 0P000 Ό0 @0 0 h僭`倭_H4]( ]$`X4 @ h4|4444444_(444_'<4X4 -LM0`4PY 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 -@T ZdWp}N $0 @T I0S\ CpT  $0PPpT W|4 Q0--0L@P  Q 008S0@ꪛ  0-8PS@L ␔L(K0PP5 p-L Mh@V PK 0P ,0"  000(^ `08 00pp80 -L MX`U(pK 0P@)P(,0 0@00(PU 0HZH 08ݖ0$00H  p-LMP@`F 80Hphք -LM4 < @@ S!78 ,4p  B8 6P, 0 90>0P`*@D S : R#: ,Jc0 ߙ@`p`B0 Xp0C$ 0P8 ,04 0 ™P@ 0P0SPP`  0 0B@$B -LMxPW$`K 0P@)Up$ ,0#  0@0(0(?^ H@?H 0p8040 0. p-LMP@#`8 0Hph -LMp, 嶬h— lp2  h2l ,* B: @P0  ᜬTU  啬0\20\2 0``V $0Z0``V &0Z>❟ ($8 0VP@ t2 |,㱕[03nP @ 090dP @ 090ZP@ 0`90P0F?0P!M 0V90"$`0>V 0<`2|"`Vh—`lp2 ` h2l ,h—Plp2 ` h2l4 ,0 h—lp2 ` h2lH ,4 h—lp2 ` h2lL , \8 ,P  T81S h—lp2 ` h2l ,h—lp2@ ` hR@l0 \`h—lp2  h2l ,`cV\\hBlp2  h—l 1\UhBPlp2 P h— ,0l\dxhBlp2 P h—l 0\` th—lp2  h2l ,` Va @`1`>V h—lp2  t2hB ,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h20l8 I,$I00#N>C 0ChR0l lp20 0, Ȅ 0   h—l004 \@3hbAlp2  h—Q0l@ \hBlp2  h—4 :lH \hBlp2  h—P 8l\mhBlp2  h—lH 40\hBlp2  h—l80L \40#J` PDh—lp2 P h2lH ,` V P x1@Tp!0040`THPH̀0L8 ၐh—lp2 P hR3l1 \hBlp2  h—l ,0\dhhBlp2 ` h—l 1\`VJA"`V@DZ@p+54X444P54@%I$p5!540  -LM HTe | H0S 8$T| Rk@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPpUU U mteh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \2T00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\hBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\[hBlp2 ` h—0H l\2I 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 R]= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 彧(N@g:x p1@`X奧hB lp2  h•l 0\ 呧} `\80\8P`\(|0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pL,48 !5H4t44 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@Lu~(PL0hj~ -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p唥4 -LMT2p0T2*~0H0,08,8#~T $PU 0SSnX@Y 4P$U  R00R\ Y "0ST20CT200`3 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0}`}0S R000R!B6S0 !0^@PՌ"Q 00c0 C20000#2x}`}$0S` 4 00hB lp2  h—0l \Z0 00l}`f}K@y$0S  -LM`@(0 S4p8P'P 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@ T 0 0 mTph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0PW0 QhBlp2 h2 l,3 `VZ00h00S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`KP, @ EP@ $4D@08 8 <2 00 $0880, T4  ,K4 <0o,0P @, k4040<0<@   140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $p|08 08hBlp2`  h˜0l \0S 0 R {P@` ֊X0 P0 ,!Ҋ ,(0=!5Mb0 0  Q-L 0S S 0SQ 0 0 4-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@$! 0-L@?{P0h7{ -L M0"`@0TP, z> ,00@ Ri PpB Y4U P0 5 80 0$,S03( 00 0*  Y H!!!!0!<00  qP z@"z00S  W 000or000z, 0r00  o" YP 80(S"ˠ ʠ0S80 S0000 555Ԏ555 -LM04`@Pzp#z4ia -LM@P0|14 RP80 TbVX1 RLѡpzpP☉iz090 `z1 p 3 0 `媄PzOzL0$ pR` 090n o?z0 #>VS @ $0S Z00C*zpPRO !zx`44 p-QLM@`PpᏐT 00 @DRT0  0 @DRTʃ0p -LM@ P 0h -8L9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳!l !L!L!L!L!L! !L!L!L!L!L!L!L! ! !!\!!!!!!hB lp2  h—l 0\0ISh— lp2  h2l , hB lp2  h—l 0hB lp2  h—l 08 0 S`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0gP`$ @ 0A,(0"A 0 P `4@  D 00pt(04 0,08`090ot0  oF`40 0P  -LMP@0t0pSS 004`090LP40S yt utp0( 90 iit P40S cti|4 - 0p`L<0@@pStP4Lt 0-0L@P80h -`V`V` pP0UL`p` _^@ᜆd 00S APP U 嶜h^p5__44 -LM@s0 00\ h ꄏ5 0- 8x 8#T0%PLT0AT 0S 0* 8R(0 4 __ - 8h LM8#0!P @0 A0T S  @0S  __ -L M @ 6@ `鰺"6! -L M@ 0@_鰺"6! -LMD0P#((0"tP1'ATN T0SKȀ<`(ᲈP 04000@`;00ns@igs0S 0P*0SSS <`00$0P$0S i~40 <8dppԉ 88#0 p喼44WEV6! 0-@0P @L fP 0000P05 -LM0s@S* 00 0000 -LMq`PU @ 0@}|P6PU $00<0$0@T0 P:00 r@\ r004;0000 `\ @1@!0 H P@00d@0 H H鈏54 p-LMPK@` I10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$:  -T LM@HT00  (0R 6ꐏ55_4 00ᐏ5 -Lp`P7@T@ h R(( `@ pp00 445 -l`L@PTp P 0S `@T$h0T0 hꔏ5,4 p-T0LM@PT` P 0S @Tpp锏5 -LM@h 0-pPL0S`0@T P@T00020#J꘏55 0-XPL0S H0@T P@T000 .꘏55 p-LMP60@`TL  (`0#pmp4 -LM@ h- -LMx@0SlhSdQ@T BLP0 @@ D0 ,>@T锏584L4/44h4p#(4 -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0Q505 -La P00@-SP@  0P PR  0S0P 0P 0 -LM@QИ 0Sx4 -LM$0p@$0 P`y Pq P $ $0S $fT` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !P! @KKP00  00`` P 00 0ZKPPKdx tp 0,0 `K `(44___5__4444 fQxp##4 fQfxp# fQxp#0 R  h`44 ~p#Q0 ^x`p#妍p#0  5 5 -0LP4M 0X 0T@K@ot0 Rh@& P`00TїLL00 R 0X  ė_____5(40!45 5 P-L 屗 0AP5_ p-LLMHKP@2 H` P TDK01@ T400 0 ,0( 0 $0 0 DK|偗pDKP@@PK P  T@P P0mp$ P 8!4H!4P!4d!4(4 - L6H -L1HI -I L+H -L&H H -L HH -LH X -`LQ 0R 0 PS00U@ h p P 000T@0@S 0U g`a0 -LM|p# -LM@, p    `P4` 0S !1(S! 0#!!0 V000 8` <` <P0SI <000I0S`30  4 8<0(0 Q8 <0 ZY  !Y *040S R:  0j p ,0 d奖 <000 P0 `P 0 11` R0040  |!4!4!4!4!4!4"4"4"4H"4 - ` 3p11#XLP@0XS (PπP 3X0011 !4 -LpPPP T*0 S@T:H P p@-PP\`@ *0S \:T p0Q:0cS*S @V V 0#2 0S "" T @ 0#2 0#2 @ p-RLM@`P uP000U00p -L MP_P T*`0 S ` 000CSP!P!P!P!+00 <0 @ @T:`*0&0/0X^ 0-L@\Px $t@ 0h4$5 -LMRP J0,0 @pT ,`ZZ2PP I0D1S3R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!R!S!R!R!R!8S!DS!R!R!PS!R!R!\S!R!xS!S!S!R!S!R!R!S!R!T!pP@T P$ 0@^SXXP  <Ppp   p y r R 0BP ^S b x [ ` T H@ : 8Ȕ40PV_\"4h"4l"4t"4|"4"4"4"4"4p#"4_ -0LS !!00a0CS(U!4U!@U!\U!4U!4U!4U!4U!4U!4U!4U!4U!4U!4U!pU!4U!4U!U!4U!4U!U!4U!4U!U!4U!U! h鋔 0A^Sll ` 〔 P  D < 4 (꜓5p#(4h"4l"4"4"4"4"4"4"4 -LM @ Yh p#"4R- R 0S0 \R000Sa@\ 0-LMP* P@KP*0@vP KqP00 ~P w0 0   0%0 K]PhiP TPP~PP 8<|~PP (v~P "4"444_DA4\4@5 -L@PT`p@Dt @ PYP TP@Dt0P__ -LM@$P2 P0( P) P0" P0 P0 P P P  P p`V P 40,P ____"4__"4 -LM@P P hPP  P 00c0"4 -LMp KP0@ PS@6$`KzP. T $0   $PU! T T @ 0 0@ PS@ P  00    Z$PV P#4"4 p-L M`KPpa0@S@ PKPT T K 0 K 0C0 N0@S@D00'"4 p-L M`KPp60@S@ PKPh `RT002320 !0@S@00 "4#4 0-@QLPJ@TZ0 0-@QLPJv@TZ0 Q-LPp`@00eT : 0c00e000V00eT:p00e0__ p-LM<@<`04Pc0c000p___ 0@-L~St`!<`!8f!`!`! a!8f!f!8f!la!La!8f!la!b!8f!d!8f!P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P__8_4#4H#4T#4Г5_d#4 -LM||`P0Ulp@{0T UPe + PUP0U00 P55ē5 0-@PLP  0S cP  P h 00C0\@P 0SU00h_0 qPP#45#4 0-L1L0@S8!0CQG!0D]S' T T T T 00h 00000P@z00 0 0 0hm p@x0 0 S 0CRL000 (00  xȓ555ē55̓50ḓ5 0 0 lQ 𠱣̓55(4 -LMS@ \00S SL L0L L0P 0^0?l 0֍ 0Г5#4#4#4#4#4#4 p-LMP@PLU` ph|8`y0 ,$0pPp X^#4$4#X4#4 -L MP@0T(*$K(pK,`K$$0 B $f , @Q h0( \$0T\ -(0DS<'0T:,0Hx]p]8$4<5D$4H$4(4a -PL`i Hp:P@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 m4 S 1!0S 2!8S  Z1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@峌,1@@DT$@D⫌TC 奌 00CS0 00CS0ڸ0 R双)勌00  0 00Sv h00S 0So P00S 0Sh Hpf____P$4D65(4_d$4ؓ5ԓ5 -LMp0@SSHP S 0S iX 0  nPti T`0 Q00 28 6S Q 000__ 0S00l_P0pQr  8 80, ,0 0_______D0<08 pQ(0 0______-L0H D0pQ, ,0 0_______ 80cR   (0 0 0_____ p-LMHP@ # D T h0\ `` T` T0V D0\ P00pP 0ԓ5ؓ5 0-@@L08PS0S00000ؓ5ԓ5 - 0L@TT xP\ lp`bXd0 4P 0S<00hQp hJ4a5,5_h$4l$4|!4 0-\L@P 2S P(0P2 00ܓ5$4 p-LM`P`@2S@T<phuPT0"2 000pܓ5$4 -LM@ K;40S0:00A0 R0  $X^ p-LM`@PVuP  0S  pJuP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$tPܓ5_$4 -LMP`@V 0FS \o]P oXDxp0S  SxP$4%4 -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP! xW0`p0@2S @T:0T0 P0(NtPܓ5%4}!$4 -0LM pR K >TP@`2S@PT P Wp 45ܓ5 -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5_ܓ5 -PLPM`\p 0K@  0SV 000_ -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (rl RW xK| K0P x| P@hK0@@ 85`<5P5%4(%44%4 0-LM(P@ 0@?0_-00 C_ -L\ _ - 0L0S _ -L\   _ -L\_ -LM$@T_ -L\ _ -0L0S_ -L@PMK!P 0Q0SH 0 90 RX7PT又P午H劈@凈<<0 4偈a_8%4H%4_h`T%4%4(4%4__&4 p-LM`P pP@0T:tPt@0T*drP 0 @T:@p0rP 0 @T:L&4|5@5x]p]_ -LM@KP -LM KPK -0 SL 0  -L \   00 -L MaPhBKP Y PS@KCP QP,2,)L&4(4`&4 -T LM@HT 00  (0R ȇꈕ55`l&4 0 0ሕ5 P-PL` @T pP 0S @TP@ 0P0`0 000 $m鑇0S&455&44 -p`L@PTp ^P 0S0W: ` @Thl 00hꌕ5,4 0-LMl@0S`0hZXXPU I@P@D ,, @H PU0錕5&4&4/44&4 -LM@0h 0-LMPKP@@&  h0 0-pPL0S`00S @.0 . 0) @T0B,000逕550 ပ5 -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@錕55 -LM0PhS` /S+ bS` `$pK 0S 1@x $ h奆$ BPX @ @0f0P,`lS&4p#&4__ '4 0-LMQ@<00CS ꤍ!ȍ!Ѝ!؍!!X!`!0 Ha0-0P0K0,0 6aPT Q 0QP0 R000(P$0Г5̓5ȓ5ē55@`55 -40LM @R ur7 r] 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@a@0a S_R@ zThn3n3 '4$'4 -L4M0 sS, `@HKTI   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SA o1 内V@xq n0PS`LK0 PBTU@P !0001 ,0S ,n&pX T KT@ T0cP T K0T0 0X PQU0:S000 S 0a0CS0000S _0a0B`F~00C ZUS` ``('4ܓ5<'4؎! -LMtpP ` PXu  0S %D@ @0  $`(`] -LMP@0`p 0PS$ KP $8P0 %D@@@0 Œ000$`(`] -L0L0P 800P 0$0Œ0锕5$`] -P0LPl<00P  Ġ 0 2 0锕5$`] 0-LM^P@ Plx0P 40`0Œ000,@0S OP000bt5$`],0,P 0S0ߤꔕ5$` -d0LPlP0P  404 02(,ꔕ5$`] -$0L0S$` 0-HPL0@S P0 T 0 $` 0-`0L @R LP0@0C000PS T0000$`5 -@0LM\0 @T $` -1LM1\@p !P  eEP] 0|! P?@0L0  0pKH l0 p Dp P@0` K0P@>`80S @X E 0 SR@ )EP` @` P@K0KP0 `KP | tp ` P x P0@``0 E` `x`H'4 -LMO, ,0I !0I!hI!! -LMr@W,1R2p U8`40: ?㳀Ϡ@4/00 000E ->PPY( cq0 S|0 0t0@0l05F\s;F U? ? ꨮ!!!!"\'4 -L3 S   -0L"R"0 03S 0-L@3ZP30h*Z -*.0PrLR`L\"0H@Tx"$@T2S -LM@  㩁000h84 -H3L M 80LbP5(3, /003 *.0 \"0T2   0""H0T" 0T" 0T"  0T0" T2SHB0h" T0`" T-.0d" T" 0Tx" 0T*.0\"A0 TP@`"0 PTU@4pK P@|"0 PTU@4!40*N000x" T0\"0 T0   PP"0 T0" T2S0\"0 T% @ %5;5H0 ,0S P,{j" 0To`l'4 -LM5=@S 2/0Q{ @T 0S0000! B!1p <Pf? ˜2 \$Z  Pۯ0᭟0 (<U!<3?"PH1    Q $q*.LBPb0P\"0T 0 0Xl"0T%8p"0%\Tt"0T*.0\"0T00("Q 0 80 %l\35;5x'4 -LMLbP@*^0B0\" Tx" $1 )Rc 0\"0 Tp1p!”0"c\TM , K 4+[0[^0'0c "*1-.0a0` 0 A S0AĀ \!p0^:-0^* L("(P+ [ 00C0Q0ԇh"0C0 T0)S 0< 000, K'4 -LMLrPP8`*N0\"0 Tx" $  0x" T40  x"$ 0 x"Tx"  0T  2 R; 1l00l02S' *.0\"0 T x" $" $" $" $l00l0Op" $@Z l" $ T@t00t0x 5 x ;D %500C(0 $1*.0P"LB, P\"0,T0 0 0Xl"0,T%8p"0,%\Tt"0,T*.0\"0,TX0?("P< 00 %`l" $p00p0 -PL@`W1TpT!T7*1T" 1T p V%A0@S S  Pp5@05Pp505 0S8?2Sp T 8QD4Pp5@p8Cp0T d0TX0. @R\0S\<0T/0Ep2i 1i i i 5i i 6i( (0-"(L8@SPP h0< 0Rh00hwAK1l00l00 -5L,p`0 <5 00 R0 RQU@ P5<5 i0S  C 0  U@P5 <500 R -LM(p"h0V@(wPP8  !1 01$0  1 VUp 0(KV`@0*% ,0SIV',0S 0 000C b b(0"HT@! @—\  0 0d8#hP, 0U@6w$U$ R 1 0+10 (,0L”PP\"0`PTL2Ph"$$0 0L”\"P0Tp#00L”Pt"$@ 06 -8*.P@0LB``LP\"0TL•P`"0TL2p"P$ ?00S SL•0Pp"TL2Pt"$ 0L•@0Pt"TLBP`"0TL•\"P0T -LLPP0 TL2P $L2@P @$@T# T pL• P0_Th h0 Cd`@ 0@CTh4CT T$p0@#pp!!5# -LM StA/0l00p 0X0 0 @`00 @0P `p`S`x` -0!LCM0KoK,0 +Z1IK AT@# SA/0萟0C0 0p@P000h   0 0 0 P0U 0|0`/@0P`0`  1S[PU0 ,0S ,d`````,(4 -< L0S 0ahcb`50`0 ` -LM`@^LHZDW@ 0-@PLT:0IT: p-LM`PU p@ 'b #b 00 0   PPePeH0   R00,```H`t!0`!````` 88#PG-Ax= p0 0C`[%[0 bvb3. P+pg "+!U! ˠ  @ 0,ˠ . 0# 0# 0#0#0#0&, H!0x ``n3 -2LM RpbBP0K Y 0 ,0v4 0ca bP`\lQa P P!88S Q4  40@040 4 @ 4  40@040 4  4 40aA040  00bC2S0c0S 4 P1P@  SR0x R0+A"RT10 0S8 ; P p484 0qcp=@0 <04p<@P`40\ 0L 000K0P@ L\ ` d `5`L"`P"`84` -LMPp` @b (K0P@ X( H0 (00({00 -00L9$0 K0 5@`D`H` -0LM||p@P!f0  P 0T P0U$  P x`@`D` - L| .601 R 0S R R @ -30S@`D`0S R00  -PPp LpQ  ] -`L@; 0S(0 @@aPjKDFA 02p Sb:p 0 S0 0 000 NK 6!0 0L"`P"`84` 0-LM0@99 90:RP9 HP0SP U P09P[?09P 09<9 0@9@0909 09090909090@909 040 0$ 0 PR0a/K -0LMR`(0 P1 HP0SP U (P;P5 ||=P @ pP  @yP   @q0 PR(Ka/0`( G-M1vΌ \0000 0c?0cll0 Lb1a/"ba0l A ?#όO$/LNpBNa|P0PP 12c!b  <`C<2c2c!dV!B0 Ѝ*Q989QA0!0Q0CZ 0-LMP@0l0C0K00K00K0 0K0 0K 0K0K Kz0@-0 @  0@- 049 0@ 48<0 0@ 4 8<0 0 $*000 0-PL@nr 0hP(4 -L M, 0@000 0 $0T` p,?*Z2V/00Ǵ`0㸑 P Sa!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!,!2P`V  ]`0p0@00T:$0 p`,, 0S000  $0,0  00a 0 P22P2pf`0pf `㜐 _P2 q2P0P 4h(4@`H@` -0L@dap SL!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!P$0  ("Q *0$00 0 e0b 000  _ 0W0 00000`PCpP q2P0`P 4(4@`H@` p-L M$0P" ` a da!0S$0  S! 0@0  $0dp$0 p 40@-0 @P $0(,# 0000CP 0$ 0x00 p-LM0@S`P0- P$ P00 |00 0 0000p|PZP P0 0 |00  |PZ O@- @ 0p`P$4@(8,\@800 000嚿a@  h @0 :l D@0@00 p|04l 3 000 Q00X1X1HS\<0StP" TZP0 04 8< 0Sp 4 l0R ,>W0ST@0L 0R, 00000)?q@ R0`0W ?0L3 R@F @0T  L0 3R4 l0SD 0@,@K0 @0 p@Ps?@dDFAH 02 Sʘ1b1 R0``00`H[?r*4 l0S )`VK5`L"`P"`84` -LM00Q   0zfE -PL0@ Qp`:@#R D3S`D3@#0CD30  =P?< p-<1LM@\`0=S`L RB?   BR R3 P0S&0S V0/0000 ?2΄ !B00Up?` `! P2 BPUQP  -LDM4 0 0 0480 H  pD >lVH0@L0 PP0 00 ><64&460s4@0S@3 0#2A TL0 bTX TS%T80BPPb> `RP 00@ X>PP@SL`Dcp`P(d3 `H UH ղ0 RX  H ū 3 0!0U0H0 00 T042S/X1S; O,UQ- 0S"  X1S00 0 d *0K!~*0[L0X!R H H RgXpV !G!0S !0S !N* K0QZ*0[0 R   F꾸4(3@ S:/0K80PH ,1,!@P4= @dDFA p2 S 1b1 R000K 'M'P @T T  T  T T T|  Tt  TTd T\ T *'mh6`P5`L"`P"`84` 45`06`6`7`7`7``8` -LM`PX1SQ0 C1  0$KLP@A$ H 00S@ 60S; ^` K0P! $!0S [ 8;@4_0 S:![00b0![000![00b00S <_$0  R*0 S`%*t` -LM@ ) -LM@   @# @ # -LM@p\P8T0AQ `6TP ^ ~ |0 0D 4 -<Py'<ppWT~H<NT@p004p;00<P^ <hc5)4 - Ld)40@i#00CS"""l"""""0 X1S  0%00 ; < 0-L00P<0 ,R  0R P l5T5X` -LM@P0 @1S<@0 d0R0T 4S 1(S0S1S2 SELF-|0P0h 4S T 0S0 1(S0S1S2 SΕOLFp5 -L M,0 0ps` Q , a0. 0c0cbc0#1 0 0000 00  @ >0^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  \*!l0!X0  @00@04 00,00S0c,00,i0C."/"0" p-L$M@P0`   K0`!P0Sp -LsM , `Dܡ  ! 1 儀 |` Kp;PPȁ ́ @80S P10 4 ,0S p,K0 0$PPT0@ 0 0PP`@K 40PPoP  KPPC[B E$D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ 6P!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0"x"x"x"x"x"ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0&X $ܡ  h6P PQ6pH0!>0kK1 ̑  c. . j?K!#[ ̑ -`)4 -L,M 0 D 0 ) K3S`@ gP1D RBBA#p  0@tP@01 1PP"0PS@ UH3 410  03@ 0 @!P P) [R0 0S2 @ TD 00KP00T00ST)0[002PU52 0C4 < 8 @S%l""""""""#"$"8K 40K0 ? 0 001H P^?I X,wAB*455`t`L"`P"`84`*4 p-LM@P0c0? . Ad`A L 0P? `p p-LMPU`% *@0 PR@ U: @0\0 ? 00@p -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV a\Pp  @ Ȍ qΌP00 ``0P@0  -L$M`. .\@0  @,  @O0Pp@ 0P 0  00Pp ,0R   . . p6 -LM@. .\ 0P p`@@ ȌqΌ 0 p-1!LM1! @00> 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0Pp0" -h5hL$MCGPP<]z&kL lۓp4!ںv ş00S 0 0D 0 `8 R08 P<0 < D0嬔0S0 0$@`D0|4 ,0p4 1 1d4 l`\ ` /KH @C@ 0L!C"F|$0S P0S3@`zl3 렂$EŸ 0  uP@d\0S P0 @"@ >0S,3$20SP Ÿ b @09@00 PP 000!A@0q0@00 P 0 @00@0 0t! P Z 0000ZPR1 6P_1 .PW0 &PO0 >x``0o34;`h`;`|=`\```Й52$*40#<#` 5`da```aha5`|`:",*4f`8*45ș5@*4v`t`T*4H````<` o+l*4x*4*4d<"*4*4T<"*4*4D<"*4*4p+*4!`5`P,404 P D\ZM@;0PK0KX90PK! %K0@@T20@M>&$ -@ LHM0, X 00 TK0P0 T ( 峼P0 S$ o[m[D +4+4D+4 -L: ,0P  -L M`0  P@C  0S<0S90 V5*Y/ ,0(p0,00V, K PP ,0( 0C,0 U b,A:,0V0  0P00` #V 5,4 -L,M@ @PpL PP`f ,00,0 RIJ"K"K"L"8L"L"4M"M"N"O"0 S70S4,5 X0*(0P0 D K P P  ,0( 0C,0P,9P   D0*P,0( 0C,0 ,9,0( 0C,0,9 0000  00000 8C80C (0B8 H@K 0 0 00H0  0P0x@0H0  0P 0 00H 0  0S$0<   0H KH00c0S P0`0?P D1    0 $< 0 @ 0 Dz0S u@K $Pm2[S 2[8SS C8S S_@  @0KUPV@K @ K 0S40S00@0K@K 8Ks @K0S@0S@pK $fP(2[S "[R R0 ,0 0,0L 0 R0 0@@ K 0S40S00 8Ks 0S@PL  5~f}fwt@vt -L pq@P? 0aV,00,00000 ,0( 0C ,0'V 0V@ ,0T   1 2 1 1s 0T@1 21,a8,0( 0C,0 ,V8 -LM0 ! @ Q 1Psbp 1 81 U J0!'! -LM@!pPW. ,00,0 b 0Q 1s 1 01 U ,0Uio}   1 0 1  -PpL(`0S @ x@ -LtM`p됀KP@  0 ,00,0,0( 0CP,0,U 00S@P p P7 -LMp`PP* ,0 0R,0 R0S<``0,0( 0C,0,7-`$@ 0>  `h  -L M, p0 , 0! P!4  Y !Z PP0 b Vg0EEW  c03PP CB@Dx8 X0  R@0SB4  c03P- CB@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T 5 -L Mp 1Qぐ2 A' 0a LBf=`  CB f= RH02 0"2 SA' S', z0 00202a ,B,0@f=00202c0 B00Pf=00202S,00000''' -LM@`p PK 0S Szpp1 Q300TIL0P_=0(0 0 R 0S00PP 0 0Q 0V  000PW 00,00,0 0S00PP@  0^ R1s 1 11 ^ PR1 11 ` 54` `4 0-LPKI@=U(   @00@0 R @00@002L0020< 00 ,0 0h`ę5 202 -Lp<KP< 2A R@00@0 R@00@00\2f<0 `P0 20BT0Ҥ 0 ' c3' ]B `@AB @!C@ @,0s @` V 0S 0S ` V 0,04 0 8 ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV'  0 h` -pL2`0C(2P@U R ,00,0 ~PU@Z000Sl0202S_PZ PU0Q,8Q|h Lp1p!@P@d)DFA@04 S`ʄ1d8A R80 800080 8l)8)0 @P@da)DFA@04 S`ʄ1dA R00 000000 0F)0'''0h`L"`P"`84` -PLMP`= Q ,0 0SW ( M 00CS 0,00C,0,0 S( p,@0L!p[3,0Sʸ0  0S 0S@ R000  00C0zK@p0K$8K @㲂Kp@ 0 㴂Kj,0,0C,0/4p0K$8K@@㲂Kp@ 0 㴂KP,4 `4` p-LM0@CP3 R.`P(0K$``0KaK`P`01K!K 090 0 p 0 0pp`aK0 90 0-p p (("\ -LMŸ@,p \`P 3 R \0R Pl U. U  00S# 0s 0P  00 0101 1s 0Wp1 21   P1 1  0Q P 10 1 1s 0 W 0pV ` 1s 1 2 1 Vg1 211 21 x` p-LMP@` T0 @ Tp -PL(p`@0T 0@T  0-@MLDPD 0<PG, (@0P@G05 ,4 `(,4 ` -4 L014 s$ 08000ȣ540$ 0S00 Q0 0 0S0040$ Q  p-LMPP` 0@ 0\ P 14` 01! 0 00 10Q p,0  x`(04 1S01 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  P000(0!0 (0p0 0 -LM Kp$ K`PU0  0 00 0H@+9P@ 0$@$  ,0S,P` (00(0 ,00C,0 (0,02 `5 -L$M`8 +P 0S ,00,0P^P$< B @ P !!@4 KPP?4p P" @0 :0GPUp  0<S< ' 90 P  0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,10@K PP@ -LM0pS,p @`PsJ ,3Y 0S4P 8 !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 %80` P (00(0* %  (0  (0W  , %(0` R0(0 % %(00(0% FPP( W`4p8 ,0( 0C,00p,0 0 p p00gP,   ,0 0,0  80  0Vq1RnU rmPp ,0 0 ,0 ,0R]*00QUY 0V PUR!0S 5 ` -LlM Q$P  S& 4 P,/A#bl p p@K \0 0  % F3Pjp X4R P$002c2c30 xKR t0p $x0P 0p 0 =9@ =C  0p $p\`YQ# 0#00F04/$YAp0Sl0S x@Kxp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30  Z0  h0  !! l t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 b$1G 0`01 ' 0 (0 0(0 00C0ZHD$ "  =$Yp ` 00 0 @(  ( 00C0#$800 F $p80 P(00(0  B $ X, Z ⌐ p l MbQ5?B0,4 -LM0@$P`#A@p 0 S #E`000 p-LMP$`p?608O*0 H0p -LM,, X$p0 1@`T 0WP`/ U@,X4Q q 8 1@`T 0WP` U@40X:lF,0$80H FP4,00,08  4? EP ` ` -LM0@  t h _ .0 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 0  -8 L0pS`( ,0Q@LT 7 , P!09,`l50P ,@0P00Q000p(0 4\ 08 #4# 0Q40 @!48 0-80P@Q04#4#00 8 0!0LS0  Q0 0 0S00(080 R40h;E40,  , 4t ` 0-@L P"00  0@(00(0   "0h 0-@L P}" R 0 0 00  0 (  ( 00C00hk"P(0 0 (0!P -L$M`"0$0( P/P@8pW@ W @4LD0  0P@T0@0!0@;00 0P@1 I 0  0P@ m0  @p ,KP@., 0@0b 0(1 Y#q0S  p( 0TYT$1 !S@#@3R 1$ R: 0S* @T  0 W4`XDP418 (1TP#2@0T00S Dt`l5X5 -LM,06KL ,0D P0H" ? p1 1 Q Q Q 匡 0<˟l1 h! n?K `1 \! >K/K KT1 l < dQ 0P 8P XQ HP Pp*H0P `: D@P R   R? 0`SDd:d*@P@dP!DFA@04 Sp0 1d1 R D0D0D00D  5!H00H0 D2PUp H0#KPP@f7  42 Pp?KP 0"RX 4"P42p` ?WpWK"H0C0Q=8QL" 0p C8P'l? ,06,08(@P@d DFA@04 S`ʐ1d1 R 808 08  008   8 8YC0@ H0 D"0PT2 U 7  42 Pp?KP0"R T" T" 4"P42p`P2@f G0 `R T< 0 P"0100b0P 0S42 pw !P0 h'h0 P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00Pp;42OKcT2( 2 K P2<$P, = P& q |1S0# 42 742  0> Pp fp@00@0, p0) 1, V  RD ,07,02 ,0<,00  0  ,0bD%P'*@BL"p 0Gz G<,0S KP:< H2 K( <P.,0 '?l 1S H R < S <H0 3  @0S@0[30@0S,06,0K < -l?v  ,06,0 @.0 00000 0  0\~ Pl ,0@7<,0LX2` 0" 2 0 " 082 0S/KK 82 3ZVPpH: KPpD 0s@ Pp#H@"D00D082帀8"82<@"82$ 8(00(08",00C,08(0,`VŻ*<= 8@!E0Q68Q AL"p 0T'P.T@1@!@P@dDFA@04 S` 1d1 R 808 08  008  8 xA< 80R 0R0R,070H,05*꤮i00C +?D X`Й5]L"`P"`84`t`5Z5 -LMp$K4 ,@P  `@ PT4(  01 B10R,0 P@( ,K Q'00K@8,P4( 0,0 B0RP,0 ( 4K  P@"`V@J,K Q'00K@,ZP0 ,0`V0P,0 Z  @P  -LM40H<`N@~VpNP0p p@ >H<. <0@R p` @@00SF<  됐<(KL <0x !0 `` `V D 0,4(00, 0;F8,45P,4 -L  -LM40`S  ,0 0/?,0\*;,00 (1!,,,D @0S  8 0R10<0<0<0 Q 0 0 0S0 0 0`T@ T Pr)LP,0 + UU@,0"[V? \H h4\0 %\H0Gv|0 G&, H@H@,0 1`T0S' , H@(0S B H@(,0$1@@1@H0Sh((, P |0S P0000DmxP2gP  - >H,0w(BE6A$ fD<`;`|`x`l,4 0-HP@L@<08 S800$< @P+  R 0 0 0 LPP0P0P 0  00CS0 PHS>D 00C0锫0F>*q<`<:`$58` -LM,0@ h -LM8@ $0 @@@9t" -LM 0 ' -LM  l  \ \  @@    0 0\$  -LM`wP@UD ^P, ^ \\)P#HB00W U  t0S: p0S*I 0#0C06 P h<@P000X(1@w-II( 1 )x )0,0,1 1P6, ,0  0 , ,0;0,0 << 10@ 000 !R !@00@0, [, U b0000GD1 Q ,0,00,0,0040 ,00,0@0@0S@ @0D0,@0@D0,0H`6,0T0@PSL0T L0P00TPl0T0,t T0 P0t `P 1D0S10S1 ,0L @P#T@  0P@ ,  8 D0 0000  t 0S 67cAP@,0  4 H H40RX088QwC00S 0 0P 040 !R8  00 8 < 0 0 Q40 0!<  )  ) @2  1 1Gv0C1 4G"40,S000000000QP4 R ,0 @0 <"@/$,000S ,0 P4 00 7 *!140!0400vQ 67c@Y,0 @0 0000  =, 0 0000  / 0 0 000  $,0 $ x,x0 G5$54Y^(5L 45<:`0#<#8`t-!`!`!` ;` ;`;`=" ="Zda,4 -LM@P P80Q 40S D1 R Q;` 0-0-LM@0lKP -@ @P@ 0 0,ό,BU00` P0-L@8P P04 Ax`,4 -p0p`PVL  P@  J+$ p0P`@@)@!`05,4 0-XX0@ TL  P0 RP q@T005!` -LM$P`p@+0 00 00 00 p`pp 0- @L P 1S0PSP0zy  -LM09@P` ]0y0p0`4` 0700700<)8 R0 y P0ES񟗕"t"<"Ȫ""""0 0S]  0 V6 00 00 * Q *Q 00C 0"000 X80 S 0 0 0S 0S090i#0 X 00 0 0@G" 0P0C 0 0 M0000 0S L4?1S 1 8C(0 11090 000 0S $#0S0Su0? 0 0S  0 0SUl 00 00 * Q Q 00C 00U:00 00 00S0 * Q oQ 00C 0g0X:0B090 `1SP}013 110S0  00 0 0@! 0P0C 0 M0S0 0 X  00 0 0@v! 0P0C 0 0 M@1S  0101 1S1 0SR0\ 0S0S00C0 0 0S0 :0:0 00 0 R Q Q 00C 00X:^0S 00 0 0@ ! 0P0C 0 M0S0S0 0S "0S0  00Cr1S 0 0S 0  =!1S0110C1!R0S0S00C00W 0S  0 z0Sw 0St  0  0S 0S R F R @090 `0  P090 0@ P  0 0S 0SXM0S 0S0S x`pp@ ,4@-4,-4T-4x-4-4-4-40.4 -LM0@S0  !p(B(>0XT>0 0S 4h|>(y> t>T.4x.4.4.4.4.4 -1LMP`R P_PS PMPppQAgA, 0@S1 V0>0nÃ0g`ƃ. Bl!l00 0L C PP 0à PP PP @P@ P P   P   P  P P   P  PPP0000( 0 S000x` 0 0 c-  R 00K0S00 00 -0 11LM@ `q P00`c Q 00`p|0 P  \0D  0 P  #o3x`/4 -L$M00 `0 P43Q&Q8 , 0 < 00 @005000"@0000<000i0D`40,p0 40 S} 04 a Rq 0007 0@ D0 D000$;T0 H 0S8<01 0L | @ t2Lx p@000P<#9@p3d514P2421t242424Q24 34 -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *80nS& aS @0(T00S1@TL1 h w8wS0S! P$$D1 1U4pP,0p0 R 0S΄ 0 K8 0C8wP 0d 0/8|,8x*8t(8pi%8034;`x`834;`@34X44/4L/4x/4/4/4/4/4/4/4/4040404 04(04004404d04040404`400H400D00 0-LQ@P 40Q P DD1 R 000D 0-LQ@P 40Q P DD1  Q 0 0P 40000D000,0700 000 0-L0\0P   0@\!:OP@0 p-LMD14@ Q ` APU  p4K400p p-LMP`U6P1 40P. P@ PpDD1  Q p,0  0 R U4P 40U phP D1  Q pD@p -0P` QL@p ݺpT  պ`X  κWV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U SPPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p KpT  C`X  <WV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T DA@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!LP P,0<,00 R*0SR:0 0S 000 ZP -LM-P@00;` 00CS0.;` 0-0LSP P @#000 0-L@P P"000 0R0 D1 [ 0-LP@P0 0D Ժ?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000Q^0 0P |0 Q P 0T@PD P ( 0@T@PP2;` -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pPD @T   @@TpP;` 0-LP0@^ \ 0 0^ \0 0\0T@ T@@ TP 0$0 @ @0 02 p-LM0(@KP `ضP0  p0 -QLMp@G P0 S  0R`0S  0RwP,` Rڐ0V 0GSH@"@"H"H"H"T"h"L10S0S0P 0R W   Q0 PQ0ba>0>0  0K 0ab0PP0<@0 /000B0 PP5X55 50S  ౶ -L$M@ , 0 40 M 0 @@0KC @K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% . p0@R/ "M2 0S @##mSPU`!q p0奎 @K3'  ,@  4X 8< @K@KP à ]C@TPa`~ pà &@K( 4@@K r@B`5 0-LP| 0\@ IH 0h00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L*@ 4 0 0 pP)00Y^=`\345 00CS0+=` 0-PL@ 0 0S  000@0000h" \0^  00lS R00@`5d5 -LM@  T T00CQ000 0 S0  0S00h`5d5,0 P 0SPd5 -LMP`p P@@ 0R,0 j(h5p"(0 R0S Rh5 - L0 zP/"h34p34 -LM0S7 䀟` PRp@ f  P` RU@ 0PSU00000  \*U@0SYh5\`5i4@-x0 p \ @ 0S \00  0  0@\`h50@-P@Q9 P7 SM ,0 4 ^-"""T"T"T"T"T"T""T"T"T"T"""T"""T"T"""T"T"T"T"T"T"T""" Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0D!D 0S -L M$$@ O 0@&(345L>` 0-LP )$O/@0810L>`$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$0!*L>` -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0婳PP !P , $00$0 $0 0$0  -LMP0 A` p$@'01 0!000W8<0; 0110 010@ 1 10 0 10110 010110 01Q 0! Q 1W 01(10(1,1 0,1i(1 0(1 R,100,0,000,040S 0 0S ,07,0,07p5D- 1B#20R00S(1 1(1Rp5 p-LM@,$PP ` @,1 0,1! P(1 0(1101 !,1S0 1,07,0P RPpp5 p-LM$1@0P v0`S S `lp0$!8< $!S08<$1 $1010 0-LM$@$!1!010P8<$1 J0PP 034 0-LM$@P1 10 1Q#P0 K P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 ZP 0-LM$@P1 10 1Q"P0 PK P0 1101  !0 S1%Fτ"0#1%( 3(F #P -@LQPp% RP` @ 0zPTr 0 R0 b0h -LMPS`p$ $1@T 40S@TX, Ġ T\09P V RD@T 40S@@T,  0P V 100CSP;` P-Lp`P# #` P @T U 0 V  V 00V U U U @@T\P@ U 0 V V 00V U U Uhi -PLM@L P h p-PLM`P @T U,0 ,0  @@Tp@ -L M,A P`p$@,10(,q$ai%0$!<  < $!@ !$10$1! ,1V0,1 0!(10(101p5 -LM@,pZGt G2,X 0G a(1$1,10  "0S00ć D1 Ru P13811%711, 0Y1a K, 10S7 S 1 Tx1  ,o;,   W! U Z 1010S  45,0HY101Y 0S010.02S200ć,   20Y00S&10Y00S H1,0V/p1 _U 10S p52x`_ -L@$!,13P & `!(0@ !, , $!> S6 $0X! 1 S S  0V,1 0140S  D1 RHV?,  P.V ,0PHx,  P 0@$!101*p53434, H*010,  -T1LMP@0!q$@ !$1!S0, 00 ,!(4 01, 40 00 R`5 ;101$1$  $!1 ,1V 0,1 0!(10(1010<  < $Q001$1(1,1400 ,0  0 ox`p5 0-P@L4 0$*4 _+ 0hb3434 0-LX, 0*00D0, !@P 0h$0$PPZp5 -#LIM0,  ,0 `  006:D R @0S pß,0 S `,N00A  D@K 0Q0P0Q  01#{+0K- 0 @ ` ;Pp P괐JK  0ePp80S p ί0 @5W \, $164d JKAP@CK0 0 ~JK 0 F!L000Y/&L+0 pK|p $tp $1|@K\0 (!Tp X 06P0 &L  Ơ0H Pp|0S'T@L0TJT@ P ,0  Ppp P`嵫Pp L0T@&@,H0P !b 0 pp`堫p  0)(Ppx, P@7[0  pPPp*,  (0 R"`3434`u`Z5 - L;N -LM@P`p1T0EP@S""""""""""""""""""""""p $ 1 01410x`4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 SP 0 0S | _ 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` AP 00 P0-LP@T*@T: P 0S* !0S:0D00#(34 -L@`p PP0 Vp P  00 00S0@ R0000 0 T p-LMP @T @Tpp@T ` R0000 0 V@T) 0- L@PP( 0 S600 5 $0R0000 0  5 -PL >Up ``@T @Th,(`@T @T 5 -@ML0(( I@i 0I@cHA`44 @`44 -LDM0`SP\` p} 0B Sw!XKҫP@BX00C Se######## ##T0圡 S PC\ | _P@`!X)\`0 \KA0TK 0 @Q X AT  Q  @ ?\ 0)P@  #\K rP@`\XTP-D@&P@{`#HA`-+X%Z$T#-P!xM% -LGM<\, P`p @ 0B9S9##########################################################,0 S ,f0BES񟗳 # # # #$ #D #L #T #h # #D #| # #<# ## #( # # # # #( #< ###P #X #` #h #p # # # # # # # #4 #T #l # # # # # # # ##4############### #<#P####5 B55 ]5ş 0'şş 7h0 0K PPW 0S0\40Ssp0|jğ0 L@P00W00SP4 D0MK 4 41P0G8C ><:04,4 0ğ0 L@nP00W00SP 3 0u 0p3cßqßoßm3 ̠|ße 0[ 0V0 S<0U KOKĪ gPP3Q 2R  04L 0@12 2 (2 "0L 0OX"T"P"(2^ 2R  0kL 0 $ANK 08 PP8!0BSR L 0@wx!t!p!l1 Ϡ7L 0{eL 0m^L 0W  0R 0PPuSL 0H?-= A`(44 4 4 455 5@`H@`@`pA`a ``?`lA` 4555``5g`a0$`Ht`!`l`T505$555 `dm`w`m`$55 -L M@ \QP@@ 0L S### ##0#P#d#####8#1 -1!0 1!06!0 0b6 :PD10S<1 P$1$!l0   A 0@@00S $KP $0-阀0S p0 pP0dSd00SV ]a̙58]da,5X4f`05tA`D@`(5 p-LMP@`  0STRPPP  Ө0T0\00S p Gp p -PLM0 @ 0 SR0 \K  0 @0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  q0T0\00S p p p M-PL0@ 0 SR0 \  0 C@ -LMP  -LMP -LPp` @EU  0S*T S 0Z030#WQ$U T 0S: 0W0P00S t0 00@SC 00@C -L@`pPT 0 S:U T  Ƨ p-LMP@`P  0S:T\P P ᫧ 0T0R00Sp  p p 0-PL@P 0 S:R 0\  ~P -LMP@p`& V00P fP P`FU@ /V0 0`F WP0@PU0h00h  002y? ` ` -L$MR, 4 00 8 p04pS,H0 D Q ^0S`@0  P4 2< @T 10S Uf#h## #(#P#d##40S$ @T< R < 82 ,0S D  0cR0  080S T4 R N D00 R= 0H0S @0WSD00D0 4X 1/#4 ͦP@  Bph@ BW*D B.D 8L Y/㷦PY8/㰦PBB~G,0 D1 RD1 0S 40,0 D1 0Sl00 Q0 Q Q0 SSPS ``Q@ 8 T0;`;` p-LMPD1`   @P 01 0BRSo1 @0S1c 0($0$!018,C/S X"10C1H0S40\2D1 ?`"D, ?  R; l0h2x0S0 1l2|0p20@SD1  Q020Q 0 @@ =/@@ |B 0 @ 0/@P P0p0h2,0@S$A,A0A8AC XBX4{ -LM   0 @( 00@ 8 $0@ @DH 0PP@\1X@ ` (0@d0, h 40l0H0S40p0D1 0S40t0D1 |@x 0 @ 000 000400 -D11=, , D1 R' l00x0S00|0|0@t00 @ 00x ̊ |0B0 n  .0t@! !$1$1(!(!,1,11 3 V/ M? 3   ND1  1 0BRS01111D 0 R`00`0D 0 R`00`0 R P  =100CS> @0.10S1t 00K z_!08 K0 *, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 TL0@!0S,0 =9C =C0 ,0 , 00 2$"0 10C1,0 ! 0($P!01 !0@ L1@1  00 00!!00  Q0V/@1 :0023Z6?B1 -QLTMQ0DSP Y 100CS,0   V 0 00  80K`0 \ H D T P0K =p`KX @P <  XKP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt ̣P`sxP K0@@ h0K `0 `0KH \ X0 T D <  XKdP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 XKIP`@P@*0S @T:0l00S0*d უP`* d0 T h0d 0h0   `qP` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` T0dKt d0 H`,0  TT070- -LM@ WPy0S| b PU ,@ PUPhPa2x"@`@  @L2  P@U`@ p ,0"S0f"u ,0 @ `4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC 00    T 0PU ` ,0 @4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`U @`f`f`,505f`X4444 -LM p-LMQP`@ \0  Pph p p-L M\@` Q 0 rppQ0 \"\ 0 1PU P P 80K00,0 &0080pp 0$ppl5T5 -LM@Ÿ,0 82^`p@2PU 2  2.`pP倀/0S0@@,0@S00]Y P ,0!0R,0R  $10M PU?0S  1 @00@0 S1!, 0 ,0# =U,0 Y U !R ,0 $10 VPU $ E00P#,0S N0S010%P,]x`h`xE`xA`1e` 0-@L 0PS 10S ,0;,00h0-SL 2?\ 00S00 0R0xA` -PL p2 ?`@T 0S @T m 倀 0pGS10S0S,0夀010 Ⴐ4 4000WxA`_]` -L 0-LM $1B1/AbP  PK0 R@@0P1 0P0 b0 g0  b$ 0cQ=9 B =$  0 0$ h0QL =9A =C 0D00QMb~844@`<```d44``?B 0-LM0PKS@ SC 00 0-LM@P 0PK PQ Q0u0 0-LM0PSX@ S0 D0  J 0QK 0 00APʚ;5 p-L,M `K@ ᵟP p 81(PK 0@a(0 $ PA0S;P00P Pp0#PS 8K4 ,08c00Pc0 A00 , 0 ,0  ,0 c00PcX0 A@ 0@ < <0 @0@KS@P @1 ၩ D00D00hx`154 p-L1 M PK`Ƚl 0PR 0  cR=9a  =  A 0  0!Q=9A =C 0P0 R0S @0S0S 000  od儽p 0R 0R 0@ 0Sx``?Bda( 11 R00 e`e` -LM10@SP#P#P#dQ#pQ#P#P#P#p,0 1 0S,0  >0Sx x000hh^ʨ,0  V?Q1A 11054e`_]`D t0< 0 0S0#0(0 R0 21e`_] 0-t0P0$S$0#t0L @01S0 Շ Ň01@-@@@@@@0 00 00@X5f`f`f`f` -LM0@S`p>0S,0S00S7  0PS0U 0S PPp(0Si0h 0T0S <4sp0d5`54|54\Q45454 -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SVf`d55454 Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00f` -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0P4K 08S,5\5 -@Pp L4`V 0 h$W  0h5 p-LM @`PU 0 php54 -PLMp 0 QP @@YP` Q0S00C $@@00 PW2  X  0P @0S S $@0SP e 0R0 S0 0R,0 S00f` 64f`64 -LM`@/PpU PPN 60 S0 (0 @00B 0\! P7$` 0\V@@Tʄ@T@ P fAV 0 !R0,0  `;0V|t 2S00S   1S Q$64864p64x6464646464 -L P@p0`SZ 0S-QP V`0S S1 $0S R 0(10  0@ & 0A  T1S RR 0000S Q0 0Q B 0 R00$P  E\5f`6474 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ P4  0@ P0 0h'474f`h74 -xpL@`T 0P$ R U@U00000 /f` 000f`0  B Qf` -`pL PR`@ $0S@ P PTf` p-p0LM PR` $0@S T pV V -P Y=f` -QLM@0Q 0AT (00@T,00,0,00CS,0 -0LM@ G00  0@@f`-$ R$ $@@0^*$0S $@ @0S:$0S$$$@0^:T T0S$0S$0S$ $@0@ R:^:T T0R$0S82P *0P ": -LM@D 88#| , `0 aPDq <+8q004!01`  ,0 0< T` R6Z `T<  B?+$X Z 2 8`0 0,8,@`P~ P< (0R0긧#\p3#74U57474747474d50  0 f`f`f` P0-LP P0 RD0@T ,!P @T000f`f` -LM@ @0H00000 -LM00@S(  e  0 Se Rd3I F`H00< @0 00 0@ ,74f`f`f` -LM@ol LR 0@00  0 $0 BR  f`f`f` 84 400Sh40 -LM40@0CsP40B ,Kⲷh(0, 0ahS00  `=94 = B4 00 p004 0pQ=9A =Cpp 000K Z UPX8@` p@0ʏ 40K*H0P@ ,?B<84  -PL'X`@08P@H p`N0p0t0h -LgMℑ 0,0 6 D!(0("4400@$04 T` 0$q$@0B*  P0 200-K0P$0*K?K "R .K 2 S0 S |fx0L0 ,0S \,SL00< 4 O^`x`\84]84edA!84s)84 J*8494 -LM ZP@Z/ w0 00  k#$k#\k#494@, R  00SS 2 0 R$0t$0\t-  0(Z^f` 4 -LM`@pPP  + pP0D 000 0  0@t5(Z^8 0S00 R0 00  0 0Z^(Z^ -LM`Pp ^H QDP?1@ T 0S2 @T0NS \m#|m#m#m# 0 -T 00 PT 0 KT 0S 0\(Z^f`@@ R4 000 S00 4Z^ 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 p-LM0PS0`0C0D0< 0bD0 R000Q  0S00``80 0C 80 phh0p( @ 3@Z^ -LM `@|V`Pp0S:000 0`00@0 0WpUP@ 0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p% u`(p`{0<0`uPlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pc<<L 0 P[ U5h`@Z^h`5T:4\:4[^d:4 -LMX @R\0T \0\00X \0 P 5PQ  Q4Q0 (00  0S00 [^5  0-Lh0P|0 P 0@P@Z^ -LM`L HpP~ PU2CP@  PUT  L0HL 00T WP d0` 0 d0l0HL 000@Tg R0000 0 D H0 B0D H0 R00C0 R000  R 0PP0 00 S  R000 R 0P 0 P0b0D, 0Q0:.0S"0Sd0` 0 0S0P 4HL P*]`R4:4 0-L(MT0h @ |0Pp0 Spa\h 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R0000P!04 0S0T0  0 R000  R 000ǭ<00CP 0 R000  R000<Kp 0 S:`:4z -<@LAPP`@ P@  pWT  00V000`F400 R0"40%T  -LM0$(S00pP 0@`p `@ h0) xt 0Q0xxZ0@ 0j@<D00@pD0 0@0 p@@ 0@0 S80p0S800pE -D ,0LR@p:PP  `VU  0D, 0Q0:U p0S000 Q0-LP, <@@D ,0R0:0 Q0-PL <@@40 p-LMPH`Q`3:Qq 0L`` <@@4p -LM0`SU@0T80  @T,K ᔬPU 8 00R8 K @,0 d@4 $0pLc^=9 =4p 0 00 40S"PX8P P R000 h0p 8PU $@DD0<,0lS:>ꐥ5@Z^ -LM@@ R, 0 S0 00h [^5 -LP`p@ h 0-LM@PT $ 0@T0:4 -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXH:4 ;4,;4`;4;4;4;4<4<40<4(4D<4h<4<4<4<4<4 -L MT@0`VP  h0 Q ` 0`pW 0`V R @` 00p`pW<4<4(=4 p-LM@PT`  P@T @T  P@T@T  P@Tp-$00 (0,04800  0-L@P R0000 0 0 p-LM@`P ,08 0 B8 ,00C ! \0 0pP 0SP00000PP 0Sp( P p -PLU`p 80080 0 1R p0 0PU 0S#PU6@tP.UhL  40 040 00 PP0SP[^ 0-$0LS@P0h( -PLU`p: 0S 800C80 0B! @P 00S$0S$0SZ 400C40 R000 0 0  R00@(WXP([^ p# `# -LMRPp `R0(0 J BR 0X0QQ@1Q (00(0 P T QZ00T00SP P (K ʅP `0 S %`%!* RXQ@X00Q0S ꈥ5 -LMT`p0S <P 8@3T0S P  p-LMTP@0` @T d0 X@T000phd g -pLP`@XX^\0\0\00X\ 0X0 \\ 0  k`\ VV0000 L <5da0<50  5 fa05 -LM@ 0@t=4 I=4 --LMxP0Sp`A \5SL0H0 R zs(@ 0{@h`=4(45[^ -LM@0 HD00S S (Syshzhus=45=4 -p-LM@ `NP 0@@YA(0 \0 p@Lg` p-LM`0@< 4PK0 =0\ 40[S  10S >* 0S Yp`d5>4 -p-LM P 0@``,0 \0 p`g` -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00Sh/rT0i'PW  0U00h`5g` 5 --L0LM,  D!0 \ x` --LM 0 --00LM Q0r鐕5 -p-LM@XXPt 0`@^00@ R `p55h` p-LM@\PX`S  0PP=00@ R Prp55h` --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -L\Mϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 0 H0 0%SSRO HT \  pH d ` H L H L  0BZS1L###x########س#########################д##############################H##ܴ#####ܴ###Ը#####4#@######p##|#0 x P`\  \ \  h`d `0V`S`T`T| \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e |\r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʯ:X ,0S ,\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dmb`  ]cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  0.D@Kx(0`x D0[ Sx  p X0W0  @X0 pX00Y00S v 0S ! x0@Tx0  D !0O0Y XPp <,WX L pX00Y00S O x 0@ TX0W0  X0 1 p X00Y00S@ 6 x0@ Tx x@Tx P X  >X p X00Y00S    x 0 Sx0 Sx D@K &bD@K&_`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tpp0 @0Tpp000 HT0 0T0 @HL 10L 0 B0@C RH \@ }TT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R 3P0 ph l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 }P00cP0 0 `PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`Xl T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D KH0T @H lR H  TT0 0/T  0X0/ +`>4>4>4 >4(>4D>4Г5X>4`>4T 0X 0 T@ 0X 0 0 X0 0x0Px0L0 8 PuoL 30 T0P` l 0x T0 L 8H  V 0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T!x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` /t0Y00S00P0 P 2R W P  P PaPh hp ` Ph l  4>4,0, 0$ Q 0÷<5D5@5\h` -LM0(h h`\@\ 0 0S<:80 00044h`@5D5\h`000 Q 00@5D5\h`<5 0 S-L< 800( S $S hd5$5,5>4 -t0@LMA \s0S #(#4# #4#,hf$dh`\5P5d5>4>4/4 -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi8Poꇠ(5,5?45?4?4(45p-45?4\5585?48?4?4@4 0- 1L @PP,01 R#@#L#\#\#01 @iU 0hd /01 Ph0T\ X0 TH0` <0h00h(5\58?4@4$@40@4,5H@455h@4?4 0- 1L @PP,01 R###D##01 @U 0heP01 h0T\ X0 TH0` <0hi00hf(5\58?4@440@4,5@455@4?4 p-LMaSP0@SN L& P @`E@T1 D B2RV# # # # # # # ## # # # # # # # # # # # # # # # # # # # ####### ## # # ## # # # ## ### #(#P!@0Sp|xtplhd`\XTPLHH5@44@4(4(A4HA4lA4A4A4A4B4(B4LB4tB4B4B4C4 C4 -h`hP0 @0XpTL@000S@@]0 0T,5545 -X`@0PpTL@ @P0S 0@0T000545854 -LMX 04 D! Z0 , p((@ P 0 s ,0 Ƞh8 V W@ P8sW 0$Zڤ000 R 00 RE4 peR dR `4F 840sS8L ,80pC(5455\5LC4 -L M |0p S S0 @ SQ SO 0 8 R R# R R0 S S<0 S S S `0VܐP0HS ! 08#x hF8SP0 8CXu Q ,`KPXs FP&h0`  S0585dC4?4 -L M8#8cZ00 (<2"(@4@, 0Sp `P0PE $`0@S$Pa@0T0 Ё8CX PUc0J 0@TcZ1  S ####d1P v<1e$! !@ 0  NP0 8C(R R% R0, R0SS=Pc0JS####Y\ 8*@0SS 45\555,5xC4LC4 p-LMP0 S S` S S 0 S S S S0 S S0 S S S PH @K P0@ \pp SC4?4 -L Mp`0A,(0P S S= 0 S S S R`V ,KP0, Rڰ0!1 P aY ,0 `0?P QPqP Hf  0 S \l`C4(5?4\5C4?4 -(L4M8"(`LK$T #G#3 pQ Y C0S P0>0S $0$@SWU0PpKa phP0s \# PLK@0@T@4i p岤KDKQP0s aJY@VITPRxŸPp@Wʼ"1Q$@D0W0$PEڀBLK @ h2 0T XŸ @p PT,2@0T Ÿ @p PT0001 R P@00S I $0$@StA0pS P00S ( $0$@S(p0S P @00S  $0$@S[O0P0S S2ḠSrı0P0S S0Wp0yP0S S0Z0kPp,(5,5C4\5C4D40S" hPKh`0\b 3` KpKl 0pcPl=9 A =p p l p l0 T2RHL"002c2cs , P@ 0S y@0,0"F0@lT t@,0#T@@0T,0QQ QL@0KPP| pP@T| pP@X| p@p\ d0S`K pP@`KbP@hKy\ d0` h0P=9@ =C` \ ` \0 \D| oP@Q H| oP@G L| oP@= @Kz<0K8 KH0 40KD X0 0 K,0K@KT P0 L )l`Q5E4l`?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a0S0CP8c% U#eP@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0   Z<0H0S<0 H 0@  `p3E 0-04PLS@ SP0ϱP 0R0000l` 0-@LP 00PP0 f x0@R ,0@@0,00hY10S a-0(0  l`l` -LpMW,0 P`*0 S0!͓P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pzp 00 -LLM0d @0dS0!ph WH0Kp0  Pl dl pnPP *p0 R0:z t2 PKBa2a11J"c11L0 P P_XKL T0PX0"PP L =9@ =CP L0 ,0@0`,0 h0poh 0S>z" XPKXP0\S 4PK`K\ 0`cPl=9 A =` ` \ ` \0 H1R9@!002c2c , P@ 0S ~@0,0 F0qY ,0#Y@0,0 y Yd pl np0HKS  .L T0S0L0 P0  }p O 5Mb?Bl`Q5N4l` -L M`(p.PP@[|P@Q,K0 KP@J,0, 4K,00$P,00 K000P@040 4 0040$4 000<W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pt 㝜@0@0j@(ݏ0@0A<@0;e `p@ < @0^ <@0+Y*0#p@@ 80Pt a@00@0|| 0Pp@0 p@0@0@0@0<@0l`E4E40Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`@00@0u 40<0D0h @0@0@0@0@0@00E4l`-40!$r< r8080  ^080  5540!$r< r0S00 Q 0 0S000\0S00 Q 0 0S-40$ < @030Q0S@0 191\40$ <Q @0 !0) 0!  00b 0 S -L M$$@ H 0@AE45l` -LM$  0  -LM$  0 -LM^@$\ )t1^# l1^ .40iS rS 0  0 0 hl 0h餢0#300L00^& 0^0S 0*< *00*< l0^ < 0 @ 0 D0S00<<0<0 s@f@s@~f}fs -0LP$@JA` L \0R*0 3S3S `p  0C BR RԱ 0  3S `  H0S0@ `V W  v:0:l o707 0-@LM0p$Ph900  0 -LM@$0P0$00 p-LM@Pμp0`  l@ <p0pp 4p0 -t LM0@S00 >|0 Q>x  0,0CS0 p||.ꔕ5l9` -LM`lPi0 p凼@"ၼ  0@D  D \@0訠 $☀ ";p05  R @ 0SU 0S  )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU W1 x U W" 0xU U U|Uu 05 0z  (0r055 UZ   ^;8p09`^ (0S.@ 20U0S 6    y0PD 0@$  $ pm`xm`lp3]\m` - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HS$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $`$h$p$x$'A0H\XS X X"@0`HP``d0\0d0r P "30 X00S =S  0@d 0 d HT P!0?0S8$,$$$@$T$,$L$QA0 0(!)^  so 0@d 0 d  0=`H  PPT JO  L-0c Z0 =vPH @w 0`0Od  d d-hm`lp35 -PTLlMUp` >09U,97(9U$953:D| 0S , x0\ (1$1F0S I(8@ P@ 8U 8U b`8UY h8U `8U p0;p0 p0;8U 8Up   5,0p  D 0S 0S||^ ^^ 00CS0 D 000D! 0|0D!x D1 ,00,0| RP@ 7U1 6U 6Uh00㪸6U 6U  D1| R :PxPd,0H0〸pm0 &0p" 5U c5U_ -5U 5UPa0Sp0p000p0j0 R j 0 R D1| R,0 h L5204U' (5U" 5P lU*h0U! *dh02 P@hP, h0  Qgt4U h4U `4U\D1| Qm,0j P 0S x140S30Sn0S_p 0   P (0$0( R|P P?d3U ,<R R 20 0 0;; 0 0 2  `(p@e PKK020  0<p0| P@[P@T 2U@  PQ  >x lHP. q0S S p0(0(S" @0H0 |1P pKl p0 LP D` AP@.P `]b0 `0c@ `d`GT  0X ,  U0U 0U 000St{t rtzt ^t e`L5t,@ot t t at nt l9`st@f@t@wt@ht@]bt~f}f5td5gtetvtt,5 +4 4-0L0Œ@PҶAp`@ .H0S`VW Tῶ * &P`0 p0] p- 40t 0LM"@`1Ps sP<0 p80<`㍶00@制0]d5t5 0-=0p 0"L@<Pt0S00  Q0 0 0S000h`] p-LM= x0 2`<PQ@J J0 p0191p 0Sp] 0-=0p 0"L@<P,0S00  Q0 0 0S000h] -LM= 40 @2< H >P] -LM0@  (0 P0SM0 p-LM@P`H0Spp% 0  0S H0Spp 0  0S p, ,0HPP ᳵp\5 0-L@PP 0 p-LM@Pᚵ` (Q,Q&p0 >;-p0.(ph遵p0m h< p0ŒHQHPHP(] A(5 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@Lp0P0p00h -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"$>$>$=$>$>$]-0B= X? u 8CRaDZp0 :p0>%p(Km ==P@ ( P@0p 5*0p ᢱ-=`b0V``V=J>`VZ0@   p0  X:p0\'lp3E4 Q0-L@PA  UPE0 -LMPP2 Z(`$pKP@ $! P@`P@ $ P@p0:p000>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@}p0 Wt h靍x0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`{P,"0$"111;/"b111A"|0St xQo @TPi zPP@@T10S4 S1 1R0 0l$K0, K HAN=0S 0 $00!0 $0 q?B6c$ (N=0S(0 ,0 0 ,0 ( (0?B6c, |01c1 @R  1P2;P 0 <0(/0"bT uDiaQF4$F4@F4`F4hF4tF4|F4?BHhF4F4F4F4P0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0Pt t0RS p-LMP@ᴯp0`(0(S U  OᣯpHꞯp 0-LMP  0NP>T00  m`dm` p-LMz`P0> S@0 0" m ( H P00 D @000 0@Fp邙@5`m`dm`0$ - `0L0C0 R 000  0 (H0 @P(@dDFA 02b Sp>L 0 S0``00`h ͙dm`m`L"`P"`84` -0  L30 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Qdm`m`m` -LMQP`/00CS J$DJ$LJ$TJ$\J$000 Pi鶲-p0l0h0PpT0T@ 0 e p_xm`hm`\m`pm`dm`m` -P@pL >㾘0E/>1 `W>p 0 0P0  饘 -LM0@S0S000A?>> p-LM@D0`SC 0^P` a/.!0AS1l0PU00\ $p -LP`Vp&0S 0\@l0% @l T@ 00S 00`d d0Vp 0SS 0 0h0 -L@P`\p U/ 0 ` \L ?>1A 0S>0`Qĭ\L0 Q` \L0 0H`F V0`b 0-@LPᡭ U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0hz p-LMP@s `R8 R0S* 0 0 0P 0 @\    ?>1 @  0 0Q00  0Hp?>1 @ , P0 3pF4Rp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p -QLM`PpF R- R0S1 0 0V$ R! 0 @cR@cT@ `dPp  00S 00 0V  RṬ 0 A(U P0F4@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 ]^@- `0R   00\ La/.!0AS1@ ]^ p-LM@V`PP 0 S0 0 0  l?>@1^!BP 0S2\0S0 02p -L Mp)0S# 0S 0R p @@`KP@K  -`,0pD1P LP@U @ W 0W @@Y -LM`,0pD1P HP@U V 0W @Y -LM`,0pD1P HP@U V 0W @X 0-LM@,PD1 P \0Q T0Q  0PW0D1 Q 0,0000at qt @-,0@D1 00S   @W@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ %ll !L#P0h m`Ժ5(55 ]p`p`]^m`[$|p`]^h[$,0 P 0SPm` -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am鮆 -h0LPpU` @ T*0S4@  T:PUm` p-t0LMP`U @ T*(04@S T:PU(0phN m`5 p-|0LMP`U @ T*$04@S T:PU00(0aph) m`5gfff -PM@L` 0|p@@wp0 @o L H00C$0h>o`DG4p`|]$LG4(5,50 <0Z$55p` p-LMl0`PU @ T*,04@S T:PUϩ 000p m`m` p-LM@`ὩT"@@PLH0@P  a101!  天po`m` p-LM@`ᙩT"@@PXT0@P $ a1010  1 }po`m` p-LM@`rT"@@Phd0@T  a101!  YT  ;po`m` 0-@LI P 10C1( 8P<0<0< 8 0 10 |@+0 (0S $0, $4ۓ$ m`o`p` P-LP! p!` 10C1* 8P<0<0< 8 0 10 @}TP (0S $0, $4喓$ dm`o`p` -LM`@pT"@@P@T 1 1 101奨T !0g)P$ !0 0!W0`00 pwo`m` -LM -LM -LM40 00 p`80 JQ18 W V, 0W:pcW`0X,0 ,KRV H4 @R"PP 1"1 101岡.UP 8\s 0!0gS0! 0f \,0$00$80!8018P 80<`1 0S 5`1P1l0:嘡 00c|0 S01W01R@1@! E 00 0 d dR0 0pd0 UX XP8 000PX:@P` 1 1 101"V 1@  @ :)01@1 0$ 1 m`Tq`o`m` Q-Lp`1; 0+0S6* R3 0S 5P1`1pl0: 0S@1@! Ǽ 00 0 pd dR0 00 VW W`}P!000t` W㾥@PP 1!1 101ᦥU 㣥@$ᛥ$ R 1 0 +10 ,( 40#s:0U00SL( 0S% 00#0X00S 3S0 @P`PU70778ܛ07x?Ui  Z00R00SxU^ @04 p< 4p4 5 L 0P0P00S 40  70778妛0x7 P 0RS04 0070778厛 0x7LWU @0 0S 40X`hd 0Sh4p<  R< V14  4 40pPD @T L0,B0aT L01000cT00P P0P P`P0pU XhP%X`dh 5T & 10C1) 8Q<0<0< 8 0 10 0`0嫽T`P (0S $0, $4ƅ$\唽8D0 ᆙP P8 \ H R WX`dh T L0,B0aT L01000cT0\ @0 Q 0 R  P0`0 `P>@ 0Q 0 R9 㱚$@ 10C1( 8Q<0<0< 8 0 10 0`0'ᒚ (0S $0, $4C$Pe T L0,B0aT L01000cT0,\ P0`0L`P]"@ 10C1( 8Q<0<0< 8 0 10 0\`0Ӽ> (0S $0, $4$彼L4S  UiU 1S, 1)PU 0 9p0 SRk  407077L(8Z 0x7S#PP4L(  0@P4 0   @Pp Q! TopZ00W00SP PU m`o`p` p-LMQ@P ` Q p T  0pQ -L0ML@2 p@022P021|`2022!LPK0ݫ2[02(0$0^0 00S!80,2ᵤ -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R: R R  R RU 0S :G@0CT@S$$$,$d1P| 7vP01PL0T@0P0T\@\00RU 0S@000 0004  ` Q!i401#8S#00Sl0W  P0W}S 0S 0S S b5555 -LM^P@p \ 0S*p 00 T` 0 &T T T 0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 P 0T 0T 0T0xP 0Z@=T0 3 003\ 55 -LM@@ D0<㜒l@h^ 0-!40r@L$ r 00LP<0<080—$  2$@02ẗ 0|P\5l5|5 0-40@$PL㫗p0S0p0  Q0 0 0S00p0S7070h钗40$ L 0  191# 3S,000\0Q 0-40@$PLp0S00  Q0 0 0S000S:0:0hW40$0  C0LS 0 Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6jLd0S |0h[LS0S 60h  -LM0@00 68 <|6L30S  -LM0@00 6. |L0S  -L ML0H 2cC0Q0^, 00 m3#0 SfʤPD 0 @P@0@ <`0 3 @pDP@P0A3 <` @pD#PP`P@P@ @ 0 0 @ 0P, R L 0S6⢡0,@00  0 # Ỹp`Q`q`55R33  00330(0 (, 0 Q 0\30C3( Q,0,0,00(,0   0\30C3 | F -LM0@ 00L<0S  -LM"2 " @F|q3 p-LM2@  ,P`02@ @F0`P2 02pq3 00-@LP202"00 $t$ 0h4r0< =2 p-LM|`@PP LP \0 S0\00S;0S p$7pQ@-L  0@Q  0$R @ S蔩5P0H L07Rp` -LM@00 0Q R 10S (  -LM @00Q  0,0 0100000S0Q0 ! !101 Q-Q 1S( S  0,0 01000000 0R0Q ! !101 0Q -LMR`P  10` @X 0R@ B 0CS0Q\㐔 Pp 012 02!  zW0 0 0 UT`X@  0,0 010000@0S  0,0 0100000Spp@p壻o`m`H4 R0-L@A 0R PQ 0\  C 0LS0^00S  0,0 0100000S  0,0 0100000S@@@0TH4 Q-L@`Pp 1 0\pW0S00@TW U 101hhs0SP !1R U. 1 \  00c<;  80S/ \!1R U@ @ 0   1P00001010@0@0  p 0  0 00$00 00a\U0H4 -LM0@S0S -@LTP` V1T Q 0,B0a 0100`a0c0G딂!p 10C1 8P<0<0< 8h 0 10 <@徵)VT? Q. 0,B0a 01000c0!` 10C1; 8P<0<0< 8 0 10 t@卵T Q T@ @T 0S@@@ (0S $0, $4}$c (0S $0, $4|}$hJt0 f0 0  f Z @zE m`o`p`H4 -LM0`SP3 040  0,B0a 01000c0!p 10C10 8P<0<0< 8 0 10 @eTP0S 00 (0S $0, $4 }$ ۴/m`o`p` -pL @M T`1jPP& T)@傳$!$ R 1 0 +10 ,(0C& 0S0 0000@00x!xQ 0 0SdP D1T!0Q 00ph/00500哏0@ 0K኏00 000(00 .0 B600 h08 . XB000000 @@08 . 0dr`Ls`\s`Hr``r`hs`Xs`xr`Xr`@r`ls`Pr`-l0 `0!X0 P P0 S P\0S00 5H4ps`Ts` - `L MP 0 , pX!XʃT10AT P0S @T P@ 000S00@TPPPㅃs~,H\0Su0000  l000000dT 005008  0寍@TT 5H4ps`Ts`I4 0-LPxP@ 000:00 R0@0ds`> 0-~pWL`U80S. +*HRPP 00(:00 R 0P8 80H@bHT@!d [800808 <0 dS< 8 o80S:S<0@PU 00000H8 H g[8000g 80< 8p0I҂/ds`Xr`I4 -LM`płX1X!0PQMD1D!0Q 414!0Q $1 Q41@T# D00\ 0R00ែ0\h0P0T0X040@0<0d0`0l00 000 D|| 0@ԌzPH 0@0֍ls` 0C& 80 >0C&   0P@00000  ^00 , 0:x`|r`ls`Pr`Ps` r07 SRX 00S*0S$R"*r X00St0 0 0SRr sus0suu0sXR0S0 uq000 0scgXK4 -LM 0R ) 0 `R 0 4 PLp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00J \0 -L,M,0$ 000 `P 0S 0+$P@ R@@T 厘000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 "P@380[c  R?@# *\0× 000M0/Sd @0 fpR  Q200 Ɩp>@ " ;0 pdPpGWc:0/S Y0+$6 㚖)t`t` -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < < , 0 /S L  , 5R  /R  2R0 /R, KR, ,0 lR ?Ó00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@u@00@0X 00@060 * P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00Sk00CS<< R;T0@ 780S2 T0@   3 #0S 7@0S00, !P  @00@08Q   !d20S 0 0 j 0 ( |`V   "0S  8 R|`V   e!00K X0@@ @ p<QT0@   @00@0<@@@00@0V 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SU0S8 0Q0R00SG@090$t` @ -LM80@0 p,0   `0SdV 0 R PP p .00ZT0@  P0  @00@00`0CS ZT0@ ,0S T0@ 0 @00@0,0S 0  0@ < RP    凚pK4K4 -@ MLll 0dPyX0X @T0@P@LLL L0@@@@h 5K4v`v`v`^^v`|w`v`v`w` Q-0L Q00 \ 08pZP hZKZ - 1LM`@Vp P $`VV }\P@}40 P Z P ` 0@0 P0 00@0$(0@0 㲄/Y 0k!@`5K4 -|0LM0Sh0@T 0S$@TP0 $ P^`5K4H- P h0S Pl 0Rv` p-L M 0@004h0l0 S000t ` 044 P 0  PK P 0 0 0 0h0p]^^v`0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ1@0\00 .00, q 0@S Pq R#Dq R 0S q /PE 000@8@널4,80P@0@@PR +P XPUqPU X R\0\0\00X \0 H  H q80S 00|0<0w`5^^x`|w`v`v`K4T0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d \ P0@0  P8p 0P 0 P Pw` -LM800CS1!p2?0P`^@T | 0V, @T&qTp R| 00 q|0p `| T0|0| p|0pP < +< <0;<06[|8 80S@0S  %PT Y80S  A  ^40 840 Px`w`P5` -LM@<0PX `   <<00! {H @p00Q00S0@0 PP @ 0W0 BR00S@ pL0S X R\ L0 \0\0\0 H00H0{p@ X X R\ 0K4v`|w` -LM@hpLH8t t0P\HX 0X0 \ 0@hOp0XSX00X \ @\|w`v` -LM@0T 0CS@@0  h _@0SH0 hx` 0-h0@ P BR@ L@L 0@0S?@0SH00hx`-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0v`|w` -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 x`w` -L M@0 K  0 @ PF% -L M@P@U0@0<0`p48<,<0/`<U5 V-P#U @00CS@0L0S0t 4  @K<0, 0< <<0iz\嘖 0  0GK4K4w`L4 -L@\ 0x` -LM<0`LP <<0"0Wy yT0S800CS`|\ \ 0S00 S | 0S S<@0Q0 <@ | |p0Qq | 0Sn QWg Q<0;<0<@;<0@T  P0Q |1!@P @dnDFA@04 Sp=ʄ1dXA R|0 |000|0 |n0|0@0 S8 H0nL0S0S X R\0\0\00\0X  RX 0X0X \0 `\hknt|'Y XP|8 80RWpYL4$L4L"`P"`84`|w`4L4HL4@-2@H?0\ | 0T \80Qw` -QLMp@`P$K40 P@T$ -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S @ -LMQpp5^ 0\ 0S $\-\ Ap0,0S SQ|0\ 0S $\\  0( hor- 0 h@!T@0\ 0   0V0P@@T@ 0004P 㥃0401xW0 R 0S  R0\7@ \ $ \` tP@d0 Rd0 0Dzm` -LM@0  01P@*810SH1 H!byP H1$0SH1 H!R |@T) }rP}Px0 @M 7P@H1 0 H!0@ 48 H1@  .x0 p꠫5`M4^``v``5K4 p-LM@0`S |K0 P.0PU @0S 0S PU@P p @00@00@  @  0@  @ $;`t`M4 -LLM pD0hK@0 d h D , -LM$`@8 RpP. PT0S @0 P0    0 p,   ,000c P$ -LtM0 K@xP@x0t 0 800C S64%% %%,%8%D% ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$@P8`ApQꤰ%%@%@%԰%԰%@%1U 1U 00S 0 pF0 K0P l00b0 0 p-T0PU D! 0P @@00@0D!f@zfat $( -LM@`@@p< H 0X <p_H PLN4-$ 0 8$  -`0@`XL pPU0@  iP x` -$ LM  40K5 -L(M    40 K5 -L,M   0 40 KD5 -L,M   0 40 Kp5 -L,M   0 40 K霬5 -L,M   0 40 KȬ5 -L,M   0 40 K5 -L,M   0 40 K 5 -L,M   0 40 KL5 -L,M   0 40 Kx5 -L,M   0 40 K餭5 -L,M   0 40 KЭ5 -L M8 0  0 $  0 ( 40 (K5 -L(M    40 K(5 -L$M   40 KT5 -L$M   40 K逮5 -L,M   0 40 K鬮5 -L(M    40 Kܮ5 -L(M    40 K 5 -L M8 0  0 $  0 ( 40 (KD5 -L,M   0 40 Kp5 -L(M    40 K頯5 -LM00 0  0 $ 40 $K̯5 -L M8 0  0 $  0 ( 40 (K5 -L(M    40 K$5 -L$M   40 KP5 -L$M   40 K|5 -L$M   40 K騰5 -L(M    40 K԰5 -L(M    40 K5 -LM00 0  0 $ 40 $K,5 -$ LM  40KX5 -L(M    40 K鄱5 -LM00 0  0 $ 40 $K鰱5 -L$M   40 Kܱ5 -LM \  40K5 -LM \  40K,5 00 -LM@P0< iy,P4 -LrP]y 0 00CS 03 0S 0S Xǯį0 p@PO@dDFA 02 St1b1 R0``00` O0|0E:堹嘹L"`P"`84` -LMp|`V$ 劯刯0 @PgO@dDFA 02b SP0 S0``00`MO0|0 :L"`P"`84` -LM@w wP4(4|0 wP40S S  (00S 0 < - -LpvP4@-| q  qL@H0 800@< $  2 02$ 0|D5T5;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$rQx`x`q3q35tQ4@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00r3s3E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVMq30@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S s3p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 F05x`x` -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , Px`x`x`@- @  0 201 R 0\ R R  0^0T,0S x`x`0S R00  -LMpt<0 3Qp`<` PUp,0Kd R@TMG0 SP0@=0 @G@Y08"@.,0P, @ @4@00`  ,NP@ ,T 0p 0V ,0t t0sn 4K 00K P@ \4 ]40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 84K,0 0嬵P140PH@ `0T*^ 0p ^ M0S 0P4 H0 @0T `: {MP40P 4rn4jPR4R4 -L M$ ( h0 pe h0b t t0RpF R` 0`t0sY h0S t@\ T0D0bD` $K0DPp,$H0 P >  fMP7t0 qD0 4Ht0T$p T q! (0\$ (0K$p (Pp( $\ W (0SDD)c <0T$p<0RR4R4 -LMQ@p``#T\P 0@30e^X05< 070 0`ִPP X 0X H 廵00\T D a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P(K,KT PE5 0P@40K(, 0厴P@-0X0H0 R $0U  P 0 PE AX0 0S 0ҴP@ 0X 00U00SR0O -LM00<0 8 @ 80 @0PG 0K , K0uPp9<04K,0 03Pp*40H@ `0T*PU  0 @ H0 `0T: W@ @LP 404p4P@\ -LM0p`P(K,K 0 P@(0K(, 0߳P00,H 0R *@T T 0S H0 0R:P귴 ᳴ -LM⤐Kp  | P P@@  0S   @T8@0@-@T2PQ @0(0$ ,P@|`80S|0" 0Q}0 Q @0 LM0  0P@  4@0U 0V@ T40 08  0,0000 05t0s/ KP@  0@*P000Y@KY 0{ZaK0Y qZaJ | fO00 03@OK KZ 0 Q10R`\ 0  0-P@  o ] -LDM|` p< PPH P8 V5 Q0@ 0@@?P vU @00D0  0PPx04 8 5 @0 K0p:PP0 ,0(H  P 0崠 OP|0@@4PD 0R 80S P8;"A<"G ZS4K,0HPP4 00;00040H@!8 .J8 P0 $@ ! 041   042 0 $" 04400 $" 042 $ x0 1QS 2S2?S8 "QL  0488<,0 0$(,0 8Q8P 020%L Rc840S_0 4SZ82 t0  048<840 048 00020x08 t \ 6 8tp\ 5 @Q? 0A<8 H0P70@40\T 0 HyL@T,0X P&@8,0!4@  8L0HX,024 80\p8 84 0@` $QP08<@@7L8@D@@8 @D00c-L`08 p0HL x0 3P Z Z 83 \0 8 t0h3\@Q8 808h0h08hL8 lN8@ 1@\0BX0` N8@` 0RT408 40 xQ 4K+0PP40H@ ?IP2 80x04040 8 <L  80<`8PP@08010DQ8 80010d08 0<h l |0y IP IP HP{/l0h!d 4 88<|020C8Sa81 \0 t0a\0S^1R80 \0 t0R80  t0\0 I8" 4!0` 4` #,$ 88<<0D& %0Q4x0P 0 840,0`hdR4R4t300 -@L pDP`0 A|`PQ`< ; @0 :@0! -LM0K"@@P0   p-LM@`0P0` ` H0 0P T P0Z 0H0T` nLZ jLB| fL D Gp p-LM80@SP0 0<l0S 0\S `V p 00S0 - -LMQ`0(  $0 ,` d0@Sph, K 0SYTL _ 0P$  $\0/&R4 -LM0@ 0KP0 00  0000   0-@P L@P00 4 0 0 -LM䑟0 ,0 @`t0 pS$ x0RP#N*K QG\ KPPC00 K0 !P0 PK  DP @P 0  < 0 0/&00  K0]PP0  ]0  ,0 S ,E#WpWGLKN KO0KqJK0k0FKH KdP0[ 0P0K`R4t` -LM 0@V!t` p-L M@0@SpPP `KZ0 000 0  0 00lj i0#00n00rp h0 0h0 -LM 0hh0`0  0 $  10 !   0m -L M00PKp00 000 0 00000h t` Pt0s<h0($200 h0 0 !1@00#!  "  000 ` 000 0PH` x0 @000 (8 Dh0@ 8D000L` $ 0x0X 00@ 800(0 i 80x0S1\T \D<0L aP` 1 E,$P`! lj i0F0r0n@0j0rp 9h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0FP(0s] 0 0R &P \00 P 00 (0s (n000s 0rp 0h0 0 h0 p 00 Q &Ph0h000h00 00Dp 00 Q o&PDh0h0 0 0h00 00h100s0s -L,M@D 0刀S0`e 0Sh0إ0<0 x0 R0S}*T I, P@X0` 0@0 @ lx0Q1!< 0`Z!RR\ T00b380   RT2 \` a4KD0Ԭ,0@04`0@ 0b SP1 P!T@0H 0@4峭T0SU<\D T0@  000頭Tx0 S\` a` 4KD80K 崬0K, K0P@4K,0 0公@ -L ᙨP.\ K P'@ PK K 0@ PKD @ P SP0  S0  0 ,0S ,>P P8;[0 [ 740w 5 <0QLKN KO0KU0O0 JKN0F0FKH KGP0[ 0P0K6`Զ5S4t` -LMP` V$ P 0@ B`TP` 0 c@`ۼ -LM@ 4ϼ- -LWMH 0 ,0 `! `A L! h0\! 0d h! l! p  KKj?d!0t1 P 0@ 0 7 ,0S ,(>dA `H0T S! 20Q Ul1 U U&U80B``, pRh! 00} ,H!hA0@Hl `1t 1R2X1  t0s dpW \=K/=KT X+C`\A`PXd`0x a0`Wp!\P E\ p1K`N/KO?K8PL 9QK8@!0PL D@1@ H0bP!S0!Px1 0U*0S S0p1  Q @pA 8 H Px1  @ 0 PU:ὧdA0SpHA R0l0l0t!d0TA00`MKx XxQH0 0L@PH0 t0 pĂ0 4ȌD \p<3 (K 4 p\- KK A?(KA/(@K0K0000d0 Sp! :MK |*PL h1S lAh@D 0lA T0h DDKA?( K K?K 0 48<S<1ST \D a0C<X1`p 1HF,`$`oD2 (@K 0Kp!MK3p Dr\/=KQ<0R0@ @@ S\A RrWnKA_t0 s<041 14 (KW 3 W) (K00000d!0S:MK)PL @ 0h1S lA@DlA Th1 pWڬ @0@ MK 0(KKK,0C@(0KKK,@qh | @Um Ut  Uhl  Ue U UT  U^L  U[U< UV4 US`S4P5` 4t155`06`6`7`7`7``8`  8 8 08j 0-LM0 P\0@ 0  ^ \  \ T bQ P 0 -LMPp\8@PT 0`/T@PT t |0 0D 4 *@*0\TnT\P0T0T@tH<=T@@Q5S4 0-0L@Pt 0@-S 0"P  0 0.$S0S40T4X4R4 0-LM 0Px @ 4000  B00R\& \& \&[&[& \&\& \&0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QL M,  Q :Q{ Q 00 0` V)"@JKPP 011$01    )0 p0bV0p)"@)K$)$ R 1 0+10 ,p(p0S0: 08 1T 1T+1T$0S! x0S1 0R R   Q  0P jP 0T 0T 0T 00T x0T 0%:0S80T X0T :0x0T L0t0kB @sB@vB hB iB jB@fB@qB@f@tB@xB@nB@wt@oB@55~fuBpBrBzByB}fwBgBvtmBfBlB {BH5 -LMP0R,(Sp@Tc&ZP,@(fZ&Y ` VA  !PKP7&ZP,( -0L@pTP`/ 0S( 69PV 0R`@TV 0SP &0@V S %$y`( < -APL` 88#@@% pR:0S 0S  0Ps $0S 0 $ \;b%D` p- 88LM@#P1`s  p 0<@80%`00`P% L5 0-@<L 88#P%`0S0`0  Q0 0 0S000h% -LM@< 88# :0S00 0 P -LM@`TPp 00000 0(\0 @Ts<0Sp`3 R-L`Pp U @V@1 <`VPpLT4 p-QLMP ` 0 `R@T 00000 0(b\0 @Tp.<0S101o& -L@M0$K0 0 1K$@ 1[!0 ! -0LM@( ( K0 $K0 1K$@ 1[!0 ! -L M Y pp0Wp`XP4  R400400@0 @ @[`0K@+000,0 j0  尡 4:0S$P X 00S* P0  $  .+D` -LM@ P 70  0P00  +70 -LMX0@0CSX0P(P,Ph P P  -LP`p @i00P, d 0 `0K$y`T4 -L@T 0` S V@0<00`PU 00S PUQ dp0S S l0SQ h 0㳵$y`]t`&],y` 0-LMQP-P P@K00, 06'P0S000-0T@K00, 0!'PQ0 Q0H5D5,0 P h0SlP,y` 0-LP@T t 0 P@t 5( hP@0lSl00p@p ,y`l \p0p0p0- -0 @LT`P p 0S @T p0 S 2! 0W*Pp $y` p-LM ` 0S 0 PU 0S PUp 0SU )#@*#pp$y`0@- P Q:lP7 Q*@0\ : 08 <40P 0 00aS a00R R 08 08 08 000- Q:lP Q*0\:00 0P00 000 -PLTM@`P p@@ @0S񟗱`}&h}&p}&}&}&}&}&}&X}&X}&X}&X}&}&X}&X}&X}&X}&X}&X}&X}&}&}&}&X}&X}&X}&X}&X}&}&~&X}&X}&~&X}&X}&X}&~&~&X}&X}&~&X}&X}&X}&~&~&X}&X}&~&X}&X}&X}&P&`&X}&X}&X}&X}&X}&X}&p&&X}&X}&&X}&X}&X}&&&X}&X}&&X}&X}&X}&& &X}&X}&,&X}&X}&X}&t&X}&X}&X}&X}&X}&X}&X}&&X}&X}&X}&&&X}&X}&&X}&X}&X}&X}&X}&X}&X}&&X}&X}&X}&X}&X}&X}&X}&&X}&X}&X}&X}&X}&X}&X}&Ȁ&X}&X}&X}&Ѐ&؀&X}&X}&&X}&X}&&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&X}&&DpB `0K> `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh K \P*U 0 P: cR 0P*0 60\*W \*0 RUil K>l000} 0 RUUp Klp0w x0P:UD 0 P: cR 0P:0 ~ | `0Kx `0Kqt0àqǠo0<àl<ǠjhpfldbP07*0q[U 0 P: cR 0P* 00A S@-@**\ *!00S 괁&&4&4&L&&&&00@S S ST!0S * R:!0R0SS `S0SS 0@S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @PH5 - @LM i/hA4^^p& -LM( Q0`0  0 R1S 1 R j 0R0!R0q50S 0S 0R+d\ 000R00R00 A  Y P2P11 0AP J P2P0P0@0@0a!R0 0! Ro?# 6   6  0\0 5 P   PQ JQ0% %01 $0@T 0 R 01@Q@T^!i< R@0@ D0@0 < @0 &h&p&x&`y`H&5h`a4y`l5m`` -PLQp` 0@S` TV@0@S0 0C0` t000 p-LMK`J@T  0S  Pu PK p p-LM@*P`% PP 0S 5p@ p%@-ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T 30S  @T4PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S `5gfff, ,00S0 000`50y` Q00 00C00y` -LM܀`0 V$0  % P"0 @PPPTU 4pK^/ :5 :P`PU@00T00S$0 S $.`0y``5T4 -LM0@S  P, + 00ah+ꈒ&5Q 00a p-0LM`PV @T 0  R @T`Vp 3/P 5 0S 0 S %/Pp4y` p-0LM`PV 5 @T 0 R @T`Vp0S .Pp4y` -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z M P  P 00 P$0  Q 0 4y`h5p5l5H0Q P 0 RPQ4y` -pL W`4 @T 0S @T XR 5 y.P Q q.P0PP*0 0#P:P P-L`Pp @@T Q P P@ @ 0S0C 0 @@ 00\ 0 $0\   g|& 0-5P0L5! @T p@TQ 0 S00 10C1Mr0h -LM5@05!h?W -LM@ h 0-@PTL @&rT00000 p-LM`&p0P@T %5R0C @T80ph*(50S 4y`5 0-@0L@PT (.P @T004y` -LTMPU, `@ 6U 6t U 60S{P6U t,0 S ,,ttPp X6%Ux u 9D6Uq 86U| h,6U. $6U \ p  0 x 0, 5 @V-*Pt0 `  Pt( t1  (%q< 00\5   X@RtN@Ht1 40S Pm0S   P^4$5ATO @TL t0 SG0DX0S 9S SDq 0t 0g 5t@K0 P5d5 0H5 @TM 0S 0S @TAIF#S SS2UJ 52U 2U!m Pt0lPKp0K@ P@@ +@ 2\@R P0S  \0S 1U1 UQ6 PP ) P1U1U:*|1U p1U- h1Ut0!T1UP1t0D X` t0 $1U 1U 1Ul@K@ 1t0@ p0K@\ 0U 0U0Urd&a!]`i$ixi zi T4FixIi i i i qϖl5i$i i i$Fi@Hi Gi i Jii i 5i i$~i i 6i(KiŠi$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,&*P0pD1XU.LK(  / 0S7 U@` 0S<Kc$ PU Z 00pZ@ PETUXUP0 0eP  0 / p<K+ P PE p `4y`T4 -LM@Q 0 S00 10C1bo -0LS`_PU p+PU PU  PPC  PpB L@T V+P5 @T( oP@#  0000 0 $ 0@000@00 pp  0P T.0P/Sz.0P9S X3R: R1 00C B 0 !  80S$00c  k@T 1000 ^+ S0 0C 0 0d0d$0C0Cbm iOkX2  @2 P`R0pS! KRI 0`R 000S@0@0@0i6000#k0Sf000 0PP0 $p1U! h1UlL1 $ ^41 P`0pS Q000 0PP0 5is@50 ' 60 P`0pS |P000 0PP0 q &P kizjt5aah`5݆a5@-@@:@0\#" 00  @Z00L^^|5 0-q/0LP@0 Y\0 XZP<Y 0qr*01<0 0hI00@0  8000E  /r?+0& -LM!@R \0700!R\@-@ *,  0!\ "0! ":t3@-^p`*#!^ ",!1 #: Hu38u3 0-0LSP@/ S /0 ) )0S0S 0S0S0S 3000  00 00l )d0ST )L 0^ 0 000  0 ꙸ5555 -LM@p@,`K4K P@I,0[ 40[A T  b%0S  @Y%PP0 007 P@  w) s)00 p1 0S!00s/A 1014 {7 w -LM@n@,`K4pK 9P@A.T % %0S  @%PP00CS0 H R0700 10C18440 -@LMh꨸5 -LMp`P0S@0 q01  Tq 0% ~$ 0(:0 \0%0 0 0 WPX0Z Y@0 <0@06`dU4ȁd&&Dy` -40LM @P0 +0Dy` -LMpP`@x <P 5mTP 4 10SZp00p0  QM QAB` 0R1000P!Sp0p00p060˾1 @`|0S uh0| 0h0  | l000 @@ d000Mh Y7 (p9Ch/\@=h40 3A L8aaaLU4h`lU4Q0P0ȁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0\02i 1i i P&i -  0@  -@L`p  P)P @  0` pP0 C8U4 p-RLM`@PPU@p 0-L P@\p 0  e90P \ 0 ~P 8U4U4 -QPLMpP` J WH 1RG 1RB 0S?0@S000000@ PU P@U 0S @T1!  P UR*01P UR:$ ᷼0U0P00S @ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  @ 0S 1 \1S50S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:00h^^ -LMPp0 S,P 0  0PP0S 0 0 ^0 R*0P  R: 0 0SP0 0S0SA^@PgU 0 9 0YPUPP`V 0 0Y`V,0U 0 Z 1!P@ 0 S @T 0ST  ]P XP @-0S<@ 00  @ 0 -pL` P@ 0\* 0S\:0000Q0\ f03 0@@ 0  P@@0P  0   P 0@@  -L MP@`0UPR` U0 V|Ք f8% p@T0TS@DT0TS $P`U"0WP 2 ,AWkPP0DUpZZW ! 0XPp8 |10@0  $d1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S |~5  } Ppg>  00 F$aPy``^^d5Hy`X5U4h^^ 0R P* 0R P: p-LM0P@S0` 0 T\  00 00 0P0`@p(5p@Ly`V4 -LM0 @ pQ8 1e 1E# = S000 0S000 0S000 "=" S000 >S0 00'  5 X4 -LM@!R111 h: 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMe.S@ 0`?C0CQCD0T T(0(0 0 #"X4X4 P P111< 1N P PP1N  -LLMß0囎P@`,0 0 h dKh  }hP#0S5UPUd0[pWTK84h R2b3c13d0<3 ,0S 0,C dK0  @T@p0d0[Wɖ 0  0 0  B0 ɖɖɖD2 1l0 0ɖ|rh _U 0pWp p00  t0 P@pp0Wl @ 0ɖ5,# d[t0Qd K0 R QQd K00 Ðh0 d K S 0h0 B0e 0_ɖ 0Xɖ 0Qɖl B0Il0 0Bɖl 0:ɖl0 02ɖz` Y4u3} Q00S Q -LM⼩P8S wSp S p  Wp!0S7 @ `<` ` ``VW p1@ R4p@TL1 R P49 S9ܙ4S iV <"'$"'0"'$"'0"'0"'$"'0"'$"'9<949<P` W@0\Ġ @Tytpp kS Sppp 0-0 0 9PS009L@S$'h#'#'$'#'#' $'#',$' 0 0XV000 00CS#'#'#'#'#'080000808070:00;0<0<0: -LM:@SC \ ʀ 0 S05:A-}_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWPu3 -`"L0PS1` Q@Y<2/A V00S\ \u, pV]?>1 u.Q L00N\Q9?>1 u. 1LQ 1?09\Q $1u>0@T@V98 90`998 1u>0@T@00 0u.S L0100S| (Y4v3S "=" S  R@)' )'d)'T)'\)' )'T 1S1 RP 9S v30 1 SRv3 -LM:@S0: -L4MH \ 0P,0 L P T  L@PP`L 8&L 101 VT c LT 1:)01T00LTUTP$0P0T 0000C000I S %L0P ] P^ Ip 0H@0Z0H P 5P50 S H 0: 00S3 p0@@K 4 HP: 0P =K) \ s{YX  0 PSiYX P QX pPpC D 0 S %: \ DK0y{LMT3 ,0S ,` p@jP 1#1 1010 P0` 0pH4;04;LLTL 0Pg0jUP!D KU \p0 2{WD0XPH(;0(; 00gUPS  U P  \0{P P XXpX ew@P " 101P0  QPP! 0Y` 0pS@$$ R 1 0+10 ,P(P<`8`100 0P RH$;0$;y H 4;04;t0@00L0 0#SU@$M$ R 1 0 +10 ,(<`8`100 0P0SH$;0$;E @L ePH\ L;0L;9 \0H :d`o`m`TY4p`440 0 0 RZ1Q^^  Q-$00 0! Q ":^^ -LMRP@` 1S9Sp  Rmp:0:c0R0,0 : 0:]9S 1#29  9S:0:K 00)RF !R; 0 t0S50t0!R- 0000 )t0S& 00t01S5z0S x R 0Sx0|00000C000t9S x9p)0x9t)0SY? NY l00l0V PodK=,0S:0:)R,;0,; 0Q% 5 @Y Y 0 ()! P 1 0 QRYPY:0: Y9S 7'4'4' 7'4'4'`7'4'4',0S :0:9S #  P5  0w0@ 9 :0:  /P:`0:z P^P:`0:n h0)0Rh0p Vs <W00P00So0- 0#IKPt010<pt01W !1R000Sp1p0V10p00000J1t 0 1t  PP 9S p`a  P:0:~:0: ,0Sc9Ss P#  Pk  Pe ,0SN9S # P9U 9SP 0:0: _ PP 0 P :)0R:0Y5 0 l(  e( p}0 t X( @\7L191i5Z4ʚ;t5$Z4HZ4hZ4Z4 -L$M 0pS iLPp  @K  h3 QH   L?0[@0 S 9'x<'<'<'<K  6K  0V 0D0 D KZL K̒D@Tx`PP 011$ 01  @@!@ @UZ 1:)01@Q$0 0 `hV+D0S0    B0cc  0R `J 0L ZPLP jIDpH0S 1@0C8#8#$0$ h@P$`$ R 1 01+00 (0,0'>'>'>'>'>'>'9US 0;00;  9USW 59V000;0;(0 H  9US9R 0 500 t\p0(0h" x P`  ##X00)l0l0:0:Z4Z4I4Z4 -LDMpP 0@U`, @ NU U ;0 ;9S9S U0PP< < U0d S# P ;0; U\ 08 @T`0 4 0 *0S4@  S0@ 00@T:4@T 40S0Q 00 RR 60R :0:0@7 P00CSuQJ\ 9  A R 0<    ;0;4 80 W^ ,`  #\039l l ɖ< 9rro 9ɖ9!2C#!0 < ;0;R9)@P@dDFA@04 Spʄ1dLA R0 0000 00>  P   0 ;0 ;:0::0:2S8@ G:0:S# U 0U 9S :0:9S0dSڲԩᲐY 59Z000;0;w70U'(  0T8 4 *0S4@  2S8@ 00@T:4 R 4@0S4 80 W0S   US PU U0d S9@@ l@D@ t@H@ @ T8 4 0 T L P z*02SpF'H'H'I'HI'H'H'H'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'HI'$I'HI'HI'HI'HI'HI'HI'HI'XI'0@ 0@T:4 R: 4@0S20Q3 0 0 S+1u>0 R!:0:9 P 9S :0: / @X  00H P& PH 0@0S 6Q6  #F, @)?D@X @0CH?0l0T@L r P0 s0804 @19S PU00X00S 1S   7@ 600   P 4@ k9S f0 1"0L P BT X9S\:0:P K:0:8@ DU$ U0dS;)0RA; R 9Z 5 o  P(0r  0dScڸ1S ;)0R;p0 8  ,@ 0@0dSG;)0RA; R 9ZR 5  h 9SD 9SAT8 4 0 *0S4@  ;S0@ 00@T:4Q 4 0S00S 0@ RR 60Rd007P^9Z ,@ @4 80C P 0  XP2S8@ L"`P"`84`4X4hY4Y4Y4 -L M1PS@ pVP`^  "K "[9 S 5 ]2[ (T9R 5 O[ 9(xX. 0Sx0|000  B @R0 001S5 00t9Sx9p0tx9( h5  4(p5  Z4[4P[4[4[4 -LM%@: 0S$ 00/P w3 -LM`4@Kp)0 , 80 x`XW@#0# <0 Pa T P ,0 S , 8KP79 09  pW@T 8K P<( H8K P00  4 #( <}x<r(@ 0 `e 8K ^P t t0T (@P@TP0PPpWP@@y`[4\4 \4$48\4D\4t\4\4X4<65\4 -pLMP` @# 60 07lal0X0C4W B  )0SR 353576r0b0s c t0 d0969696l0p0t:70x0ZPx00x09Vx00x0 0-@PL ~ #z0760 pB0 W0CXj535367b0r0c s d0t0696969l00p t00' 0 -LMll:\, @Ppx H:\ <:\ i0:\9 (:\ p,0 S  ,9Pp@ P9;99S 9S 9  ) # P 4p9) ;9 H9Pp1p ȠDʅ \9u>0  R! 1?09D:9S9S9 l R8DQ98\ 8\ 0p`8Pp9@ 108%S<84p}{8pPpu8 R 9k 9 ;h4p9e9 b ;7\ 7\a 7\U|7JPpO90SHKP }K  ` 0  SI 04S]Pp.X`W)0CX)11C R# r P9<9 P KP [OK! G 607P0KP [9S)R 9 )  #`ii iii\4x`w3i i   i|i i85\4i|ii !i ii5i i i8i 6i(i|i| 0-!91)9!1L)9 t1) QP*\1 X1Q00@T@ 9 0  9l UhAN@0)00lP  -5L`@YG909l@} NW #p  9S9 #00#0!> 6 6 7) p003039  039Sr007) ( @]4 p-LM`lP^1u>0l@WT@D*0@@R l0S@9S,#9@ # @ :@S 6 R @9 p) # .P @7'P  # -LAMH5 `$  9,#(3(  &3N @R9099PSn Pp; z0@S W S RTPW)  00)R  Z 9W R ) 09 $0S $& 9S9  :SP )0S !000& 09~)PWp 0 Rp1PP IKl|lAx 0  PPIK?> u. 0!LS2 0S2 \\ q?>1 u. 1LQ @p \`8]4d05T]4 h]49)sX 9S0 p-LMT`P0S@0 0 T yp@5` -`LQ0 @P@d|DFA 02p Sb` 0 S0 0 000 `00L"`P"`84` -L`0 @PM@dDFA 02b SpD 0 S0``00`h2L"`P"`84` 0-P@L  000 00-P@L 009 S ) 9S0: 0h p-LM`@PU:0 :p p-LM`@PU: 0:  ##9l l p 0-LMHP@0N K @0 K 0S  0`|]4 p-LM9@SP 0 I000p ` V 000p9SSP` WW k1S  p p-LM K@PP9 n ` P eU b000]p9S" ePP 0Q #2WW -1SB000=p I3000.pb^ -LMpL@PT`  l0S 0S`3`#0S60S`V P  p-LM9`QP0 )I)"B0 t:0C: R xQ 0 Sx0|0 00C0;1S9S:p + ]4 p-LMP`@@D@T0S p  ph 0-PNL @ 0S Q00h -iP0L90 9P@ *:pR 0S 0`S W@ hm9S _H;0H; a 0Z g -PLp`M0 9wP@ JP@ h7 -LM9PS@!00S.ip9"Ƞ2C3 ,^0 R))9ɔ9!2C#!1S0 00  0i -LM9@S)9 RC  10 1 0 91 ]4 Up@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @OP00S T0 0P PPP>pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP9ɐP@ S`` 0SF S p 0PQ Q 9S # 'PP PS00S'8'X'X' 9SS# PPP00)R# 00)RPPV 0Spt5 -LM@PAAP`p Q2D8 M@P 0iSS  0i?!1`R0SP1P0P10  1 0005  ! 8101( 7]4 -QLM`pPx 001k  80S $00c[  *8PUR 1000@ `  921)  )   #1!S(5 9S PX l@A0(!(0[ 00\9SP`9XY0`90\Y50S)!0@00 S 0 B0 0  0e0e$0C0C5]4^4 -LM`Pp {?P? 0iSS;0@S)0&00S!ꐃ'8''8'P` 00`IV000Q`T( 8;08;U57V s00 0 S9PPy 4K kP` @@G90U  @@@"[ 1g  80S $00cW  <7PUL 1@0000000921) )9S''ą''ą'ą''ą''0#0 .K   9 0@00u00 .K  #00 #  .K4;04;jS 0 B0 0  0e0e$0C0C^4 -LpPB00ʠj`P 0`/">C20`0E*S=ȇ''ȇ'''''''''''''''''''''''''''''''''''''''''PX`@ @@P -L4M, PPi `p p@h 0 T40 8 0  P< @< S@TPPR"0`0 0`S`4  00^p T<800 oQ84 ,0<(0 0` p@^4w3 0-0@0PLUPP @0 0-0LPCS  @0200P@ 0-0@0 LP@0 - RLM`p9X"@0PU $ q1010  1 UV~X"@\$t$0S !0 ;00,(  00 M$o $(0'`Pp 1!$ ! PP!P PW DH$H0DS0SP T00R00S Q00P00S00T00  0Q00`P00 \ S @9SP00 T1915r  * Pp 000 *l`B}O@ ̰o`m`^4^4^4 -LMW06 S W0,0 13 *p PZ @0P0d PPe a`# \Q3"`29 S  l0  @@60706 =60,`w0`0PPl )`R00  00@  P@@,l0`c Qp  t5_4 p-LM0PS@ ` 1S 00|0SP0xP0|P0@p00025 E0 0(20p0H_4D > <<0< 0!Z0 0)9 0!1 * ''?' -LM@XQ 0 SX9\9 `90C`92pQ 0 Sp9t9 x90Cx92 -` V `PULp@0@ 0C^SPUU dIV@PLBPU<=V@(h7P3PUX`45\`4h"4 -PL`@pPD'\'''  0 . Q( 0@!T\WLHV@T,h  @T #2 pkd_\ XxS, NTID``4h`4p`4x`4`4`4(445`4`45w4`4`4`4`4`4 -L$M@lP, , W0}Z8 4 W` p]0 H0 0P< @0 DP < 0R00 p 0 \lP@  0R\@ 0R  , 9S 00 0Z 0 D0S 0\  00 Z0 \\* H0S# 0 R 0I0 W 0 \ 00 W4 0R08 R0S80@8@ p00S, 9S 0  0 0S40040 @ -Yi@L X00pQ8''0'''V0М'D'D'ȝ' '9Sk SL SC S) 0:XQ 0 SX9\9 `90C`91pQ 0 Sp9t9 x90Cx9 1 Pd0: ` 7PP  0PP 0` PP 9S 0PP9 0909  #l}W 009V񟗛t''О'О''9S D 2Q d9@ 0 P0P005 #( "VdМ'l'P'P''\ 0Y 0\ \O 0iFVCМ'М'ԟ'М'' 0 V2М''М''М'W0P50:!#uɔ0`\\ ( T 67kl ,  {t5`4`4a4a4(a4w3@a4@- \Pp`@@ P0 R2u  00S  @ RJ 0 0S  ^ZW 0R* p-LM@ 0 1 1pP00 0 L0`V<@00 Ba2a3c13LL0Hp逖C -0LM4n 0@ d5 0- L  @W0T* 0Q1 R0 0 PA4 e@ 0d5 p-LM0@0P @0HW`P" 0P 1R 0S* 0^ , P0@0l, pd5 -LM`Rp @t%  P`F @pT`85 -LM4@,Kt 0@  @ P鈤'||3 -L M0@(KJ 0  @P锤'w3-0 Ƞ 0 S sQ||30 1 SIRw3;3p@-}As8X@X`!X # 0S  0\pUQpp0z3G-0 Ƞ 0 S sQ||3 p-LM@l0l 0` T0P HP0@T R 0RTph|55{``` -LtßP0@S0pH`X0 0R0D00 8\43(]4 T < X0S\0 S1P P .  b# R 0 0 0 R000  Q00000 S$h걿x|` p-LM@P` Ph00P30800p p-LM@0P `0 R @ `N00`30(00pph -LMPQp `V @T h0  @T(0S@0S W@  -LHM@HPp\`KU@ HpL0X0 0 T 0P0 4 0$48 0 0p -LMH0@S&0H0 -L M` ( A"(4 P 0, 00 Tp 3S @T, m h0  ,0S00S40S80SQ 0S0S0S 0SC , P0S 0S$0S(0S$ 0S0S0S 0S  P34 SX 0 0 XX0 ,@ 0S0S0S 0S 0S0S0S 0S h0 (0S Z S}34 Sy80S Y SYZ 0-H0LS@HP 0 1@0 Q Q0S 0S$0S(0S  00  ˽(0S 00(  -@LQPp`  0R` T 80S0C80M00VQ <0S  0 000喽 Q" <0%@pW 00S DX R 0pW 0S T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD1 <1.Xd0 ,0S ,0  00 0P  0 0@G, T00T0Tz```@i4` -L M 0@p@A`0d` 0p0#!dP_0 0d0  0pp  -LMKX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`*xp0 p``P PUAP:P55 5 p-L M@@PP 40`00 @K@0SL LᕷP808 uPp鉷p醷pܾ5 ( 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0\@| 00 T@ RL 0hSJT:<0\ T0L0P0SSP@0,5l5 -LMp0P4`K$0 ) 4P0S L00P0 $0S $ 0@P  0}D0<0. 10 S `Pi4~`5hi4 - 0L P55D}` - LMR 40 S 0 0 Di4 -(!XL"x H` P \ hWU H -Lj!!Q#7011A!1 Ƞj1 j0A0 x!0hp00 cT1(0000 c( wj ! a c0#7%c!c1c X@008 #HT 00 0 R 900T| ?A7c%c!c1cW XEنb^b^b^b^b^yb^&3``5b^5b^ 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0鈾5/u``b^b^b^b^Eنb^b^b^5 0-LM0P [[@[0[ P@0b^i4 -L(M,`KD 4pK4 @$Ÿ$ 0@w %Px Q eB!2b2c621b1c \ڼ0P*0 RP 04P:1!1!@P @@8hQV2[S@ ` B1 2P13[@S `,@"!@00Q@0   0婹0\ eB!2b2c621b1c1\ 0T33i4`5~`5о5x5`h`x`{`i4T`i4`i4`Ծ5ܾ5i4 p-X`LMPv@T 0 S00 00C0hT ph` -LMv0@S e000 RqP "2SX00X0 o90X000 0XQ0SF 0SC : t 0 00t ?\P000 "48<#Q000 R000 0S  b24X P.P 0%0S q Q \4 R(00(0  o00S 1 MP@P ջ#0S#00ͻ3pW 0Q pWp0#$0$ h("( "4 4Z0 "48<#8  `00`0夻,#00埻S!$)-"("4 4Z00SY 쒟2  Q IP: 000 @PP@) l"@00@0P "4 408#8#$0$ b$"00]40$"040 Ÿ0 10 K!@oF!d00d0A1d00d0W L 0Sh 0Sd 0S`c 00 0 R 0S < R 0SR t R 0S  R 0SR|00|0 $R(00(0 t00t00%p00p0[P@P000QP@``|55`x`55`~`5@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0R` ؾ5 -L M p0 01 cQ c 0  0 RT 0Q0R  R> @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V  c "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V ` R0@00@ ,$00C00f8#8#$0$  "4 408#8#$0$ ,0S , 0S00,00 @ T,  ,@ "48<#Z @"48<T#, `V}0@00 001Sm pP``90V0C0@  P`.00C0V@ 8#8#$0$00 0 0 000  R000 @"@2@Pz @dDFA 02 S`(1b1 R000b0 0 0! 0 0 0!B W P 0P U  `! h00h0V 0S0 0 0 0\!000 00C0Q Q00P@P00 Y 00S0<0 0 0 0 0 0  00 00 '꬀`5L"`P"`84``P5`x` - @LTp ` P R000@ d0U0C0 R000 0@P@dDFA 02 S`T1b1 R0pp00ph騸f5`L"`P"`84` -L⛸`p㗸0S000 R P00C0@ T h@倸00|P 80S0C8000ho 00 0ꀀ`x``` p-LMt`^0S YpX@00T0SP00phK(P000^0Sꀀ`x`` -LM|P0S ppp00/"?CQT`1@000?0S 00/"?CQ@Tx`55` -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( *P H 000P PD @ 0D"P00P00iP0iPT T|2 R8 PUT0 0P, PE0S P kT P 0 0H_000  R H 0D0 P P Tx D XPi4@K >2 [R3[Q0S 10[#0 210K[8K@  %10[0S% S 2[0<KA <0 20[020K@0iPpS20[3 [0Si t d}P. 20[020K20[3 [0SX0L0@ 0#P H  꼾555`Ⱦ5 p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 P@p鐯꜀`` p-LM@0`+TP p0D #10Pb^|5 p-0LM $0 (K0( K'K1KPP+ 4 10 S 80S0C80pY00 R0`V @T 00 Q @T`V80S0C80p7.P80S0C80p$4y` -PLP&  P` 0@10 0 pD00 P2@PE0U :0U0*00|5b^ p-LM` 001PC@ c 0!0e 000e00 000p -LM1` P@,`  #(00(0o QP 0SsX  0R 80S0C80t000 0 0T0\  0#$(,"(DRD #0_ Pp 0#!DQD#Ip00C0< 0Rv "0 S0!0" CP"(00(0l"Y$00$0Y ,00,0WM APA|/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(/(t/(t/(t/(t/(t/(t/(t/(t/(t/(t/(`  ,0{L00`L0W E400 0P Z00Q00Sw }Pt@Qq 4 000Sk4000P0,P ,0 `a 0 Cح*G+,  0 ```ؾ5ľ5 -LMQ@` R0BS)l1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(2(2(2(2(U 1 Rt 0hLR 0Hp莸-4 0Phq0 p00@S P0S PU`PٱlP0娱p0 p h0@P 忱PLD 0`@ {@`Ⱦ55T``о5ܾ5Ծ5`h` --)L4M0 ,0 X 0 QL X`H0 P p D KD `H @001H0 ; 0S* \ @*\ 0 WP ) P 40  0R 80S0C8000P0 0 00 0S r P P T DJ(4K(XK(K(L(T 0S p@T 3R ,0 S ,5_@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 5S@ T  0S @T T0pT;p 1P7pw 000s 0RP@ 0 <0K; K0@K80 D@Q |@ 0P0l01 v&! 0?0 p❴ PU  0R? @1 0c0cS00062 Q V10 R ,*000  6x!06 8CR 6S 1'0 1 0 GP!zP$1`W0Q0'0 !\@0< <e $!0, 0cS ` 000 T"0\"?08t0`0`S t07t00K 3t07t000C0#3# #R?60  000cS0H#LL10T1p3@_0yD 00 0 R000 0 0 00 0:80O$HT!0l0bSL|040/P$B R 00cS10cS 0 0  1 01 Q @  00cS10cS  Œ0S \  0 0bS i00[;6t S7 10T01t 0c 0 0bS^ڰ0 00  &%0&?08t0`0`S? t07t0 0KJt07t00!R$ 1'0 10000S00C0 `af 0O&0 0 ,7b~P7P'X'R? R =Q 70 S\ L!p00bS P0Q0R00S 0S P@0S\ X10cS(0T1p L!Հ`Vw 00cS0nS 1S:6SDt 0R00 l R8 0!R 410cSb l 8 X  |P h0  HP2|@t 0h!0bS5t0`1 S`500* 1R 40 :|0S m )0?0 H $ 0RpQ lLP a0lS0VG,:d 8  0000|  @_hX| 0 |P h0  HP40 ' L@ F 0St; R  0t00D+t0ñt   0L@  #+0 ?08⤱HPKd`K R R0 0 D0@ @KGKH@Ku0 \K4Kd@KcKkK0 &Q Qw ! 0 S- 00 %0 S   0P p  DX Pf 101  f R \=@T2 0R #3R ʌ tK 0P P P  ˴P1010 S1010P 0 `( ߸l ۸0} ո0H0KGK D d0KKcK0`0 &K]> 印P   0R00 R P1010 80N  X00 x0  05 `|0t0 0<4(<"4!*s000  R 0S0s 0S0S 0s R  0S0S0S 0S 0( fP000  0S P0 @ !0 00!0 UAP000 d 101x0K P p x 0R0%p * ]xLaDj4 -LMQR0@Pp2K  R R` U`V00V0S RM R @00PfU00SV 0 6S&K⥷2[#$0$"K"[ R V 00 㓷<4(<"4!<0 ㇷ<4(<"4!<0  6St0 r 0 Q1 !0n@P\0 t@ z Zt| S2\ Z h hXZ00^1!X\ t P0  CX@0D P3S0XP@x0  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx R4=!,=0x aS0b0bS T tp0 0bSt1Sd  S( h tp tp00 0S J? dh `Xt ɃXh  r X00R00S,,h00h0 0!0bSHD0OD@ FPp 2 02$0  1 ԖW' |Kh0 0SW \0 h  h 00c<  80S Xڐ\ 0.P \| 0Sy h0| 0x0S ~x 0 0 @C t0 1R0B0X401 0,$,!$#, 0d,$,!$#,P 4 P0x #R7R9ɟ 2Z`ZZ"("("4 40@0NS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 0St0 0t0 1 0cS 01!S8H 40!0000@ 0R t(0?0 400t1SV uSS `P.d1l@ǟTdA@00@0tp 00 0tpZ1 0cS0Xt0 t^<p,0 S ,0t07P `(Q ` 2RAR6S87ó t0`7孤|7 1!"4 40| l t00| m0&00 |@S;0 0H @ ` S!@( B"40 0l 0|| 00H 0 Xa ⍤FZ 1 0cS!S 0d0 0 8#8#$(,"8SP" @<4<("4\! D@T 00cS10cS ,0 S ,ؠ 1 R 13PAP @P<@K0 P<0K;K` cK8P  0XX1 RV @P Ġ̌ .Č 0$PP D@T 00cS10cS`F0d#$(,"XU*`1U*t0 h10hSh0.l10T 005t0t05t0E(P`(5$'h(@^aj40Kaо5r( -L0Mp0<`K@ 0 u4KPP@ L0 0L0 06$0 0$0Q<0P [ [/ 5t0%K>`PKdK(0D@XK0C808( B`xLa:T55о5j4Fr,5(@^a -@Lt0`0p h, N? , O?Ɍ LQUP1 Q 0r0*0r0P0,H0l <^*40  ^:00000YxLa:<58^a5 p-L M@㹌t0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LP` `0 ?08‛ph逌<00<<0 xLa4^a<5<^a50^a 0-@Lkt0P6 S \0P\ L0,  a R 8 80 ?0K0hK4^a<550^aMЍ -LM Q`Ppn \ 0Sd/, @0V0T00SNTD0@ 0 Vf((((((((<(T(d(H(t(((h(((T8 Y 0,00A 0@P0 0Sx000Dh0    $Qh0< P0SK S. DPx% 0:0t P #08000#60 ?0ࠚA :8P=7P 0S PQPx Pro0 S0S0S 0S 0S 0SQ0s QiPN ጹ 0S 0S P E;08Y [P50- *| 50,H0'H0S0@ 0 QϠ 0# 0 01  00# 0 B 0CS0 sg|| 0 0 0r @0r0h0   ᜺ h0   ᫺ -ՊU V V  U 0 Q  0oP 0o鈻xLa55Ej4 -L M`@pP奊, 0 S_ UD 0 R R/ ,咊  0` 0\V, V ,{ W W *P !P 0S0 Rڰ7R'P 0S0 Rt0t000t0 0W 0 W* 70t0 0>V 6 P p-LM0PS P0S0 P@|P@ p`GP Fh0 00t1@000@070p55@^a 0-6| SL@@Pڲ0 0S Lx P@60y@ -LM6@S (((D(D(P(06@T 6S|0@6P S000 0ό൘06054^a -LM⬒X`, P P0SR9 Q㍯K"!: /q5P@/D2(K0S S| K 0P@t 0KMKP@ly1X ( K0SZ SM X W DP @0  @Xb,0 S x,妚5W @ 0  000 @ 040 XI/ 5040 00 0(K 0 S S W @X  ,0804 h 0]Z LS 0 B0 0  0f0f$0C0C0F6(0S9@p5\^aMЍ -LM QP`@p 0Q0T00SQ((((((( (`((P((X(`((h(((((((T pZ X᝺p W2 yPph0 22  s t h0  p Ճh0  0S 0S$0S(0S 8p㾃p ᶃW(0S㭃h0  0S  0S$0S(0S9p 㖃:h0<4,80 ቃ000zxh0   0o" 0o-h0  \gXh0  +QoM-pKh0   0 po 0 oܴ妪^a55\]̾5\3,k4 0-LP:@0h3 -L MQ@P`\ 0 \8 0*φ @Pi馇54|` -X0L \<1  %( 00 0 5^a --H0L Q 1(   00 0 5^a -L MĤ@+@K0 0 P?+ ["2S S (00(0( 0S :"2`S0 S 0 $(,<4<#: *0K0S0000  + ["2S S( 0S:"2S S0 $(,<4<#:*K) K)0KP 0 $(,:0# # #8 0)[ 048!,!$ <0# #$# 00S 52 R 2pW @T Ve 0S] @TpW< +[ i0, O\`B \ B`z00S <P  T] 0pR)000SPP0!0P0060C/t1 @P0`S 000 @@ 000 00 0 0R X 0S xP$00$0`*K _Pl(PP+ [(000PP + [ ^a 54y`^ah`aaa8k4 -L M`)0K p6) [0""S) K S 1S1S1S1S `6 R T6,  , _700,1S01S41S81S  Q Q Q Q 1  80S $00c ( zpW 10(00@`00!( B("("48<##8005 I 0 B 0)P[Ui U^40K (40+K,$,"*)0+ K00*K *0K匭*[ 048!,!$ <0##$# 0D000,4p R 4 R 0 R ğ ( B0@ ( B0@0 R   B0@  B0@`#(0/0(0+K) 0#P$#7000p'SV 0( B(0 0U  0g0g$0C0C00S9000500S/ 00S'0 0 0# 00SfX (0/0(042 R(1S 1S2,  , N1p  80S $00c`  pW 1@000 @ 0 000!"4 4`!0庀(1 0 !   440)P[U Ug00K 00+K,$,"*)0+ K 0嶀0*K *0K唬*0[0+K 0|0 Pv0#$0$ 090 "4 40S 0 B0 0  0g0g$0C0C %^a̾5^a-QM 0*\Ѝ5Ѝ 5 --x2LtTMp 0 Q,0  pP1  00 0 0@S0510205 :x0K x [0S 000 ,0S ,ؐw0[S 0S*P0p00 HKdK0 "bV? V ]000@@0K HKdKc@KG@K\0K | tKPo 0 `1/<1t [g000x  P11<<1@D0K GKd@KH@KcK `0K5^a`\k4^at5 -3LM0`SS@ S"2QQ2 QQ Q(!08# ~pxMPP h011 01$0  1 ~Ur 1:)01!0 0$!0@ 0$00  h0O!0S- S @H(0K (K'@KZP@a0` 0 !( B("("48<##801   @tK p@00@00  1#$0$0 a   440(! 10D 000R7$ 000JW%^a o`m`̾5-QM 0*\Ѝ䪁Ѝ500@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ o @Jy?Z@p ה m fpP -L?0@0c80 !<\ P!TP 8PtU"\@P P<0`S 0!0 Sm @,Ÿ  0PpQ `0 V!P0V P`80 VP 0 (0R- Q0S&  T0S ` VP d00 TQ0 d03T0`80 VP" P000Q 0 T 0 (0R  @`0 0K@P0H00 @A 00 KP0 @DPH0c sX5:)T5 -L M0p00 00 P0, S j V@ 0,T@#& V L#0S 0C0Ÿ 0P 0 T 0P@q0p` 0S  0 Y 0Sh0 0S 0Sh0Po0`0 `B 0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S $P 0S``l0P0S 0Sl0P0s  0S0l0P0#ll00Sl0  ,0`@ 0PD媟L#0S0__@L<)l4l4m4(m4k48m4 -LM P@,`z0 v4 r0<  D XD@/">C2"/P!008BS@ CX?#404p$@WDtCY8 ,0 <  004,  `@T@,;P@1@#W<3P@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDp,#,@‹PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@pጋP 10SBt0 0Z凋8 0 T 1P-z@ ᆋ`,@i`}VP3"0 SPPP#0 SP8 0]`X8 T`0l!`!R @ R D0| 2a B@>`& -LMPp  P,P ,@`VPUPa 0 P` ,@V,0`VP 0 PP`,0UPV -LM @PP4  T 0cSP\q8 0 B0C0 Y0 0 0! d ,K0P`,8"HPQ@ 8  3S 2  堊0 T0XP<0 0!8?\>`0 0/ ?> 00cR#`[ P80iW00\!8?\>`0 0/ ?> 00cR#i P<PX!@!400C40 g!40040T0XP%0 @?Q>`0 0?>0 0c$00C$0 P B 40P 00C 00@0 00, ,|,XXU `` -LM @Pp4 PP0 00Uz 0 0 ! 0d 0,K=Ph,"H`0S 3S %Y00U 2  00U T08 UZ P !40 SPUUA 0 0QPp7 ^!?Q>`0 0ς?>00c  ^$00j$0 P j 40  0Z0j 0 40 j0C40!400400,x$,Y, 0 ,?p჉0 8 Z00 ?Q>`0 0ς?>0 0c8 ^$0j0$0 P 4  00 0 40040,A0 ,pU `` -LMR pH @Q 0Pd ( 80P(X`0ZC 4R`0  0400C0 P B 00C0| P "@P0 0` PE 3 RX0  200000C0 l3 RT000T0 0C0 0員 800c ˈ3 R`0` Z"PXQ0 P%R4 |080 < Lj 2@ @!QT000T000Sj \28Q4 X0 20 0<,0 , @P᥈0 0` 4 40@P`,P0S4 @T40TX P, 0S30 f` 0`<`80vLq4 T52000?00s2 q4 T52000@0@ PR`0 ~ 0PV.L5sX50 0S`0 RQ0@@0 0 l兛h>`00 D{D@T,P0S@TPU dm4m4m4 -LM `Tp 1S0 0 ! 0d 0,K#P, 8 80"H@0S 3S 8h$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000 ć P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  /P80PU,080 , 8 8[80`c`0P,080 zU m4 -LM P`P@P00 0 0 0! d ,K0xP, ,倂HpZ4  3S ^ 0S H2T  080  8 @>Z!\000/ > 00cR#= 081 a4 ^Ϡ\0.A00/ ኃP  l1@R\0/ }PI <1 Z\0`000?0A0@ P@/0.Z\0!00> 00c# 00 0C 0  P B 0 P0C0 ,0F Y0 00 P 2 020 0U ``n4m4n44n4 -LM p`0PR 0O0  0ؙ员8T 0A0U2Sʼ@0 $0X: 8Ù 00ş R00p  0庘00 00 ! 0d  ,K0P,,$H@T 3S f4  +00U 80A040 ?80 @448T`0.!48000?.a 0 bS1P4 0<  T0USZ% #@?T>`0 0/ ?>1LQ p3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480 24R`008008?.a 0 bS1P< 0 2 `R4 `0RA P00,$08 0a$08Pl 0l  000 P 000| 4@Pᕅy@Pፅ0 o0` kPE\1 RX0  2000000 1 RT000T000 0媘0` T`0PB P 0 R`0  0B000 P 0 000| P0 $y$Tn4n4n4n4k4U ``n4n4o4 -LM @p,0 Ws*4 0 0 4 ! 0d 0,K%P`, ,x!HPX 3S L1  Ȅ01aY\000?0p0S9. 0X\000/ 0900 0W0p500 0   P4  P000 ,00C0 P B 4 20C20< =S0 塖埖U ``$o4Do4xo4 -RLM`, p{ @n?Q1 Q`000.,0Ae8崁/.  b  B020!ʁPp1 @R, `08P/.  b  B020!᱁P5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` fX, 0@ \8,0, @/>QU `53<3o4o4o4o4G-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -LM P@P 0 射85 0 00 0 @ R@  PU00\pP@ `` VV V 0 4R@_i 0SE:0SA:0 @T00 T00S  Rʠp0(`VP@PZ P@P  0S:0S: 0S @0 0@BPP/V8 8%0@P0L 0`@V \  0"PP (0 > P0@ xK P`@ wPP 0x0(    ᡅ 0S:20S/*@5L 0`(0 @ xK 0PP \  0P 0d x02T0 0<H @0@P0`|0Kd KPP | 0` B| 1X`tKV P    pd0G0 0@K@PPO`@K|0H \a V pQ @00xK  ~PP3x`0` dG0 P6 d03 T0 d0KH<@]0@PPPP ?\00Sa@  =t`K V@ *0 r00V@:Q00 TkD 0 h00dh0   R0ad0F0 K0P `0KH k 0' s RV? P0! 0xK 00  PP x`P` 0 0P d0 3T00 P00!a $p0<H~0@P Rt 0 0 K0PPZ0 @0b0 0] d03T0 0 @ 00xK  PP;x`0t` 0 XP? d0pK3 T0 H<i~0@PPP"` 01X` X0 0  (0 xK00 @  @PPP @@00Ǘ0x1( P U  S>00K L0R-PK ?@K 00 KKK K0P00@0S:0  ޒ p4$p4 -LMPT`@ 80  000    0 08 00R00S 0pKa;  0 R 0U 000O 0 R U0D  0 R 0V( 000O 0 Ry V0  @ H0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RC P` 0pA0 0 0$@(x4`0dCA0 4K0aP@@0Q7x40 H 㴁8 R T0@ @ 4442,5Sʠ0' 70V0   V 0000uU0aU 0000RTPp4 -pLM`X =8 0BRS5 0S00S' R MP@   u 0@(@,@4@ 0 PSP  0K000 X@W= 45S:05S*0 00K 00P@ 0 R0000 5   000 0~  @8500  0 R0000̐@00P  0@40 t @0b00 t P0b,0 0\%:R |@K|@Kp(< ǀ4K1SPUZ0 PU 0 R01( 0 1p0 PEU000 00\%9R K(< 㕀(< 㐀 0 R 0K0X}\)0   0@0 0 t 00b@<0 t 0a0C80 P 0S11X000 ȠZ'1SiPUZ@ PU 0S11(0p00 ȐY PEU0SR 0S@P11(0p00 ȐYF Ġ Z P0 #Q/ 0S{:0Sw:0P 0S00  R0 @P 01R[ 0S;:0S7:̐0Q @aT ՠ PT0QS P ؐ Ĕؐ 0S00 0 R a /000 0 ؠh00jh0̠ S>0LR-K NK ?  K 0 0 0S:0 @KS>0 LR-LK ?  K0 0Pp^K0 0 Pg 0S:0^ _ 0S!0(0 1p0 U 0P 1R // 0S:0S :00@ 3  @KS>0 L R-LK ?  K0 0@ 0S:0 @0Kd K1" @0!T R 0 R0 1X  0100  0  W~}0PK000tKp< ~p` 0 R01X 010 "PP ~P@ 0K 00PP@r 0 R0000 U 0P 1R @_= 0S:0S:00@ ᨓ80S 0Pc0H2z @ S>0LR-0K0 PK ?@K ^K 0K0@ 0S:0 0 K0&T 0D S/& 0S :0S:D0Sh0S 0S 0(pS  Qy 0 R 0P@0050 0/ 0S:0 0S婎Tx`lp4 -L4M0 `0 80 P T 4 0\ D H0 t0PHPU H 8XH|00@ 04D@ L@ \< 00 ]3 ,00,0<0<0 <80&Q0 < T`<)P@8<|H, 0P UU Ud#U80B``fpQD 00 f0 D}thANy@ T0@ @<P@T Dt H0PB4U 0cpaPEVXHUp 80SRH{aV3D0S) P2P"@DP @dfDFA 02 S`1b1 RD 0D D 00 fP  TDDQ<00 :00d "L0,K0)P @,0TT T P  0R0d ",KT0P0PT0 ,0@P P0L0 00P0 <u vPD X @UI U  UD  UA U Up  U:h  U7UX U2P U/<0P0xx`P5`L"`P"`84`5`06`6`7`7`7``8`p4 -LM @0KPP0 K 80 | P 0 5R/8 0S#:0S:0 00  ,K0`P@8Q,854H 0 80, ,@ LRS>-0`pǏ00  0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġ`53<3 -80L0CS%o)o)o)o)o)o)o)|o)0S0 #Q00 L0 R0S婌p4 -80L0CS!Pp)lp)p)p)p)p)p)Dp)000 10B0  2 R0  00{p4 -80L0CS!q)$q)dq)@q)dq)dq)dq)p)000 10B0  2 R0  00Mp4 -80L0CS!q)q)r)r)r)r)r)q)0S1 S20#B1  0S 00p4 -Lp4 -Lp4 -L q4 -L0`@K Q ? 0P K` O4 PKP05SPKP R0 0 <@@0000@< 0 PP P}JLzJ,P I,L(rPxPQ`IOP009004\ \4 v`hd3TTc$s4Ls4s4E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M@0Qp `; {P@ҍ X00#00' PP@р LI|  09 0Q  @PIII@0:@0  -@0L Pp  ZP@`@0 S@`V GP@P @  0 0M @ $  -p`P\LP0d -40( 8$@<( :q@`@, T0C0H0VZ  zuZ vuBl ru D pTt4 p-LM80@SP0 0hl0S  `V p  0 0S0 8 -LMa@@ -RPp =SAT8 K8 4P , 0@  ]8p @0 #=0T00S<K <0PpST 0@ @ L  0 0S  ps  @ =SPp媆 c)n4$t4 -LM4 q8  b8 PU4,0KPŸ @T@`Vp0T"0.E p@00@0, `,002 0`P@ ,T Ps0 0 0$@rxr`0dCA0 0K0$P@ ,[08  ~@xr00 H ot00x00p1 4,0KBP@A 0S@@l0P0S 0S1 P 0S@@l0P0S 0Sl0P0s ,0T @000\%0R ,08 0,5Sʠ 0p00t0 0S0l0P0 l,80080P`a_aw45_a`a`aT@-@1T0, T:F@3 0000 0S00l0P00 -L MP, 40@Pr0 PPp#8  R4 g0@d 0 " H`s,QE 780p W 0\'d0T   cXs@000h 0`00h HsL5H sP5,5S,>QS. 00P0 SHŒp011pGWp00P000 `` p-L Mp@P0Td``  pH@`|< 80`@|phv c^5_a8t4@t4_a@-QM@ 00CS ))()8) P0 Ѝ@_-@Ѝ $  55X5T5 -LTM8 @ 0< P0 @D@  45R 05R@P @@,@ 0S <P0  0S<< 0000`PU`VP0D@P r PH 0 < d P` 0 S/ <@0S:0S:D 0\ @D@08%\0pcWp!L0 0OTSp0@` h sd h 0S 0SF0SC 3 R9 d@< 0H@S00 $,K8QP@&H<$,@0cXX pL H@ $ZP@,@,@ 0SvP<<000,<H$ 0AS ,K8H 0 Td0 0`@R4* 0S:0S:\4 4K,@K8H 00K @dD D@RS>L-0`ɯ00  0S:0 0St0p D@ S>L0R-P@K ?  0D0X00\0 0 040D0X0 0\ *<0 0S:0 <D <d P` yUv5 -L\M0 08  4 00PL 0UT0 p4@80S S 1T8l  8 0l R0000  0S|6d t6X 0S 0lS00S 0 Sl 0< S"4%R:05S:8408 0P0R00S l  R:0S*U X 0SD 0@K0T`\ ^P <0l P p<8@850  lX!RPPl00@P P H P0,KB0P8`Pkl0 Po 0 S 0S:0S* 0S l 0@ 04 R0000 L 4, Z` @0P`<  P0  #Q 0S:0S:<@00e`XHH8 XP`\0S<@H0 0Sf ,X00V0S8P0008PUkXQ0 0S 0S 0 R? 0;08@PXY4z L^g6V T0@0K@\0@8@l X b0P@88X0Q\ R  0` 0;080P1 R 0, $R0000 ,,K,0H Hkr< S>0LR-pK`@K ?  pK0 0@ @`K eI 0S:0; L@DK 0 `@YP*D0S'\ P P`XW0T DQ  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPPP@@T0D R)0[*0[S""[0R0 0R@ R @00T@ K0P@ @P T @Px@..Tu4- -LM@ KP 0 0 0-@DP L@P00 4 0 0 -( L0S 00#c^ 0-LMP@ KP  0S 0Sl0P0S F0000 0- D0@L PP0s],05 p-LMP0 @B 0  P 0sD, 000Hp @_ 0S0( 0p0070@8@`@p50 0S00D d< X R  0S 000 p-L M0@ `Rp K;0 R= 0 00 0 R  00 0 O0 0 R  00 0( OH0P@ 0 0 R 0  00O0000 00 0 00 H  0@0 0 `` -LM`P@2 80S)))))))))T0@ $PV 0Sh0d `0X 0S  0S 0pSt   0  -LMp0P$K`0 R 0 00 0 R $00 $0 OH 0 R $00 $0( OH@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST0P $  L 0S 00[D080T 00h/4[8$0Hl0 00 $00H $0H0@0  0 KK`` -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0@   0Sp00R (AP R 0Sd0X0 x3 R 0SD0D0d0X00H00D Q  0 R00#d#X R q T0@ } 0Pt0s4  00K R000080Sp mSf 40p0PT4,0S:00 S*(qI T0@ C  0S00p  P @P \0  0P(q00000(s00 000Pq T0@   0Bu r) 00sT0@  S0s|0sgr 0Sd0X0?D 8#8S: 0Sd0X0#8#888d0X0  0S  d0X000d0X0+@` -@P 0` R00p  LQp %@P,Q 80S  % 0 R00t?P   0!:0 000000<  0  "x O -L M`q@p  w 0 Sp00R ?PP   0St 0, ,0  0, S 0pShZR0 PP  00   0 R00tpp 0 R00p@@PP00 0PP( PPPa,0SZ000Z 0S 0;0, R 0S 0;00 0 0 R0, 0, t   0 R00pwP J00 o og 0Sp00Tc 0St00We ?P^W 0StppK 0Sp@@Artu4E p-LM080S 0 R00 d X R  0 R00 d X R `T p 0  0u` 't ' -$"LEM0`,0 8 Rpy T T0RpW  6PcP1 RW 0Sd X 10S W  MT1 ,0S H,1\000000000 0P 0 0C000C0000Wmv t'w o'MOK ? 0UP `u4t` -DLMM`0 P,0  0H1 HQ9 H1L 0RD0R TpDH!0S< L 0S L10   R 0S 0R H!  0SH1  p00S@( HPL5YD!000@!8|PD0 0C0 RD  00C0D!000080: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u %KPpP1P 0S 0 0  p   0 R  0S00t000 Pp  Pp i 0 P 2 ,0S ,bX0000@P1800 00000000 0PpdT0D 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000rT1H ] 0Pp3T~PpMOK 2TP 0GpW y M# P10%io0 0C000C00000000P;TJ  0S00t00t07`t`$v455 -LMPp@` Vv |0S 00S Bu " iP 0 R00D!d1 1@R#P P; jT!0bR0S- PP0S$ P ]PP?>1!E , B 0H 0C0,[$0"Q ,呺 -L M P,劂@BP00  0ƕ&0,K偹P^,0TH(` (`/T>1 1@R#@  d> aq PP/ 0lA0 P@ug.f.!1D0,0C000*  R0C 0,& 101,(0J"p `PP;  $Fg ,n4v4v4w4 -L M @`P`$S U0: 'g , &$KP$0$`HpS?> 1@PR#  0,0 00D 00$兹$Ź; fe$w4n4n4o4 -L M @PA \00\0SC(xS,6倢0 Ɣ&0,K壸0S-,0(H`USQp Q ;  ' 0,&0 00 00 Q,& 10C1X0,+f< R,c; He FeK0\ 45Pd l1ğS t@t Pl1 xU:h!1!@P6@dDFA 02 Sp;1b1 R0``00`p60@h!P0S:`!0S:PP R d1Spt0a0 d1 ,0S ,G0 ! 0!$t  o l 0t!p! i e `^ @TO Tt  TJl  TG T TT  T@L  T=T< T84 T5`P5`L"`P"`84` x45`06`6`7`7`7``8` -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `h@h0@ PP<0 X@ \ h x  4T0@  00CS4` OPPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 PA0S-p@L@ pP t t0 BOK|  @K dI 0 `@X0 S0;04p S06x Rc 04d PP!0|@Px0lx00S, 400 KT0PP 0   d@Q 0Q 00 R ~X`\ 4Xp 060044@00@0` ,}8\RD<pD D0H<  SG00< 8 0b@0 ?4 /P#  |t0 0c p ?@_UT pL ,K/0 PP50x4t4 0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@[ZDx4dx4xx4x4x4x4y4 -LSMh! #hA0  ,0 6(@Kp1 34  L0S㈀ `0 0#60C S@9*<*8<*<*8<* <*8<*(<*8<*0<*8<*@<* A?(K h1KK  IhAx 0R 00l1 Lp@pLEh_SK 00LKGTK@l`X WKT lUK MOK \A @a 8 D Pa K?P@`Qx0 0R@`pd0S0@ 0Pp@d ` p[Ix0V`0MKS >K>Kp @Pl!JId00P0@0|0S l|0`P/VUh1 0e@ J H F D B @ > A?(K <`,y4Dy4Ty4 -L M@0Kx RK/P 0000Kb0K/P(000000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C S=*>*,>* >*,>*>*,>*>*,>*$>*,>*4>*00$0000000000 0  -L00 H@LCK @0!! '0807!( 0S10 ,0K4nPP! @00@0 d0S0 0S00505 0d ,T0@ 000,8 ,-80PP \ba`aw4aa`baXba`a`` p-LM`0\0 \@@TP (0&\Fp0  KP @p00 R Qd 0R 0F0pp 0000 d00- -LMpP0+p@N`+H?U dp -L MP, 6Z p&ƕ R0`00&&,@0H?,0S 8 6pV0Z0X00S 骣 -0#LRL R0SR T0 S5S LSQ`0 Qd0 S@z4dz4- 05 p-LMPt0!` 0 wP@ 000Hq0(-08@W@p50   0 0S  -LM      % -L Mp0P(K`,0H 00 (00H (0H0@0 H!0 0000@ 0:#:0 10 00 (0H00 ,( 0 40 0 <8 0  D  0100D0 d0@080S; ST0P $  L0T@$K48 8$0`` -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s" T0@  0R SPM 000 0D0 100 0 0000D Q 0 0  qk T0@ T 0P"0sX 80SS PSI 0p~P(q; T0@ 5 0R P \0 0P (q T0@  00000(s00 000Pq T0@  000sT0@  S0s0s -@P0 LRp` P$ R 80S   P    0:0000   <0 0   RO -Pq@p@`0  v`SL tP  QR0`00R@ 0S 0;0Q 0S 0;0TV 1P -@L80SpP` 0 00   U 64N DPp0! B! -P p80LS`P T T0RGV  |P:@1!R/ 00' !000 0P 0! B!HV   P ;61-(t` -L\MP@H D `T T0RpX \ `   H0T ᢵHP ᷵D嵵镵᯵ \ T0R0 0"0   P X PD L 0T0 8!R 00T0 0 0d0  X 0: S yH0 T P S0LP0 0L! !L L0 0$Ph 0 DWhX DT` 0\Q ` R  R XEP RH% TLPA0 H HK ±P6H0P ST  0P0 P R P T0RL0R LP0L 0R T 0  . 0 R* T0R& P0S! P0SߴT@ܴYL000X D@P L 0! B!L0DƴDߴP0 0: S YTL P` R00 S T0! B!T ᠴP0Y 10C1 P@ 10C10 P 0P 000H僴00 0 0y DK  %DPY叴 pL@P 0PT0 YTQ aP RD]`Q00 S hPP 0! B!P0P@000T 1@@K0C1T0    0 0 D 0P.0[S L d#"[X3R`  04  0 D 0 T P P P0!RBY 4T0L 0R` R00 S T0P2!R !T000P0 PL P? ` R00 S T@0! B! 0DX L0 H0P0X00S*X"0S TL Q 0 0 0 X D(TL 0\ 00 .RdDX  0X  80S `H^ yDw00 0 0P 0DK 0 D z4u4u4z4z4z4..{4 -L@PAU0$   A0 0$bp 60S b0 .0S0 b &P0 b bs?0dba$  ?#>C@0dafac^ -0qLM|0x 0PbU|07 1  P`5 䠟 R0@0&  P `0S00@@ .x 0 0Q0x h p0Q0p  b@&ECda55`c^ fa }4L}4 |00`|0da-8p0P0 0Cp  0   fada 0-@LTP 00ST 0S 00 0C 00TTp  0pP0002 020W1@ fada -LM 0@S@0 S p00Cp0daP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TPc^ p-LMP P` P p@ W@ `202 &, -(0AL0$1@TPop 0S @TP \=0@S000@`p@ -0S0ca p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000 = CB0ca\}4x}4 -LM @R)(0 Z$$ aV p@P0S@PUZ0`=V$ Zc|o=?p00Cp0@T  @0T~n@@ p`#0 @ L 0T0Q00S ,0V 08W@355_]- ^  0>0>0 S   -L MRPLA`  |*00΄S %!D & 0o0 0654 p-LM@ LQ|,00`0,0**+0L1p50 00@- @58 0  0 @2(  0P 6Oda p-LM@ ,0$ ph, L0*06PU 10`S ,0P04,0$ 000p65da4 0-LM@P Q 10S Q\ 0Sl( 0P P,0 0 1C0S;`da2(444` -0P@LT`p , 00S @TV 0 R@W m!@U1S10S SL0 Q* Qp `0SP;`"da$5 0-@L ?,0P  10S,  000D 000L,0* 00hL 0hda5 -|0LM\ d \0+ KK1/%v"!G X5da faia@4 -L$M8 04 S8p0CP~:wp 0`ZC%Z0>0>0S1#  ~0Z@ p<0  40,K@ ( P<   X00 P00S 0 X3ZP<@e, T @!8 3 < P d0p` @000 `0  P0000,h 00K L00  0P<\ 5 5܄3" -1LM ,0 0`Dp,@p娐PLA P 0R,p^,K 0  n TP@ 09 P00(4fafa fad^(d^dc^daa'5\4 -LM>\0ǠȠŇ@`P'0 ` p P` P000U 0 0 00 09P(<4 PP ꌀ4Ā44 -0ap #6RL`QP: P@ 2% " ZU:aQ"@T  P PU@  0S:P 0S*2 "!6:*" -0a #6RLP Q@: TPJ" T: R p$`QV  @P 0S:Q 0S*! -LM.0 L (0K^ #̌P@# 0p` @@GPD ,1, UL0`pc!  0 x @T  ~0 04 AjzZEUd,4aH0 h p0S '&,0 0854ada 0.  0* -LM0@`p P000 ` 0 KP0000 . . (0KPP 0  (Pq *܄3" -L$M>L0℡~(K0p!p@0 `P `@@PJ<1, WL04 c P` U0P@  4 `W000S,,4P `@0 @@@@Th40 44 4 zGqk%2 fa'5(444@4 p-LM΁TL0K! 0@`P `@%Pp fa' -LMPNPA@Tp`Lp,K, X0   \$ 0,9L fa'd40 -L`@P T@@0p*v@  p-LM@P `*ph  -`L0S0 !,B$R0 00@T \p\P 0@0 T0,  S(<@0hfa8]5fafa*0 S4*p4 -LM✠圐圀 0RP UP`@pU```  0@00X  0 0fafa5fa|4 -LMPC x`xp@0Th `U @2 D 0S0 0C 0fafa4fa -LM@   0@00h fafa -LM@p@ X`P0S@ 00   0@5` p-`@LM,P00LP (@DH@@P@T 0@ @@@p ( 00S0` ph ꄁ4fa -L M@`p0 P000 `0t P000 ,0K 0  ,PM܄3"000 - 0 BRL` LP 0 @P` @dDFA 02b SpD 0 S0``00`hE L"`P"`84` -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P ,0RP $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0Z0,PS 0h0 p-LMP@(`,0QV php p-LM00PU* ;`Px@T T10T1x-0T0pP  X0,P0 0tt? @P `.X0 P Lh'@TP8b'0@$_-] fada_545faha4 -LM@T0<<hx(((x  T1x@0CT1hhafa fada -<P0000  0,  0Pp D0V $00S000 x G$0\q T  ,0R 0, 0R\$0002,0@ ,00P$ (00404( 4(040 0404R880P<0<@@DPPL H   ,HPL000 p @0@0Q00 ,\00 S  .0 "600S 0  $ 0R@%,0W (00S^ ,0 b@K0 P0KPv Qt40q804 Sm<08Si@0<SeP0@SaD0S^L0S 0SX,PP 0  _!00S000 000S$$0,0$0=0P00Q00 S,0  .  0"600  . y0 L aP0, R*0   pPX PP 0P00 ܄3"5fa\iapiafa0@- 1@P, \  ^:\ $0S 00000S( \ 0^5:$0 ^%:\ 00\ $0S\0000 0^:|haia -LM @T`pP 0D @QP Q0#03QP U ,0U 0S: -LM 0@劯B@N@N@ -L4ML0 40 0@\@K@ P*0 P0\h\ , KYP, V,$0 D V* 0P  Q0#03QP D0 ,0R 0S:D4 Z  @PK0@400  D`@pK00K aP(Q, 0S:0$ R:X $0R *0S!* R 0S!$0 S: 0S* R 0S!, %*Q $ 00\*\0 5@pK00K #PR,0 R/*X $@pK0 00K P0D 0S*, , R 0S, %*0S05,0 5:$@pK0 00K PP`Z0J0 0  @ F 0 Q,0] Q[:D RQ 0SD 5$50 5:J,D 0F ,0RD $0 ( -L MLP`p V `1Wp!V`!, K00 PcP,0@ 0, R0%0%0 0 T0,0 N 0SK*$Wh: Yl` (0S .0 "6C0 D0SN40F (00 RAs2 $ t6p1 $ L0( cc40 040( 0S0000C0  00, 0h V0 ,@ @ 0S:5,00 0 0 $ L0( cc$ 0 $ D0  $,@ 0V0S00u a5 P0-L@P L0P40 ( 00S0@"T0($ BH"&Q -LMpL`\8`5@P0 0 P  -LMP$ Kp`@{P* $ 0S $0S(0SLQW# 0 S p0P 0$d$0U @p 000C0$:@PTU0 S 0000C00$ 0$9 -L R0ԑ00đ\0 0R010201<0 0R*000000;`da$5NN -L$M0 0 4 S@P` 0QT, K⨜P`>,0 $@0\A 0 S:2\7*Z`!>20K0  0 @P 00 >2Q2^:40`, R ,00C,0,(0,Z ``0K ~0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0D P@  H @ H0 KP 0@0 8 0,@PL@  1 0<S-*$<0Q*0 S` 0S]$04 <S1& (0 $Q!0V)0K*)K jiVp:00L00 S  0<S: H4D @L V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )Kjp/V:0 , 000c P ) K @  -LM 0  S 0` p @ 40S0@0S0 (PU`p >0~pW  0h:#:S P:SQ:Q:J q   `PS7 5  0 &P 0SR  R ,0( 0C,0  ,  0 @`` 0K P000 P q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  0ٞPH  10S     0@ |0 3P80 J,0( 0C,0 : O,/ VʦU^  R  1 0R-*  (  -LM`P@1/ 0S, *"*@S>0NPb@` *T p  006  , KP,0$ @D P Z  -L Mp0*"*0>0>0SpbFZ@ W>: W< @0` P000 `0 P0000 0P ,0KG0  ,P0  ܄3" -LM ! ^>0.@  aR0@  P@ P @@ -LM*"*>0b^@0  NP@ P@ -L0 *"*0>0>0S b^ h>+h>+h>+>+>+>+>+ 0   0R  0 -LM*"*>0b * 0H ,6S# `p0d,$#&@PQ : 0`\:P  da -LM!>0 a 0* P   -0LS   0 ` P P # -L  -L,M00 R0, P8 < 0@00 0S ,0>0>000  #20#0 Y030"<Sʠ < p`4 080 $&0,< 0, 40 P@X0Q9 `p0 @000x"`0d DP000@- 42 H)&R R ,46 S  @ ,  0,0 0P@, 4Q 0 80S  @ MT4  0  C4 R Tnl 80S  |0@ 0 P4  8 0  T|0 0 4 , :#:S <0s%܄3"da  -p| '6Jh0@@``LA@HVT 0 S @T 0S0S fa2S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0da@faHfaPfa2-0C22HSD000   202  B @fada -LM2@ P0 00  202  B 2 0h0h0   @@2402   寻" @002da@faHfaPfa2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0Hfada@faPfa202 202a0@-04 "QP h@?!l!0 ^:0A^P 01:?01c10@45ia -LM , 0 "X00 ZY"0@0ŸT0d0l h`x ^ `Y0  a0<"6AB4  8 0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c84 fa@fa45 _(4iaB}_da_pfa85T44 -PL R: 00B 0 0 P gda4 -LM,a> 0R^PA0 pW 0gS*N@`0S:>0 N@ T *$PK0S J $7T:堻|WPh5*DD@D0>0>0 0<5__4faa44 -LMℒ0SP&J1l `!db@0SP> 0p`S@`0A8 PNLZ0S J1` @ 0R:P@DLZ60 0 R    R  B1PP @P0UT 0R( 0R0S*0B60 0 B0CR0  R  B0PP @P0U 0R*60 0 0R0  R  B@0PP @P0U45ia fa@4l4 0-LP@KP@ T0 -LM,  \00 4 W 40SbX%Q*!p WN `Vx!0S`VT!0VZ: R`4A (A0!X:`V!0P0fUq څ1eAD PEU @, Z 00  00O0 0040t 00Z00 oXT, @P 0<0$4o!(da4445iaia؇44L444 -2L M0Z ! 0CZ pWpWa1d1>0> 00 `PP00 T Z !0Z020G Z, `Ph0dp3qPU,  Q 0 0 00   #&h:` !0 0h `01 P#&:h` P!UDF Z,<0X ,00 oo45ia fa5 _4 - LM |0\ , 0` @,pP 000 pb8 00\,Y(W$0$doR454ia44X4d4 fap4 -LM,0 `@x@S <00 R4 @0R D0RZ 00S, 0 Q00S(0QP 22L Q 2 Q 0F`8` p8pT TL 08!`Vk R0000 0   B 2 $00C$08 R 2 00  004 04 00 ,0"S 0",I 0"`2 8 R 240Q2Z% (& :h `P00P%,   IF 0`,0 0 0` " "000,1`VT@qL0!`V0aV|Q_dahfax` faw`4 -LMp\`P-X* " 0`P "%&:h `P00P%FF``  0p ` 0p " "000 #&:h `00$~ R 0 0 00 0  s R 000 0 0 " "00C0"0 0" fa -2L P0` V0 2Dr# :h ` $D R 0 0 00 0  9 R 000 0 0V " "00C0"0 0" 2a |aR 0p10  0 " "00C02 0: R $12 000 202  B 2S02 00C 02<20@0000P0P20$ 0R0l0 D h R @0V p 2p 0 2 fada@faHfa85Pfa -`LMVp At00TPPU `V2  "  0S 0$"*2 -XaXqL^0$ R0D0 2@ TPR1D@hK R0000 0   B =iP 2<230 0S0@@@ 0$ 0 0$ #\0 R 00S0@@@P 0 00 da fae` p-L M K0 "Q `KP @/1l1 0^:0A^P :?0s8 c! 01pV0b0 0a45ia p-L MP`@ 5@@@t0l l0@@X0X ET`@@1@0STpfa50ma(ma4ma(_,_@5 -L$Mp0 0 4 00 P4,P Ǡ,K 0 PP\`0 젟 @L T 0  @@\x0  , X,@ 0P4D 04 4 00P墮jVJ03,0ma4(_,_x` fa4(ma4ma -D!L M0PC (@0`p P000 `0 P0000 ,0K@@M 0S 0  | ,P`@u,0@@o,@ (_0ma܄3"4maa,_ -L U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA } V l 0!6 VP0 U00R0S  0 0t  0 0 -`0@LTpPP P W* 2$"  2 02㽲1;0@T0 $C02 ˲绲!2022  0 p   0!6 000 X0 0,A0 0 0k+fa -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TyX 00 \P Р){2@ Z00S VF!2022@02H@Tr`$P,m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+m+ -LM``@`0L pQPP H#P 00 hT0 Q fax`4da5pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0daVUUU -0LM @`PL { `Pp@ 0Gp101\ 0V`0 p @ ?CSD00D SD0\ ,0,R0Sx` fada4VUUUda -䐟LMp ;0`S' PS000U 008 0B6C0@%`XTP,0XH`8z(,J `0fadadahfa|fa*4 -LM pW     ? W̠ b @0@0S0  S  R P U ' pWK 10 1 @0="0Q/S 00 0C002"$10$1 01001 @pTR 20p00p0İG1 0R1000@ 0S04ʾ0  h p0S 0 l h0R 0020X00 \ P0S P0KU q 0 0 PPP Xd| Wx \0KQ0  @h(41X0P41 0P@ ` K0K0PXPP@P > Wp  402"  Q  E  Rg 2d0 `0K$ T  TIF6202g08! W8!  2  0ao h0K @0 0@0!6 Ck K P 202 @@ TK K 0 !6lD 0 P  ' 0!6[,0P P:@ @@ 2(10(1+,10,1#da -8RL101^@^@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  WM<1pG0<1 0!6 P 2J02 J `2"02p T00R00 S n8,P101qzdaPfa@faHfa - Y3 LM>A0 0 +QQ:34 (0  0aS < 8 00`VԢ'PQ B/ 1b10 ^:0A^P:?Pu &Q` TB?!l!0 ^:0A^` 01:?0S p,1c(f1P12" Q4 0*R0#  R <P, P\ , 4pABPG2#40,!0Q!0000 00C0" $00C$0" rppp" 000 PP,00S ,0 8 l0 < RP@0RD 0S@48,KP0lP,0 eda45ia fahfa -LMp@T' P`Q0000 0002000@0$ 0R@0$0 D @Ti fada85 -@0LM@T 0( T  i @L54 p-DB MLP8  $ `  0`\TP`PXL `0`0<Ta 0`|t`` 0`<( a`($a! 1`<0!,148!t0dx |0hxph0L!`pda44D4444$4T444؋44X4444$4L444 faЍ4 0-L@M 0@d@@Z P0 S@0oP!\0PPPk@Tx 0@ d PEX Tx0 P=0h?86da4_4na`fa]4$40_8ma,444(na<4 -LMx`Vp 0W- `V0pQ`00 0S 0  00 00 `0D4p H$ Q0Dd00d00S 0  00`V 0S0 @P@dDFA 02 ST1b1 R000 h\%4_daL"`P"`84`@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd04_da -X0LM\  0R \ @ TT000@4_ p-d0ML` @P0 K@ @P0,d(4p]0_`4-X0^ P ($\,40\DP ^4_ -EMLPM0|$ ,0  p[0S S rP@,P `V FK@0D @P4 L$ p t H iP@dd00C@S񟗖+H+؈+؈++؈++80S|0# @Vo 3 ,0S |,p(PP@ @ \@ P\#\00@d80S|00 0080S+  x\ BK@$@0)PP@ 80S \\ <0 PP@ 0 K@\ pYPP@  OTx @tB~KpGpGG>K0C+P@D hT1` /nP@_0SGBKAG>KA0C+P; 1` Y( PU! WpG 4 O#J6; 0,P@An2$$P`@*DTU WpG Y|@<0@d |4 `naO^p4|4`8444_da -L|Mܒ@0XpP 0 0IP@80S S @0X 0 0H%$ P2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !90P C@\0PP@ 0R50X @00@0k 0D!000dh00h0 !T0H0 $4>0CFT0 0RP`dm0 BP 0K 0P@qp KT$;H PP@cT0 PP$Lv`4]P54dat`4444D4 p-LM0@( +($00PP(0; (P` 0 00p@80S$ m0@ P0  u3t$h00bh0@EP kL0(,$0)0]\Wp^@ `da0_X4 -L M @ 6@鰺"x+ -L M@ 0@鰺"x+ -LMT0O$K4#&:P_Pp ($@ĐPb0O&#J86$[\d \E@@sTP=i0 0+400 2@~[i+ x4 -L$M8 @< `8x@ @ 00  <_8 億 <0$SH H@0夛D 8L$@D? 4 4K 00K, K^P00s 8LD  ?40`PD"pe@87`< H00 W p@0000^$ P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@!P$0 0c#& $ a8n  e$0 0e#&B@4A- p0Q:>a?1 &#l!b0QPop*H00p "F!V: U p -Lp0 4 M-LM t KP00K @@ P P *?0@PKp0@@0pKt0S@#&: pKPo`DF᠀#oጐXQᐐ \ t0 R Y PU Q$ x0RPUYtPw @@ l@ 0U0Y00S@`Y  Tp嘀W0; Y% `V$ xpRPP P 0|S: R 0S* "5 0 S Y   0R@`TpKt  2Q;{ 2 02/T44đ4  2 @002"02"10# 02 뺂 `✀ p 倀KhKtl l Kp0KP@ P| p`0V` 0{pWWl0P` TK 2D022 8021   2Q p 0 R 0S T T嵢8  31 2 02ᴢP20t SY` 2ᜀS  t  Qʚ0pSKt8 Y 2ᜀSt P 0R@Kt X"72 `K@: UpWXKt\ t0S @t0#00tP0Pd0St`0 tp=0g0 K @K 0KtP} 0|@Sq:`Rm 0pSi*202eK K Q_0@S[PKtP2K02@:`p\HPD p-LM P 0R 0Rp @8 @0`<P` P0SpБ4 -LM -LM@8 000 p S0`P40 1 s @:Pp` W400S=P,  W 0 040 2! "0,00 1p P`P 1S @:Pp` W0W 0   \0  ,  0!,0 @1\ B,b_\, # \ ,K 0P@,0"@ ", ,01,2202, G,44 -L4M@00# T p` Ẁ"0 @0 0S 0S RT P00SX 0X 0R0t T 0 SX0pP0 0 0S*pe0嬡@@0K`P KH  4 Lp D 0 8p , `PI 0S>0HK 0 z0P@/ U8 W00W00SbP R00Q0#02SXT0 0C0 S UX0 a% ᕁ0HK 0 L <UPP TcX 4x` p-LM0 PU@ p0 S@`@0P0@0 _  & x` -L M0 p` 0S 0S0000P 0-LMP `1@0T0 U* T0S' (@T@T 01 P0S >0@T 0h80  (Q,0,0, 0<0000S @0 0@0000S0@na8_@_0S@-+@,  0 000@45|5 RQ-L 0P0000 P 00S000,4 RQ-L P P 00S00000ST4 -L@M\TK K < 4 <#:0K [0*":("000||4 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000Q뤒4 -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  07P\ 0R,0  0S0sJ 0SI R 0S0S0S P5 02,\ ,48 <#R: /P, 00 P @0  0,\,, P , #< 010く/ax`oa -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#h\ ,,00@ P c 1~;`PX UPE000P:Pp 48<#hX\ d,,00@j Pz~|P p ܻ55Ի5ػ5oa -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K Pk H0, ,pLK%P L0S10L0 (0 S h(H0S<0H0 H,0sS$[ 00S40S80S0 0@@ P0,0S 00S 40S80SQ  l0` x0cl R q+<4< 4l :0 l 31`̒4|] -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S ,E R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  BP@0S X 3S@0S<0S80S40S ,@K (PZ 3 SP0\ 0RP0 L,@K PT P(HKs`ܒ4\3$']3 p-LM`P@ P00P3,@0 p p-LM`P@ P00P3@0 p -LLM☁0\PKp`@K|A$0 ` ~{8KX@TKD@0`KP ?@K[@K@PKP\PKP@3W `\ $0S $+ 0W` 800C80` 80S080`|`\ @V 0S0C 0 0` 0 0@`0 4W0,  $@U`l33444 4 0-@LPP 40 <0%wU800C800 p-0LM@PT` 0 +PPUʜ@TU pP 40 <0% 800C80phEaQ@- 0`SP*0SP:P *0SB  RP *R 0S2 P*0SP: -LMᐈ@ppT, P` `8T VX P8T D8T 88T48 T (8T$8 8T*8T8 T 8T 7T 7T7T*7T 7T7 T Q 0Sl 7TB7T<*7T .|7T" l7T{ p7T d7T uD7T V 0S-,0 S $, d0lY PpZP; K`P ` 84K40[S/ Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P 5cP 0S \00\0dK K>cPpQd5T T5T5` (K`P ` K0[ pS (K@K K  1 0 1\KbPp 0P WY Dc\00CS\0`4T? !T4T L4T8 r 10aR001#0p 10bP001#000|3T 3TV @I1.jVy @=1 qP#0000q4#0000L|g!3R/W2TO 2TZ1Z2T 2T2T |2TW Z p d2  R): p @2  R*0S $ 00SP 5#$0$  R 5R00%"48<#P g1T X1\1^d1Tt1T*81Vd1T T:X10SPW  0\n$1T3e OaWu 0T0 T 0T0T*00T 00F`ku$juPliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i H4T4Ri Ii Qi Si Ti ``i Gi Mi >i€4Ni0WiHPi Oi Ji(Ki -\9LAM`VP0p, P 1  5 -0S S/cH0S U8 Q1 HPTP,蜠K E 0[S -0S h@ 0 SRh8 RU5 H0S |0SH|0[S\ q'0000q'00 00 0@P  =d00d 7@ 0 0Y0  p7 ,0S h,aP0005S Y VP d0 jZK5$#Ġ0Č6xK7K4p0 0K0K0 .Kl 倀KlKt0 P 0FS0 000$1 0dK\K0HKc0KdK@Ɵ.D@KD0HKCKHKG0K;P@  zP 80S0C80Ų@T 80S0C80Œ0 .K00 OP@ 00S 00$10h5 H0K_ P[ 5} DşHKP@7  AP 80S0C80@@T( 80S0C80 .K P 0S0 00$10Pp4 R(6 c(0  `27GOK@H0K1 d0K1 (4(  0  P   .KP 0S0 00$103 R *  (0|i@K@T3(0 H0K0 d0K 0 P  U I2 R (0 Y hK P 000 ` ZP0 82 R 0L Pp 1 R0 1 0  RUS  PP7 P00( 0 )0 X1(  5 p0`00|00 RP 0S  0SP00 0PR X 0 R K0 R 0[S0[0S[Q5#$0$)K%"48<#Q $S`]``433H@`@`|3̓44P44aԔ44 p-LM@ P'Y0 `0S R Q000 Rph P0`00 0(0 `h4 p-LM@P. R0000 0P @`U00 0S S @0S SS000S0@ R \00C\0 0@ 0 t` 0S0C 0 ph a44 0- LQP 0 @R T0h2 d -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx  i KeU00  3  R0TK\0KhP 0@ X< !xK GU0h0  d  P` 0@QP@0pS0S 12XKOK0)v2Xq  SK 0T1 `V OK0 S `VT\ T< PU p ` 0S0C 0 00 R 0PV PpP0ST PU p ` 0S0C 0 00 0@0S00PVPpPAȽ_H4@-|0\ 0S \ Q @ 0 0R 0 0^@0 0Ƚ_ p-LMp`@PT 0S @T 6@0 0P0 S00@@ pȽ_ -p0LM@T 0S @T P P R0600 h:Ƚ_ -LIMp`0,0 m00 P 0SvP,6 㓱P`g 0 0 PU 0SPU6 E100,0 S ,0SU P 0 0 0R 0OK`0`0MK@0K<0A1T (K 000SA  R0600 ű 0S0C 0 S/K 700SP` V P 00 0 ``l41i -LJMp0P 0 0`0CS 0  0S {A R000  R 0CS  NKJK00<0 K 0-K 6T|`|42i -pL@P 6 㹰`V70 0 @T6@ / -LM@P6" P RP0S0S 00S0 0- @LTP 0S@T00S P@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\]H_] -LM0@S S  PP P 0P P P0P Pl3 -LM@P P P 0-P0L@T P0 HP0@T00a-P* 003P: 00 ? >-RALQBp`L PUe 0 S\D@ @\P0 S `344 -L M`0 X, 0 2PU8 O@KT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ04y``aHa]4 -LMw, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP6,0SW y  Pp0] -LM@  @0T0  0 R @T0K R%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* P4y`] 0- LP  ح @ ѭ ʭ@0 -LM@@ B ? h; -LpMpxPK0@X 0 4Ex0 p`K@EuE B0 00   00#0 Q  `@`H@`<4 p-LM P\ 0S \pQ  R X00G\`@\ \Z %P QP ;PTT@ P , P T# T 00#0  p  P00 0  00  0 00   #PT0S S000   P GPT@#]] -LM@pPvPT T oPD P1@T T dP, @T+Pa0S( C0S 0 @ `( PpP@ P`p.(&0 h`0S h(0( @`0S(0( < `0S(   4y`]L4444 444 -LM\`0@KP(x(0  Z5%#000K 2 8K4 KK |0 h qPPK< @0 X0KWK,@ < 0@ JPF@,P 50 000K`a @K@KKKK 1 !0 1\ڴ0[00K [ K  VP (0 S (- VP/P t0 R0 Tu KP ,0 R  f`̅3`4]x4̘4 -L|MPK0`x@(p$0  LKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$80 0\0`3l34]4 -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ M [000[S  A0BS 000S |@KXBK B [PKB*C00l0 0 %"4 4  0 $0 S $Hl`P4 p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S pzX0S 58J0 R (  x0 R ZPYH,KePP`]\444]l3 -L(MĢ0p(0 a%? PU 0` RP U PU `0S4 VPDPK?0Ÿ.D rP @P H  0$( 0 "48<#8f L)H0@\ 1 x 0@0S(008Q8 R*H8pW  048< S  8pW0<0 8 Rt0Sf*0H00 Pp\ HZ(T pp 048<@x 0  @( 0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 |@ D0 0Sp@ R@T 0 00SKZ @@$ ΥPP  $  048<00 <$ 0\0  0@4<2DL   800,0#2P,6  0R0P00S@T  0S@T Q  0cPT  0cP000D ` VD @ 0S0@T 0"R@080 T8P 0S P0S=ӥZ @0`C˥0(0C8#88#$(," @"(  ( 8 0VJ* 80 0 B0 8(YD 00b$0喥00C080! S P 0P U8 #H0@\ 1 0@804 `嫺<ß00妺8 PP 8"Ÿ0D 0b0M"00C0H R 1 0@Ÿ@08 erXŸ00mhj8"00eHb00R R:0`P@ @.PE( )0 0@8 @ D 0SLh>0S( *P'WZ'08 HQ 1 0@80zHP1z0  0ꪲ P E,0K8 P<080  , 0R0% *0<н_̽_xa_l]toa(oah]poaȁaaDj4 -PLUp `2X !@@( 0 oZ P$4D 00b0b 00C0toapoa0 0   00 80<808 8<<80808 < -LMyu0aS00n8PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0SA00= o: 0@<b_(oaapoah]a -造L&0S !`P0080S Hp`80@@80S 00m_(oaa -Lp3(0 0 0]]]]Q0-4 $Q Q(0 `0P@ 0R!,!,!,!,!, 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  עP @0 S00 0]l4 -$L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) *P,0:S @0 40 P0MS1z  80S $00cj 0 uXT 10000 00SV:XJ p4   R9 R/  R' R < 4( <"4)<(#,(` ## 0P `@0P`(` 00S00000S 00S0 0 0 00S1 Rt]/0L0S: 00 B00 0  0h0h$0C0CMcu1P@  0R0% :P 0 SR0Q0P@ 00K P 0 0R0% * V UV (P xoa]4oaoawaDj4 -L$M4 0 4 p0Qg ! 0@00X80 $ 0 S8%@ ` :V :0 0< pPP0X,!!- 0 @0S }ʀS S eS) < R0<  <0P40K 8 80@00 0S00P 1   0 @<0S<),h),),),),0 ;P@ 00S 1 0@0 < 000<0 0 S S0P 1 (  0 @<\ \00<P0P 1  0 @<\ \000 00S 1 0  0 @00S=ʂS000S 1 @0@<PW X&S 00S 1 x  0 @0(0 P N1<0J1 0 Q 900S1 p 8^000S 1  0 @X000S 1 8  0 @<\A(0 0 P@<00 f 1 0@ S_*$<P}P 1'1$ 101<  Z< 1:)011<01$ 8L (  00 0g(0 0@(@0~ Z0  ƟA.L` BP`0@ `0Pi 0< 0 S! ʇSf DS! S000S 1 h  0 @<0S'XP%00 P  s0 <5000S 1 `  0 @< RX0T%0<0 P  @@R0 ;@000S 1 P  0 @<\qX$0 0 P  &F10 !F000S 1 X  0 @<PPXL$0<0 P  <0 <S 0CS40S X X#00 P Z ß `LP`0@ (` < R <@<[P 00(#1100$ 101<0000 0Z 1<p 0g̐  80 S- p32( 8 Y  0:4\ 0 @1P:)010P 0$004 s0 (0P$00 p00g4C< R<\XO000S 1 H  0 @<0SX1T!00 P  DS0 D1 R$!0`P0@0S 1  0@08 / 00P@ ',0K ;P`0  , 0R0%` *P `P@xoa]4waʚ;wao`m`wa]@`H@`wa4waDj4 -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,, 0KPp  0R0% * 0 S0% :X dK<0\ d0Kc K\@Kl  dK0L .PS@@KHK0 H0KGK HK 00 P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 RD f\@K  . 0K0 4Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KPp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0KPp  0R0% *+ 0KPp@  0R0%@ *<V0K0 Pp  00R0% *$0P@ \ `wa4`a]]4Dj4 -L M@0(  $( ,<4<,4"|P@U110SPHDPK0 C0KD K<`K0SG B P, 40" L0P0SS<1 R \0R:1  R' \0R$*W*0P@ PpP 80S0C80ڔ0@T @T (0S `(~\0W00S0%" K`]]](a]@4 -&LDM0PTP ,0 0S80\0 `P dP @p` :Y  HK@h@ t0@K hG0KHKHKRP@0[S U5 ,0S ,,?0[0S 00f@CZ #=,=,C,C,0ST 0S  SZ T @0K5 @ [R R h@K bH0KPd0 Z Z Z 񟗳>,>,pA,|A,<0\0 㠱@PP !!$ 1$010 1ᅱUF 1:)01``\ $0R0 Rn@$f$ R 1 0+10 ,`(`SKA @a0@RSD0SA La0LRS00L S:XA @a0@RS `A@0@ \-P+^H`PP@X Y @*0.S@,0U* T:0 0, S*00S0C00  00 S000C00 00c 0W 0 0 `  q㝯@\$ᕯ$ R 1 0 +10 ,(o`m`p` -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S P0pi0\0jS\ 0jSg P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P kP040 4y` -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K1  -00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 4y``` -|#L4M0Pp,0 Pp 0R0% :Z- HK~0 H0KG K0c HKT0 @T: h0 A@TW2 h 20S'@HKLP0 +PPP |2 ,0S t,@L3@0S  PK 0 2P@ r0:S,0S00S40S80S , QP0S 0S$0S(0S T ?PQ 0"0 # W (!0PX  h 00S!X@P0LHKX P XYPP0P0 piQ@L@0S  PK X0a L0K ; PP7 L 0R0% 0*`a? d4aʚ;Dj4 -$(LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0  K}P` K`KPK K 0K@KshK`KPK   0 b6@T 0  ㋿P0 @T0[Sp RE  ` 0: 0000@S1\6   0:( @@ 401K<1 0%P Q 1 0@Q 1 0C0@\ 񟗗4U,U,U,U,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,pU,V,(V,@V,XV,pV,V,V,V,V,V,0S 1 0@\ 3 ,0S ,00S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K KK0  tP 80S0C80 R01 R\|K:0  0[0S1@  TȠ }0P+^TPK(@L0( k 00@S*PL ( @0 R 4@40(0@`a\]x4]4ț44& -LM@P`p @0 _4 -&LAM0p,0 `@0PK Z - H6 R<6 R 0R0%P r:Uh  KK 0[ST 0[SH 0[S 5 Rş@0 5 ,0S ,Kx X0[0S0S <5 R Kt0 ,EH@K0@K KG0KHKr΢P` 0P 0S 4 R80S0C80Ų)K KKV @K P80S0C80ž0[`S 0[@S KK P00  3 R K KK*NK(H( '(Pz!R0 ! 僑Q Y0 00 S T3 Ra KK@ KKY0PI 0PP !@! 0K@8. !R3삟! s20SPBdPK@Ks`Kol0KxK c0KdK0K0KKK\KK KK FK !0@֢P@KJKK0 0KK: Zr1 R K KK ]0[0S@@RT1 R K KKdR= 1 R mK@ KKx 0 90 R K KKj0[0S5#$0$.K0[0S5#$0$-K0P@ E?K YP p P  0R0%P |*L`T]]]Xa04H44Ȝ44`4]]i,44$4l4waDj4 -&L4M0 P`,0 F6 R VU 40 <0SL0  H@K⚻0 @KG0KHK L]L000 U)Pj 0Sg  Pp`@_P 5"$ " pp!p pXE @hD$$Q 1+ 010 (p,p<81 p0p0c,  80S00 0 b L R,#Y0T 0000R:YP  0 0R 40 0 SP  P p`0@0: 00 @ @@|  x(v0(0@@@@@40 PQ 0P f@ bP L 5(P(` L gY0 0@T0 R4 30 S T  Q@a@ 0DS:?>0R@̺!0 0 g 000 GPU60Sn 0Sd 0SZ 0SP !@( B("("48<##80@@ 0:4( A 40 0@@P L0S 1 0@LQ 1`P 0@L  0@1P@ p1 ,0S |,300S000 00S0 0 000S000 00S0 0 0a kbAg00SR\P 0SM 1 0( LY *⏾`g?XU 0  P ~P00S0P0 `aT]o`m`p`sa4 -LM`@PT :Rp/U U S*` T _ \(`P Q` B`S*`0S`  @/`0T0U00S - 0L P]]_ p-L M@jPP 40`00 @K@-0SL L῟P808 埤Pp鳟p鰟p]4i, - LMR 40 S L00P00 0 AĞ4 - LMR 40 S 0 0 )4 p-L MQPPP 0@S0 `ph-P 0<P`p*p 0 ph`p]xoa -LM@00K p" 0@ 00 "@0P ,` U0@K!!  70K  ?@0@K * p0 -LM`S嘻4R0@!0c48R0!0c4<R0 0c4 DR0 0c4 D@!390Q 00R D RhpZP, @0^PP A0 R ~p0H, 00 S0 L 0C # 0 0 R :Yp@ꫪ`` -LM, 0PR* L0QڂR, 0S*@Dp`@40x @T4<@0 ,0H 4 800 _,``4] -L] -LM P4 @ dB!2b2c621b1c00Sڜ0P*0 R 04P:l0l  "h\ dB!2b2c621b1c1\ 0]`a ]]a 4 -4@LM޷ [0h[ꔬa-5 p-X`LMPT@T 0 S00 00C0FT pa - LM(080 0 4 !  0 S'='=P@ 0S ! 0@4`P0@ 'R`00`S x+0@0S1  0@4 ! 0@@T  R0S 0S$0S *0@0S 1 Q 0S0s R0S 0s Q 0S0S0SJ R0S 0S$0S? 0%  R2 R'  R R  R R R R 5 \ \p ty0S 40ZP L9P@ 80S0C80H00 0  0J吜Q 400S 8 R  04,0 PU 4, (0AS:(Q 0S a(g40Sb Y\ `0S 0S0sN 0S0S 0sE ȟ0@Z 1 @ 0@7@U wgHL0 S4K8K @T480\ ǟ011 X7PP0@0S1 0 $@04 & 6 RY h P4 Ɵ@04  ,04 (00yp&0@,K0K4 K80KP4` 04%,0S"&0@0S 1 8 0@40S 1  0@4 0 0)S0(P 00Ps" 05 R@5P@ <0K( TP4  < 0R0% *'$40@0S1 8 H<0X R@04 1910 l4 R; @ 0D0כ  еP4P@ 0S 1 0@40 P 0S)P3 R ß0@ R p L0@0S 1 80@00S0SP@ T  |P@T400S6xP04 8 40]00S  !48<#,#80 400S 00S !48<#,#8 0 4 00S00S 04 d1P@ ~00S 00S 04 00S 5+(pP4 K!0@WX 1  0@00Sl> @ 0T  # 0@05S1#=#=``aaaa؍a aaT]at]]`a@a]ahaa],4ЍaapaDy`Dj4 -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( PP 0 0R0% *,0K( PP , 0R0% *haDj4 -RL M`p40 @0S SP V g* }pP P`eV@1P@ SN SVZAP 0/0K \00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K"[P"48<4 #8V0Pˆʎpaa -0L0@Sp S S S 0@ 0S 1  0 f @0`P``0a -LMh@, P{l 0 RM 1 0(@3T CT +T'  PP0 p3T0000aa 0V#3T T +T  )0iP@,0 S ,<T 1P@ <T (YPP  00Q  )040S`hDK )0D %Phh@`K =@ [R R Y 0S )00 Phhf?0[0S03K?0[0S )0 PhhM`\4ha -LM$0K@ p3T#0[#0[00aa@XoPP H011 01!  UV#U !0 00l<  80S $00 00lV* 0 X `؟@h1$П$ R 1 0 +10 ,( 0 8#XR 1@@@奪paV PU @8+TP`8$VpWڐҭ0 0@ @@Q ,0S X,啬K;L8S/K`]a\3__a]]]42i p-LMP0 R@!K*` 1l1 KR! 01K![R:xxP 0S\p Q R 0S RQ[]aaa -LJMⰡ 0?R`(0 301b!QQ0+PX l1 PT`1 qWO 01 DAD1 R 8q˚0 $,p4@p0輚 0S00‘(0 S (  505 5S-㛚@Kp0 $K dR/KቚX`ah5p5](a]$4Pa04\31i -LJM q01b`AR( P3*0S0 `0 \Ϭ\ 01l1D LR!ȰH(0 S X(匫LK@<0 $K R/K(]`a@4\32i -L$M` 0  $0#0#(,0#0 0#0#0#0Q@0 U   ⱬ0S$$  PUZ 0 #<#<0ğ@0 ߙ0  @0#0#$0#(,0#0 0#0#0#S0Z,0    rP{ ZX=, L3Z   a0S$$ 5 Z8 ۃP'  @<cdm89Tv@P0P 0h8,d[P|@0S= W> 0S Q0 Rh00 @0`hP`8`d5TA hdP 0'SP|0Sp{}00S S`]p]a``44aaaʚ;]]a]aa4La$a -LM , 0SX, 0/"Ao 1`pV PU t0S 0CSt0 p`V@8㜀TP@0 @008㋀ꌫa_Ь,5a,a -L4MsD$0 L , SP $01g L0R ğ`Pl 0@tD R 01g`t1 R T4 R 1@ $4 ,0S $,Φ( 0P`i 1h  80Sc (`V[ ȃP0pdSP lSP00pFß儓 @RY 0LS  \(00"HQ00S 0L SHK *0 dQH0KG K lQ r02@ P 0PP 70 @@@K@ p00P7 0'S0PpKS$4,0O`@0 P@KP``\@0 dP@K`P``q圑0pSU4\ 21< 02 01g\`0S @0 8#xR\ \\ \ 83 1c 0 \0$`4S@0 P@KP\`` P  P  )P0L@PU l0P@ PL@PU`]aa_Ԡ4]a]a -LMp`m!0P@? 1l  80Sg (@T1 1P<U1M xP 0S*P00S\  \ S:00S S* 0 RS!0 0 0 !0SPP U PP 0l0P 0K@ 4K04` /KPv 0'Sʚ;___ -L,MlrPPK`bPK`@0P`, L `ԓ@-Pp PQ2 0$2  Q ἓWb 1 (0 0!0,P] 1R  80S0$ 0bc  Q  Pp? (00 HKz0 @KH0KGKpL`! bB!112b3b21c12c!b`Ԁ0 0`0 @0 PH K0Pp,0 S |,嫤P 7 0 @7000c0c=ꄧa`o`m`p`ʚ;aa]ܠ4 -L MŸp0@0 04 `cV/VP0P 0R0% P :Ux "2Sr0S000g 3P$Ÿ_0^5Ÿ"p 0@R/*1R, 0<A /V800`S*0S 0 00gPP 0 p1 p1!b100X!0P 0K 4 ,@ 0 00@ 00@;PL 00@@0 0@0  ,0K PP0 s , 0R0%P l* ,Tadata]]a]la\aDj4 -LM\pK 0 P , 0 U p `  QmQaQU<QIl0@S @h0S 0@d0S 0@`0(S 0@0fT0S'0`0(@CT00:Z   P ppp 0 `P 00` R Z0 00`  `0 <00l0S Z! 0 0 l  l00lh0S Z 0< 0 h  h00hdP Z 0+ 0 d0d  dP0S  0S0S0S 0Sy @0 ^i 0U0  0S  R  40 0SJ 80S0C80B0 0R  000   z0SR  R> X0<0 X0 400  1Q<1 1 P0@UF 0S=  R: 565S3 8+0@\ 1 X 0@A A L0KR LK\ ,0 S ,劢LP 80S0C80LPU 0s00tK^\0K x@K@~P t \ ̠t 500   R R  R R  R Rv Rn Rd l RHx0S tt Q5 \,: 04(^ 1 h0@ <t4(<"4\  0b0C0t S 0 d0S   h0S 00  l0S,0 0  ,00 ^㜐@Pp 7 !"$ "0000 0აW 1:)01x7p (@PP V @ 0K} P   0n8#8#00!$ S  n  04<#$ 0 @ 0D8#8#$(,""(  0Pe 0 S  0S00000 ,,<,0 00 0 @\ 1 p  0 @ ^ b0S 1 `0@p00W \0  pXQ4P@ 700 @0 4P@ 7 0(S ` 1  0 V1@01|0K K! P࠳ C1 @01 00S00000S 00S0 0 0 00Sz00Sp\#0410 Qhe00S_ 00SV # 0410  00SG z RA00 @0 1<Q<12   000S0 U 0S Q42  0S U 0s00Qj P 0S 1 P0@\ 1 0@5S!0@^ 1 X 0@3  P 0SP 1 R U 0S~ 5z dP r0SP@ T hP@0S 0S  N0 R X0<0 X0`a4o`m`p`؁aЁaap5`]]aDy`a4φ P0A @00Sa0S 5 h000 Wt `P0@3  X 0@   P  0 L KLK  Ƞ -  -0\K   (0S @  " B B@DNlhd`8#8#$(,""(  P ppp `K ! P  dK !P  hK !P  lK ! P G - RLM`p@ݍ@6PP 011 01!  ǍU' V W `  ៤P㸍@h$ᰍ$ R 1 0 +10 ,(c*a0  [ʚ; 3 -L`P@\ )R1S*P 0\0T00S T T PP0p 0 :RpW 0 :Rppp 0 0pT \ -@0`TLpP) P$`U` 0S{tUX }P P`@{t @{"t@x` -L4MT0pP,0 D5\P W`@8 0FSA,,0,h,\,T R 0\0 0S$0S \,0 S ,0S@T5nt@PK⋠PP` d4 R X4 P 5`S10`0-0T RTKjT 0 Sr3T0[ 0 T RXKWX0SX0[0ǕT 0SP0S0S0S Qd 0SQS0SI 0HKL0 ś0 H0KG K@KLKtL0S <`V 5S0S$ @T 0\  @T\ KP@[ 0S0 000@0QțPT00J00S5#$0$ 00S1`1 Rj1 Pe `|P 0(T% 0S"P0S0S0S Q; 0SP 81 RA,1 P< 0`S @T1 V 0S @T' kPT  R000 B00S1#$0$ J|P  5rPp7 $0P 0 0P`x``]4h5p5Dy` p-LMP`@ U  U U -p0 0V0 0pL0 0 0V00V 0 Q50`] -PLM@  R Q000 R5hr -L$ML0QPp,0  @㠚00 Rp 0S ` Rv Rs0)S     0000cS 0,0 S ,N00CSYH,,,,0,\, RO 0S 0S> ,2 Q6*Q 2 Q/ 0S0S0S 0S HPKF@0 H0KG K@K$kP Q 0%R 00S  100S1#$0$ *R  }00 SY R 0 0R 0" 0%* R  0 10R f R0S 00j < R 0 10R0S0S`,4h5p5 0-0LP@ P4 1 0'S(P)  P P P P  00hru00S00000S 00S0 0 0 00S0ʚ; -LMP 0(SpP @c`V $ 012020  1 V (@ 1:)01000 (0( B0 P @ Pᴝ7o`m`P0 S00!0S00!0<S00!P00! -LM`P 0R@ K:T 0S20 0q Q0%@ :T   MP000 @0 ,0K kP@` , 0R0%@ *#0S00q 0j0 @P0 0(0K FP@` ( 0R0%@ * 妭haaDj4 -LMᤢ 0\(0 ` 6 0p00 S0l B 0@S 0S0S0S 0S 0S  R0s RS 0S S 1P@ (0 S (A0S  R0S 0S$0S R R  0s RS$0S S8PKp 㳜0S  㬜0S 00S !48<#,#8 000S00\0a0 @P0 0 (0a0 @P0 `a@4 p-\0\@LMK` `00P`\ 00@p|_4_<_ p-LMPk @5`#Ġ0Č P 00S o1D #211@,0($phC$(]Q|_ 0-0|%L"4 40`P%@"4 40$0S 0ԗP 00S 0h5]] -LM 0R @`P :U  0S  00S0S9 S1@0S 00S$ P 0S P0S 00S0 0 00SP` V P`$(5#$(,""( 50S 0S0S0Sn 0S 00S^ P 0SP0SP  ā,448!#8?As\5#$0$ `V pp 0P`V 00S0S 0S0S0S  PX (0S S0ᕙ0 (  l0$0(5#$(,""( 0Sd0P@ $0K 'P@P$ $ 0R0%P *凫Q]|_waDj4 -pL0P@S0 @TP  `@VPTV ( R  BR(  U` PV mT `@VT$|_a -LM`8 zP 0у@*PP 012 02$0  1 ḃU 㵃@Pp 011 01!  ៃW @@0( 0 p@ Z  0: `000  gXm  a0 0@80`0``````` O0SN ( :04K 40 Е80HH!p`P0@ Y0 K/K4  1 0@80S ʂS Z00 Y1   0@80SY 1 B/Y1 , 00S ` ` o`m`\3xoa]<_ -LMP 0 0 0 RT@00 DDܑ<00aahّ h遪L]_aa-5L4 0- LP|8m8@=00T0@  0`/0?040: "# ? 0 00uMb|jm! -LMX0@S #S\ t0 \00h0QQT0 Qh骾( 00.R 0\ 0@]x4v p-LM`@(P0V00@ 0`p -PLM \ Q @T0 S *01 0 S00@ 0(㻔圩븡4ء4 p-PLM@PdW 0SS 0SLapP: 0BS(,,d,,, 1S 0S0P U 0S p@0 \ 墩꠩0S |  1S$0SL `@0P`(`Sp 84]4]aD4`40a4 p-LM@Pȁ0U`$L0@ $0 00 ᱐ph鱁 00ې5`` -LM@㥁 0 S  i阁PUq <`Vm H1Q p QgWh 1S(,,,-t-1 Q Q 0 0<   0041 ,1Ba  0 0S 01 00 0S \ 00001 0 x0Baa0 L0 Q000偨 (~ {뼢4]5Mb]]Т444 p-LM P `HD1D!00 01@T Q 1 Q::@T0Q P@| 0 0b S&p 0 0bS00000T0@T 8| `0H  a R@Tph龀@O@-a]5a``aD] p-LMxaPP $0@SQ TP $0@SBT$1 R `0S@2 T  5Q' 0 R0 R@0S S P 0 R 0S \ 0 \p 5R\` 0Sx 0SsꌬaD]ĬaT]d]] -L0M衟0D@K`p(0 ᭒CSd0PUhz@0  '00 ?0#3 0-a54y`H]Mb -L Mp0`S, P@F PC V 40 40T 40 }PqTZ!1  ,  0  0e 0 4@5@Y z5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@D004!410 v!01!1 0 k! P@ H0nPA@ܳP\0S @40cr@0Ur\@P\Nr P@` 80< 0CR80HĤ45Mb]]X0GS S S#S 5SS ʇSS S p-LM@!`\ XP P p3000  00  00p#P00pQ 0 0S XXpPU}( (K ႐p4(4 -SLMpP@` R00Q00S3R`U-  cP$ W W *`X 3d c0X0P00S` U %`   -L Mp, Iy0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4!y0镋0 0D D 001100 %!ꌬa -LM, 4 0 y, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 <x8<6 @ ፻P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  O08#XC D]X4 -LMX0@,0 `p XK@ hK< 0R60帐 0 弐 Đ 0% P@ h:T^ `xK '0S@ u0S.0Sş@0 |,0 S x,qXKd ǟ0S hKD 㾟$50S xK  㴟۱Pر @(0覟X0ST0SP0SL0S&[4R t0S d0S`0S\0[Sx0[S S pG@K XP R010 0S  0S 0S 0Y0R00Sh0[ xKSpphP`z K0P@BY Y0 00 S 4s0S[ xKf Y0@04PXK 6PL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-dŸXK%P"Ġ0 0Č2 XKx KKX0ST0SP0SL0SXK ڞH@K㣉xK@K0 H0KG KcoP@ 40  00 R ToVf 㰰P` 0  p0S 0 R 埞w0[0S5#$0$'Kp0S0P@ 0K PĀ@  0R0%@ *H,`T]]8a|4444ԥ4 4<43|444 4waDj4 -L|MPK 0 , "0S Y0 00@`v@lPp \ !1 01$0  1 vW 00S W U 0S @00 0     0@00 :0` d`K0HK@׈Ԉ0U H0KcKGKd0K\PK  4 R0S R 0(S@@K  0KKҷP @@K (` x0(0     0  Rr Rh ^H 0@#$(,""( :( @@% K0R0 $  K@{Z 1`P 0@ 0@@0 \ 80S0C80H2 ,0S H, ~n P Y@ 0 @@ 0P 011 0 Y @ @ 哌 00S0 0 0 00S1 R P 80S0C80Cnb0 83TG  >PP@@@@KJ5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 au@庖$Yu$ R 1 0 +10 ,(Pp h 0R0% *(埖`d]T]]Ha,4<4t44waDj4 -LpM0@,0 `1PK 6 R 0 0S# 6 RƟ@0 dƟ,0 S `,N ҨPϨ @(0,蝖0[S 6 R K⽨ ㏖0[0S 0R0%` Y:VO @KPE [P= 0 4 TPK8( L;KLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !ED0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF K+Y0 D<0K@ @r90 $(,<4<!4"L T:0S\  \ SP1:PT0@S F2 R  0P•2 R  0㶕 R 0S  R0S\ 0SX SR 0 SB K`b0 K0KKʄ0h [0  /h K0h [2 00h0K1\K 0$(,<41L0S. T000#90 ` S80H@Ks0@K G0KHKx  0L S 0SHKH@KG0[SX=y-0Ɛܐ 0ڑ`04<4]]aP5`H4]L"`P"`84`4y`\3<4 -L|MğPp, @ @S 3  l`K P `T 0@S 00 ίX  巷T3 ,0S D,r0S/00S 0S 0S$0S(`V 80K0K@K0 [0 P ,H0@K@*P 3Sv 1k  80S $00c[ 0 㭷pWR 10000#0Y"(`0#0 81#81#$102$1 1 ! l@  000 !40! ` 0! 0HQ<0 &w "w 0( U8,0h 0,000H  T70O0S: 00 B00 0  0g0g$0C0C ṍP 90S61030S  0S$0S(0S90& #,0 0 h`x`T4\^aO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  + p#0 >$3 -RLM@ H6 -RLM@ ;6 -RLM@ .6 p-L`Pp P 0 RL tu ^0@00OJ00C0^ L u|]_Դ4a -\0L0TS 0S p00R0S )Px`a -LpP`P@U U UPEP PE0R0@hpp004 -LMpQ < 4 8 < P, K00K.PP ,  XO XI;0t1%j 4R6Fcj,8L10 T @!8T d 0@T0X X 00Y4< 8,00 R, H0080 R 0h HX壆0 :n#:RJc` 0 80 00 R 0aapa 4 -0LMPp`:0P:X@PH  P PE 0R08@8iQiU Dp5pa4 -SLM@2~s H00H0( (0 -L0 h._H-] -LP/0-8-@-H-P-X-`-h-p-x-------  $(,04@DH庄84 0- <LM00CP@ SN@-,-,-,-,-,-T-----1? ?0 0 01 K"0 0 ,1  ,x; ,$0 S----0 L  K20C0 10 [UU33L4 -LM\@  t\ u\\Q10` R`` J@`z, 0 V. @   | l,0q6S P Q q0` QJz Q sY QPF @04  @TZ00e/C1"/ 0bl SxJPd ,0TL1D,`a`4d4y4|4(444ȵ44ص4444 -QLM@|xhބ݄hڄ`քPф$@̄H4,ƄD h„ 4$4H4T4|44̶44 p-LM0~n0`pfPPP( 0f0V@0*` %Vx( K,0K JTZ:T(`+ P, 0L00( 0S 0H 5aapa -Lr4 -Lk$400-@P 6 018#811  R R  -0LmP -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS -$-$-$-$-$-$-$-$-$-$-$-$-$-$-X-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$--$--$-(-$-$-$-$-$--$-$-$--|---$-$-$-ȝ-؝--$-$-$-$-$-$-$---8-D-P-d-p-x-$-$----Ȟ-О-ܞ-$-$---$--$-0-8-t- 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P033̹4ع444 4(44DA4h254`M4K5/54@5x3P5p3&5@3P34x4434 O54`44 44$444<4 0-@PL> `Sl h0 $$ à 0 < 0 $00x4P4`3X4d4 -pL`@Pu$ T 4 Z DU pP@TXD4(4Pp4t4|44x4 4 -L0 Z\@`%Z' !00St 0t  rW\PD  e/4X44D4L4<65 -O8@LMpOSP!b$ $00S 0 hdX@@  f鄺4@X44D44x4<65 -@$40$&S !PL$pdxl dVHꔺ4444X4D4<65L4&5塀ꌵ4 )3000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A R- ~bs_notimpl_bs_mmap: args at 0x%08x - ~bs_notimpl_bs_r_1: args at 0x%08x - ~bs_notimpl_bs_r_2: args at 0x%08x - v~bs_notimpl_bs_r_4: args at 0x%08x - i~bs_notimpl_bs_r_8: args at 0x%08x - \~bs_notimpl_bs_w_1: args at 0x%08x - O~bs_notimpl_bs_w_2: args at 0x%08x - B~bs_notimpl_bs_w_4: args at 0x%08x - 5~bs_notimpl_bs_w_8: args at 0x%08x - (~bs_notimpl_bs_rm_1: args at 0x%08x - ~bs_notimpl_bs_rm_2: args at 0x%08x - ~bs_notimpl_bs_rm_4: args at 0x%08x - ~bs_notimpl_bs_rm_8: args at 0x%08x - }bs_notimpl_bs_wm_1: args at 0x%08x - }bs_notimpl_bs_wm_2: args at 0x%08x - }bs_notimpl_bs_wm_4: args at 0x%08x - }bs_notimpl_bs_wm_8: args at 0x%08x - }bs_notimpl_bs_rr_1: args at 0x%08x - }bs_notimpl_bs_rr_2: args at 0x%08x - }bs_notimpl_bs_rr_4: args at 0x%08x - }bs_notimpl_bs_rr_8: args at 0x%08x - }bs_notimpl_bs_wr_1: args at 0x%08x - }bs_notimpl_bs_wr_2: args at 0x%08x - r}bs_notimpl_bs_wr_4: args at 0x%08x - e}bs_notimpl_bs_wr_8: args at 0x%08x - X}bs_notimpl_bs_sm_1: args at 0x%08x - K}bs_notimpl_bs_sm_2: args at 0x%08x - >}bs_notimpl_bs_sm_4: args at 0x%08x - 1}bs_notimpl_bs_sm_8: args at 0x%08x - $}bs_notimpl_bs_sr_1: args at 0x%08x - }bs_notimpl_bs_sr_2: args at 0x%08x -  }bs_notimpl_bs_sr_4: args at 0x%08x - |bs_notimpl_bs_sr_8: args at 0x%08x - |bs_notimpl_bs_c_1: args at 0x%08x - |bs_notimpl_bs_c_2: args at 0x%08x - |bs_notimpl_bs_c_4: args at 0x%08x - |bs_notimpl_bs_c_8: args at 0x%08x -LMpL`@PL ;g8P$1( <0D $00HL!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -L@p`P! R ,0 $10 P\ Q0.0 R,0 >x p 00eᎂf! R ,0 $10 sP\ P1]e`T` 0-0 L@  ,0P   H0 RH 0hqf0,Sdax`]]2-@@Pr?0RW` ----` B`p Bp` B`RE0C`R9`ꜵ-H-T-`-l-x---` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `@-d-X-L-` B`p Bp` B`p RpPP2-B@P00O0RW` -ض---` B`p Bp` B`RE0C`R9`ꔷ-@-L-X-d-p-|--` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `8-\-P-D-` B`p Bp` B`p RpP2-D@P?O0RL` -ĸ-и-ܸ-` B`p Bp` B`R:08`R/`ꀹ-,-8-D-P-\-h-t-` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `----` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480 p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q ` hP0  R R R 0  R R R0Spp]0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ P dK\P8\00S 0L!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<$100g p-LM0 @P0 "!HN 0L`L @000ph OI Hphx`da -L,M \`p V\ H0C 03I Hg$&R   R  R0RႡ0僡0# XL P P KpH00CH0 p 020P0LP 2 HPK A d@ i8!P \$6BS@-L!@0 H@ -LMp`MLP0 S@0 0 M`7@5`$ 0S00a -` LR000 | |0@PeM@dDFA 02b SpD 0 S0``00`hJM 8L"`P"`84` -` LMT ^LL @Q Q\ 0 @_Hx`` (1 R 00a_ - -LM0` 0 !HAHP1UP`!p000PG4 1 UPRL1`t1AT  0P= @Tp4 H` 0`HW ! R ,0 $10 H\ eI0.0 R^! R ,0 $10 H\ JIdHuTp  0G `mx``daa1]H4^p---,--0-. -`,1LM 080@0K(PUK   PU Kp0(  PP  PU K0@ @ P_0P00P0GH 0-tPtL0n@Q011!!PLP@0L!0*4  40L0C0l$rd!rXa0]ha`padataat` 48]45ػ4]_4]]]]da<4T444 -L MQ@@@00C S0-- -H--------<-XŸ 0M<2^ 0S- 0N2 0S0000  00K,O- 0M1 Rڠ! 0 V^4 ^0 S QSR Q P(QSRQPq,PKP  0NP@  J J 0@@NV^ h0{XP 0 PlM@b0j]a$`]@`aaL]$]ap@-P0@S` 0 t ?2c0TP00 R 1b!00`P p]]f8]]Q_ -L@A,@` p3PP 0 [ 0 P0 0   $ ( 000$0(000L4 -L MP S$(`p@, (KH,K @;P,00$`p(0 -L MP$(` pQ-0V80, @ R0@\00T00S\0, $0 0( `0  (K,KU -L$M$(p 4 80 0 R8 P0 UQ0 `! 0@ 8T@!,K040K PU 00`V00S P P00 $0 0( 0 -L6p400$0(000 p-LM@P` D5T 0G0S>Q&-`---0-T T @Xp 0@D@@T@H|1qxot 0@ 0@#@ 0 Q 0Xp 4paaD4\4p44 -LMPpU' `V @ `\  0V PPP  @ @N@@P@ LL@N @@ @paa -0LM0KSp8 <0 00 , ? `00V1* P&Q @Ϡ/ 1b10P:0APPϠ$:?0s1c4 1!00  0j 00V:< 80 R< e40KS0n40 045ia ->0LMnd`p4 <P@L 40 R08 &8 P00U* V 08    0Z UJjF:804 0S80 U@X, K00K`P 0 0L00< 0SH n5paaa4>0 >0 o;5M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p 0 0 0c@0 < 唒W`D h 0x"Y, K00K D, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 Koya  0-LMP 0 .@K PP@ PjcP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHpaa -LM`0VPp R a :VP@bT@!W W `d L 0D@WHpaa 0-`@L\0P 0  ,0R 0 0S0hmlapaDؽ4 -LM`PV r @0S  2S @2S2S lphmdm0JS ----p--p-p-p-0  rm0mm0@hm0 Pcm1`VAA0S 1 R$ 1 ?#+0AB%@Em Z 11@T !m9mt6m h2m81\ ?# $1H1@Q1@!+B%0@ Pmm0 m0 0X Dmu" 0|  5mcmlꌐ3a4444(484D4L4(4aaaaaē3aT4\3|4 444aa4P4l4|444444e`e`0! 01 ,   0! 00 2l 01  x`]]pala$aa`!`C68`@d`03 6 !03! C@-p` PDq!03 `aPc_BCHd$MQ`pp50q0q180K0@<  0 P padax`3`ha5_4444 p-LM( \@SP`8 0 i i (iiii$i4i00S8@< D iHxihChdiH Ti L}iP4X43`444H44444$484L4\4h4t44 -LM \Pp`@  @pL 0p; -LML ^0P0p @`H   \f 0 `p0 L1@  -l!LM000 0.!0 S@C$1HpxL17 X1: `N @0 PP 0A+P Hm P   0z;0.S4  0S00Th  @0 R  0H 0@dax`4ha p-LM@0P`XT" T ogKR0V0P00S 0[0ppTKb0V0P00S 00pKE0V0P00S 1[0ppa4 88#4S S - LM(4P`0Sp @"0pJP`(0S00V00\00S 4@Q0 0CS ~V00\00S(TA0SPJ(4 SJ4...,.,.,.,.,.,.,.,.,.4.@\. 0 PD; 0 :#:cQ! =`*)  @Q`1h#R& /P  =`0S000S pp`V  Q#  c)*Q`00f뤯a4aaa p- 88LM#Đd0`PP 06 ?S R2P%&:FFpx`8]-@-0  80@0@ h0 T@ 8 H0D000H0D0 0,40,4440044a-88P0S P0S00 ,40C,4H0 Q H0D00C0CH0D0440C0C44a0@-8P @+ 0Q P00RP @0 0@0 P0 "  ,4,400C,4 0Q  H D0 0CD0H 0D H0 0CH0D  $4 0C4$$4 0C4$a -@ LM0|@  xh hada0@-x@PQ0000  00 0  0 Q 00  0P0D_- 0S  R0000 0 0  0 B 0S 0S0 <00 0 00  0D_ -!LM!:Q(@T!h' 001PQ ;cp$ KP$0W 000p`0S &21(p,]ccP@ (_a_ -LM0P0b0@T- qP* @0`$0  2 0R ( U$ 0 R 0R0 S0 R!c&1?(00CS0 (0`icP0H0,0 @ R  0Haaa__pa -@LM+0O(0 R 0Hapa -L O -L O8 -LM8@PTp`  0S 0` @TH 0L\R S @Q Q Q \ 0h0hS 4S  0h @T\  ipL -LM8@TP, ` 0U Z 0`@TQP U00P00S V \ @R U Z @Txc ``` *(": 1(Q"( 001 0R  0*"%,`VLpN W 0S6  10#R0 S& 2D0Sp0S `bQ `2 R 0R0S (2H20b@ 0S0S a 1P U P@R `@TU VZ`(*(": 1("(Q 001 0R  !!0L0p 0S"  0Sp0S 0Q 0 R 0R0S d0HP000S 00 0P `apaaaa -LM@ 80 Q@ i @ 00 8 40  `0 :8p#*  !( #8R 001 0R  :#58PQ ,  0`  |"`0 0PPP 0\Sj  H0D 0C H0D 4 R 0` 80S > 0S2  0S'P U ,1P R0S  0S@T00S p1 ,X!HD!@ 0S  P 0S  0S D 0S 0P 4$0C 4$ 0S  0 S  R L0@p4H 0S  Paaapa -P@LM`pg 10S 0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@px`apa -LM8PU` 1L D H 0S 0ppUB X@ Ta !T^  *(":1("(Q 001 R``(40C(4 :#%,40C,40 01p R T, 0 R( 0R%  w0P\U@X8@ 0S 0S| l0,@0S L @, 0S $0Hx`aaaL_pa -LMlQ_0 @000 ( 0 0$,4( C0S0404@4$ _H_ -L,Mph P4 @# P9",KQP 8i/ 1b10 ^:0A^P8:?0sh1c, 1! PP8PPWL   8 8Q 804 : #5 @ QH D H@( >0 S@# # 8@Q h/ 1b10 ^:0A^@:?0s'c!001@XI @0 L 40RP @0 4 PD7X  T  _< 4S44SSD0 SH0H0S S 6!aV@0`0ó @0` &W  @0`00@0<0D 0`H0 00Q00S H 0S H0 10#R0 S 5D< 0PW 5 Y D R8000($ ($D Z` x5W} 5 Ry 0R0u @S TE0Sg<5 YZ  8$0 )2 Q  0SKH 0S? H0 0S4X+ 4S44SSD0 SH0H0S S T4!AT@0`0ó @0` W  @0`00@0 6 300S 3 3H@3H0 p3@\ 0SY L3PS *8YP< H  "W 8< u y_0 PtH 0S6 `4D01 LQ. 2H(L04d"SW \2 YD2 T  !< 4S44SSD0 SH0H0S S 1!QU@0`0ó @0` 1W9  @0`00@0<D  `00R00SH  0S H0 10#R0 S 1D<1Z 0@ 0S 0P c00KS0l00 0+ ac)*(":1("(Q 001 0RX0l00a45iaaa3pahaaaL_44 -L0S7<K1 Q V$ 5 R 0R P0@T:TPP  0 SP 00dX (HW:4L000S < KH P 0S0S 0@(4$0C(4 0Q\ `0 (DKP C/ 1b10 ^:0A^P:?0s#c!D01B@TA  4S44SSD0 SH0H0S S 2!QU@0`0ó @0` V  g@0`00@0Y 0S 0 0S00 \0 ` `XX<0S V 2 R 0R X0z0X0 0S !HPP \@0K !< K‡P XzX P0S$ 0p0 R0S\0S 0S 8 ` R 0S  10  H 0S!0S@ <K1@T 0SP00P0 00 x Hh 00PL aY0l00$ P daaapa45ia3L_ -@ 0L ʠ 1( P^! 0 SP0*"%p\0`00l 10 0T 00S,0H@0apaaa -LM PP/*%:8#*!%( f V `!R#8 001 0R :#U@p*0SZU@:00g0l0 R U:Xh<0H,0@00p0aapa@-0$,@0S!*4*6 ,<1(P 001P : #P 0S ( 8. :(#8 #:T -LMP0 ` 00S@e00 T # 3U8 4` *%:8#*%!( 0#8Z!R 001 0R  R Pt : U#o*@Th f 2$pQ b/ 1b10 ^:0A^p:?0st"c!,01b@X2@ `R{Vp2 @0  @4pS44S@SD0 @SH0H0S S 1!AT@0`0ó @0` YH   `@0`00@08 R(40 040 8 Z U:0Um:8 R 40S 40 0S1,  0S 0 0S  0S 000S 0   T0H},0KS0l,0 0h$0H45iaa3apa A-LQ 5.5.5.5.5.5.5.hY -LM@0@0@ -LM@00@@ -L`M!(PQ&F 0 010 P40 > :#5@ T8 7 \ 3 >0p n#2 Q rϠ/ 1b10P:0APϠR:?0sX"c!,01^ 8\ 0U \ 0V\ 0 @  @ 00 08 1 RA $4  0 2R  1 R H8!00\@T06S0:<,,<0H̯apaP_aa 0-0 L"*("1("(P  \! 0 SP *"%0; L0 @@R4@ 000Hhaaapa@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!(#800Q! 0 S@ 020000ha@-`Pp !:H$$X 00S (| $:1(P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R puP ` `000@0  0@0$0)$PFVaaP_D_$4 -3崓LM00p 00P$0, 0 ppp p0S P U:YZ @:4s4C<,c00#S' 0" "0"0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@U4Ÿ4 0,,PHO0 "R@!TŸP 04T0D@5O 0@-O0!@T0 @O0!@S< hPJT:kLWo`P@) E1? (P 0 01  @`P 1 000R ;P= #W9W 0p(Ā UU_apaa4_įa<_8_@_ada̯a,_ _P_D_L_L45@_8 _`.H_]T4L_\4__<.h4$__.p44_44 p-!:LMP`0S@! 6P@) : # L0S L00 00SP@`p\PHH0H  R : 00 00SfUaapaԯa @4 p-LMS@P` ,:8l#*( #800R 0 SP*  ^0"5060p 6Uah4 -80L0 00 Ơ  Q0 8]aaL_a -d0L \R00#P00*0 $T!0hTa]5]00 R 0  \05055Ta]] -L$MP(P1"01@ +.  0 ;>00 @0+. R 00@0Ha]pa -LM40 >0P, 0 0 S S @ 8 < Z4 # 0 @4Z 3 #6S``V 0088000,^>>)*10S006J00 Z4!H,): R |H PP@ 8#8ZS#0@)`p@V ?>0U.! !Q 0@ST0ȌJ0 0H0 <)1 00! 10S00:00 Jh H\ %ST0T 0 80 H0@ 0<0 t808 0 80 ,0(Sapa,4X4ԯaaaaaa40a -``LM0pS P0  @P@.00 RaP0P0S  \:00Q0Sa0@-l0@P 0S P  T :00U0S000a@-0@ @0L 0  0 000 00 0| |0t t0@l l00?00?X0  a aدaaaЯaaaaܯaDB.a@.aaaȯaaԯaa -0L0Όn`VPp@0?0?0000?%:%6;PK #;J jV!Z:R$] ]4 -LM PP%4*%:8#*!%( v W p!R#8 001 0R  :#U@*`L0HS @000ZU@:< 0S U:hHpaaa 0-80L@T (PT $S0DT0H_a(4 -X2LMP, @ @,8S, 00$ S080 00 8 ,1( R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0C $R01!R.P I P \.].].].|].].].].].].].].].DP  0PP0!?#=?00c?S R@TjڣhR,@Y@ BP@CPmPFP$Ra44404T_h"484<4 -LM(p`1S`>V#1(KPQ @/ 1b10 ^:0A^P%:?0s c!(01B@T H4$4D\=R8@T W 0 *43R@TX0l00T_45ia44 -!LM!:1(P`U!0 001 `R8pJ$JT( 000p帀00 0+; 00 :P 0 R 0Hp@:#:S P@*:#:"*S:(21@(PX0 P 40 P ,_0_aapa _a -1LM@@pPP0 K<PU$: 8 #!( R#8 001 0R0*"%0Q*:P0H `  0@*=P4  faaapa0  ")0 )Р)0 ) ) -LM@p `P 0SPTT0 R0 00b81Q00@ROO^0]8],]4 -LMiB2< r R0S tRP "88 #$0LQH2`d`P 0S@ Pth P0Up7*!A06T&*46!SAQ  x1 :Pp`UJ1 16T:0U00 pW0#02S0ESXe.`e.L!.@ L1:404L1L@H@L!L X>0V800`H`0 0 04- -LM 0@+  h`" -:#:LMS`@PR pK D7  jVJZNa4 -L M00' H ~p@g0>0L ^| P;U@`H@ $@K,0  $ 00<ZUzj\N]a4 p-LM`00l H0N@0d0>0^P 0,0 L 0L0H p6Na]4A- QQQQQQQQ RA- 0@P`pQQQQ R40 ( 40(S"4S]40 ( 40(S"4S] 0] - 1LM @R)% &B? S %0  "!   OOO -a O O|-`L%\00 S 4N0N(N$,`N]544,4[<4X4@ -pLM0`S" @0  2 BlN0PU *   000VU:`2 0SH]x4 -LM`T^@PƄ ?p 0p 0,`e0@@]pa-??!0S0q1!1 R  P 000$0$ P 000d@d -LMJP  -$ ?x,~8ȟ 8+8 R(8* b'8( X K~<800 0 x0NtXt-NlI)à@XXȟXTȟT bPx@ 3`8`N0N a,Ơ 0  HN000 )P@ 9#9S*00 S0)\:00 0C007 000b1,0 PUZ0Q I$IT dL40 C\ g:0 0C007*7Ɵ0 C\V:00C *060 L0b1\0匆u:0 0C06*6L0 L0b1\0_:0 0C0D6*600 L0b1\0I:0 0C05*60 L0b1\03:0 0C05*60l0l10lWMT%dSMH5XOM<şLKM0 C^ :$5L*608M0$A `P PUE `Zd1CP PUE `Z4$ MT 0^|DP`&l@0@N @@e 0@@(L :@ :@ :@ :@,0 9@0C(P `:@PU @Z <3 @0@L "0>0>02 a\2"& Ÿ 8 0L0L^" !01 `2\"LT{LDvL !1eL"2 1!1 ZLWL5! 0 @6KL5#1,A 0@0 hV0C ^:00C0k50 0b10 @84@paat`Ai` `a_p@]l.t]4a4aaxa 8]pa44|a,4a\4daaaaXaa4444ta44a̯a44C5? D4ha]UUUUd44 `ha444`-].]-]4444 P-LP t2R l2 `B00Pb 005@"P@0 SS  QQQ00 Qx APKK0-S SPX 0-S0SQ q00C@CSWz.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.pz.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.z.@0000Sl00d0`0K@@H:K@0 S DSBOt`a4]0]84H4]X4`4h4p4 p- LM0@S p005PP@` 8x[0Sphq5PHP`D j5P4P `]]X4@`4@]D]t] @h4p@0Q 0    -0L 0+R 0  h Zt0<50Sdd  0\SR RHHD0 JJ 00aAi04t`]4]|.40o3_ -L M8@4T 0 @@TBT_a4 -LM@`!0pS/P0U %P.,P0S Ux*CPP >400C0`!8`J000!P4a4 -LM @P7D 00000Sh,갸a -L,MRP,`Kp@ 3%40K,KK P@ P030[4 [2[81[<4U @ /0[0 [.[8-[<4 00t0 y I0 N 4 -LM1(KJP`0p 3,0 @p(@K@ @G0' -L M$PK@p`30:$0K3  3  3  2$  28k$P0 P ` PK' -LM1(KJP`0p d340(K $`KPp@ @0 -L M,`KpH3L0PH@X@0 ,K@+PK(KP P0u' -LMP0`Kp$3!3@0K UP#K0 /K.KP @,PK -L$M@4`Kp2 2`0PT@!$Z4K-K [0 3K2K@ P,@K~0 0 0bS00-0  4$ 00bS -L MZp`Q@P0   RW0 e %00Sa  0P8 04SOW00 0>S  %00S Z00 R  048 00 R 08< 40@Z00 0S  048 00 R  0480H  0B P0ST0 N -L M,`K@P#20p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p1``$U-Kz4K 0 3KP `p,@K -0L@ p50S h*Pu0P" P 0`V U004P< (0;4P00@ @00 0SV h鎝P 0,0h -LM0$ @(X , 0PP& !P&`V 0p0p P`)0 V 00SJp P` 0,0MFT4\4 -LM@pPY`U  5p 0$0  00 `0 000 020X 0 Pu0 @ 0 -LM,0@S$ꤊ........0.00Cs0 0 00, 0S P;p  ,#G0S 4 0-LM0@0S S T@D P0`` P(P0@DS000Sa`$e`4 - pL0`04PS^0@0p0CS0Օ QKꄌ...|.|.4.H...|.|....$0( R0(0Q 0  O0@0@S 0S :S0@00 0S 0CSh0 @ 0)S 00000 @@@@p@ -LM0 S 0 qF44 0-PL 4@ @0!qT p@D\FT4@ 3S05 00hKFmxEF0; 08< 4 0<S8! 41F0S 08< 4FP3PQ <P3P F FFF0 S0@ lEdE\E0,LE0,5X4444_444@4T4l444(4444 -8qLM@P/ 0Uă`9 U 0 p5U <0?R0S0ASp.\.p.p. . 0@0p| EP0c0T  E0D 08    0X_]5 5,5D5P5h5 -@LMMT`pP1 )@T 0 S 1S 0S0t PE0S h5< 0 hEpT 0 Ĕ35555 -LM BB@/ 0S@0 @|a -LM@y R000 qh. 0-LPh,0@T 0U @T\0|a p-LM0`@V@ P7 P0[0X Z ,0S0.T.x.....$0  B0[0$ ph郚 0Y0X 4(30[0MlD0H,XD00 0X 4(Y02 7phD 2 (5L555 p-LM@PO < 0Q^C0S>  R50ˠʌ ʌ00ɌH0 @P`00P  ph0 `$&00  004`;00P8_D``WD`SD555x4 -L #M\P@`p 2\ 2\ *@0S p  02\00  00p2\t -T2\ X2\ 0000000 000@00000@}̠ 0@ @Y1\? 1\뤠 ` 2Q 0S(   0|000 0  0p0#00 00 |6{@ ` 1L@D04p80P0<@m0\~ |0\_yp0\v h0\X0` Qrm0400  00  Q@Q Q Q @Q Q QQ`.3 Q- LpC!5 p-0LMPQ0000 0S000 03$0S0$0PC P4x 3`V 4@40 !`R -3V phbA]!5H] "58"5A1 0-LP1P#@P441S@T )0&4# p-LM P@| 0`\ p| 0`\0` -pLM@`p iLP@0T 0!R@ 0T] -LDM0P,0 @P]|!0PY0XU 0 q0C Q0Q u$0 l pC U$0U 0 ,0S ,<+tp 40!QlP 0l0 P@ T h`K:R,l\lPU@ T0 PP U40 P`]`"5-\0 S S S S SL\ 0 0S S S S S SL\ 0 S" SS 0B_S \00 "#0  0801000  0  L\00 ^ 00 \S00  SS -LM<Ÿ Q, @,A / 0@\0 z u\쑟1 \n ؑX+ P`K PK@K ~  z P@1R  0p A<1 ,0S @,b*Z 7X.`.h.p.x............................꤀ꠀ꜀ꘀꔀꐀꌀꈀꄀꀀ|xt6@p`\d``P5X4"5"5"5"5#5#5#5(#50#5<#5D#5L#5T#5\#5d#5t#5#5h4#5#5#5#5 -LM`4p!P1S ` P@ 0` /2 嘢2  0pP[P0 @Rw R Rr U} 8"0S1 $"0S70 g 0,K# 00S  101101 101,0唑S!1 010: %00/0lS0Ա04 K0ı4@ 0 ,P( U$0 ! 41 R$0S1A0 - 4 K0,0  0 04P44K@X : 0P 4: .0Sv`RtUH]_]@]D]3..<54 -L MPB p0, u`@᠟  0PES u@,0YJ. 0 r*P ?.00 000 f*P3.  ]*0 P 0  00 R0 ,@ -LMK 043 -P@P0pS00Ł` `00` @L0\/a0, 0 000h@x]t](4 -@Lc`$P P00$ ;004P$ 妕$PP0 PUb p@0SP 0@ 0UpP0U Tp\@0SP 00@ 0U0p/].4]]] - 8L8#Č M R00,p \, -P@y 00 Ԡ/P`mPU< 0*X`  Y  Y 0  000PU 0/- -0 000, 100, 10, R ,8Q2 RP`X-. fP` V X` -P`000DP0`0 0` .`-`] - 0!4LM#`p\-P@4 0?/PP* V0 70  V0 700(PUP -/Z--W 0 000   n 0<0B-`] -D@!88#L!-PP<`09 0 <`03 p<`(^+P+V D00S 0 00bP `$--h<`@``MU h,04000;00`] -L,MԀ0SU 0z $@TN $0$0徠g pT(P+D0`0S2 `<@+ P1 46S7 4pK 1(00&((*&<&%4K20K1 K0K/`K-K,PK p0P.<H0  @0   P0S .,>0S7U 7UV 0kX7U P7UHQ #  1IP 0);6U=6U"*6U 6U"P$6UQ Qc00 "  d 0@d,P 0 *_000W,5U 5U 5U㲀{U@ R0`0 p%0HS"5%@Pe@dDFA 02 S\1b1 R0``00`M  0P0S1 0! 0#$0$   BR !4$@P@dDF!A 02 ST1b1 R0``00` R0 0bJ10000 1 0,$,!$#, \@Z`s0ShCP R0`04 K%  0@@@ P01 <4(<"4!<001 0#$0$ 0 S0S0002@2@dP`p2U h2U  B@0D,S? 0\PKP@PZ0[Y [$ R !ԾaP@ 0P@B`@K P 0 P0!  6[#$0$&K 2)U0U 010U 1U 00U0y0Uv 00Uq 0``] Q@c c c c c Q d$5c@c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc cch6`L"`P"`84`ddQ @QQ` -L M,0 0e00 Pf$ ,c$a@Q0p0m S$ d0( 008,!2040 0 P t # d #0T*@KϠ<0  DX@ )<0`0`` &P0 0bP 0 PRY *(0 ("4400$ 0 0,0X o[@ #00 ph6`Ql$54WEV$.|$5 -L,M` 0 ؀!4pKP@ .#%4K@(0K P P@YP# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ pJPP ,0K ) 0K@@@ pP@,0S@@T,4 ,0 , 0^ @O@0 N -LMP`p $P P@ $0K   pPPPPjP $\00S 00  00  h -L$M@`p 0@ PPb 0KN 0@@@@ p8P@0\@@T = 0,0K 0+ K  *K)K4K@@@ pP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 @ 0 z  N -L$M,`KP @p"Y0,K0 (K$pKP @@)@  -L$MP $ 0`L  9Pp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 =@ 0   N -L M0pK@` /"$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP@  -SLM@Pj Qf뜁pQ0`0V !  Pp0 0@T@b@bPU?J! @0L\, 0 @=p0 @P]@dDFA 02 Sʬ1b1 R0``00`E0N^J0D@T;p f`h6`L"`P"`84` -L M0`KP p!G0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp m!@K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `p>!BU0K/[@/K&.K)K4 Π0 -pK*K`(`K -L Mp0@KP` !!CV0K/['Ġ/K)K8'KP 0 *Kp (pK - ML`0 PpPP@0nT `:PP` -LP -L 4pK 00&((*&<&%4K20K1 K0K/`K-K,PK p0P!00 0 00<H0 @ 0   %P@0S |! 10S! 0-DP!88#L\!@T 00 0h0<( 4bQ<00] -L M @ 6@.. -L M@ 0@.. - hh&DLM$ @pP lB t2 UP@t 02U 2U 22U 0W l2S2U >2U6 !p2U t2U l2S  0 00<01U 1U  ?K e/1UE 1U 1U00 "   QL10S 00p2 P  0 SP0U 0p00 |&4400 0 0S0Sh 0S00000]D0U^ 0H0Q]QQ @pd Q@mdedAsd rdAQmqdhdk~gd.Q` -LZ0   S S  S S S  D 40PS@P  0`440 0 S@   048` 04D0 @ 4K 00K @ @0^ 0?0S0S,P K0@p K` KHP<L0XP#HP T@ 4PPK0pK@P0\@$<T`0 dP `@Kp@K40S0 440 Q -L$MPp0@0Sڰ1,Kl  [5,KT0L @` `0S0@00 q-順%5 -LX  0 P0$0B(0P S 0+뀹a|.aX4%5%5 p- LMQ0`00@0  "!\ R0000 0  000  "! 0  "!p逹ada p-LM0@P`S.......@ D0P!!00P ` p@@@+뀹a&5-0!! R R0000 0  0!!  -LM $@ 0@0h^GY.a 0-1L!M@4 0800 0P0< *00S P/Cb1ϠN3l"c11A}S c•ϠN3l"cT!!A0Dv,)8 0h((+a]]0A@8&5Mba\&5,.x&5 -L$M400 ,0  00K(0  $ 0 0 @0@ ,L. p-L$M048@K4 0 ` P0 , (` 0\H D 0@<4Pp0 , (` 4@ P P p*@L.&5@&5 -LM@q,0s ,&5'5 -0LP<`  "!0>0 ,p00 ,P@ ~00 ,T 0 !!g -LMPp`0 1 1\ 6..8.8.\ \ %1C 0 0c30 00C = 2  1\ \ \ %9 K  I*'5 p-T0LMP`00@8 ,T00 8\pa p-0LM@ P0`<0 \00< ,T0000 0<< \pha - 0L 0<,a - 0L 0<,a -(0L 00< \a<` -X0LM@ 00<,0 0S(000 + @a<`0'5__N  0O   ! -- -i0~n0`pfPP( 0f0V@0*` cVx( K,0K JTZ:T& P, 0L00( 0S 0H 5aapaQ050 -L*)p'5 -L$)'5 0Q 0R_@ -0L@Mt@S*l0d@ \@ A!0\@0 0  "!_'5Xa__0Xa -0LM 0p0,0 ?o`sJ0,0S%0QU PP   0 @PU?o0cS`,008 401oXaTa__a\a -LM@X)0DS 00#!40 0$ !!'5XaG-0M  "!!R  80 QPR Q R  101 R R1<1 R\ `p` p0 @0@0 00   P0 400$ P (00 40 ( `p@ P$!R 80 QR \@0@ 0 0!!Ѝ__aTaXa -<@LM8 0 00 0 0 a -LM0,"0S{ 0`  "!r@P0   000 Rn0  "!`00#! 0  @ 0@00 RR0  "!`00#! 0    0 00 R60  "!`00#! 0   000 R0  "!{`00#!  1 L0 0!!]Ta\aa -`@LMP8  0 0#!, pP0@S0<0! 0TQ4 0!  84`\@@s,0 0!!40 R @''5`_f`]'5(5 -LM`4 0!!0Q!0000 0 @P@dDFA 02b Spd0 S0``00`vM 0!!._L"`P"`84`M  0Ѝc0 0aXaTa -LM0@  "!@0!!$ $0 1hTa\aa 0-L0LP 0P0@  "!@0  "!Ta 0-< L0P@!!@0  "!0Ta00 0 00!f\aTaa0 S- L( ( 40  ' 'D(5_d(5 P- L 004,0P 0&l_t(5 P-0L  04\00S &l_(5,0Q0 Rp0 0h_@ p-LM0l00P`B'\!0@0T!;Sy0 U0 @2@2D"4 0@TT0y/ ph$'e0 4 8  < @ D O H L P R }$08@8B80 0 804   #)%&)#Y x &%%w<0`@)5)5t%/ -LM@<P 80 S04080P 0-00@L4 ,0040 \004 ,0P043 \040 \004 ,0048 \004 ,0048 \004 ,004 0 \000 PaAi -LMPh0d8p2/ p P` Lh h•p0p2@ l@  |h•l 1\p 0pYP bh2lp"pb #sP@ dhPPH < 0  )5!*504<*5T)/471X*5 0-LPqP@H8S8S p2 S0h2lpBLHHH p-LMP@| 0U0`0  UD 00C0phu u= -LMh2@ld ,P1h” 0l0d \,Th2ld ,h” 1 l0d \h2ld ,0 h”0l0d \h”ld ,0 *h2ld ,h”d0 l0d \h2ld ,h”,0 0ld \' -LMh2@ld ,h0h” 0l0d \Dh2ld ,h”$0 0ld \' -P1AL@`@ \@@`E0 p\0  B0C5AL8  <\0A 0 8/0C(  0B5 8< \0 $*;#30 \0x0 -PLp @`,0. 1 \JKLM0@ P P@@@Dt :@Dt hu@0 \ ,0; \8 , x0 -LMPD@Xp00`". 1 )  0`0@48@u0PGK L0 X 0 0 00PB0C@0 0`0 0R 0,0  @  0B0  00 00X,P0 p D0D 0SD0@D@ @00@0b 00 # 0c$0, X Q]`a 4*5 -`,0L(0(@dϠ>1 0(P\ p 0S Zn@  D00 $  0/00-.p10,p0p -LM`00p@0".PP0   pi ( PD@U40 0(0K00  ($ 0B]`a]D0, S0D0D D @00H @0pa 0-PH0LS@ S 04G04 HP0 -LMp\J 1PU  ( i@T4`  P$0< 0:000 `@0@] 0-@P LR000 @ H0 BT@  $Q  R8000ht80 8004H00QH  0Q 0Q0 Q 000D0T0QL0Q#!@0<0 <0 0 AW@_W@@W@DW@CWBWEW -@0p`LM @H ^ W@ D0/RQ80 0@p0 < -H0LS40uhR -LMH 00R@4< 0BH 04h.P0 S 0- LRP@ @0S #S0S S S lh0h`XS SD@<S4*5+5 +5+5+5$+54+5(44D+5h4L+5X+5d+5 -0L00x0 S -LM@3yH0 R |04Sh ] -LM@\"hl @0\ -t0LS0 -L M@P` Q L?/P?/?/P?/P?/X?/p?/P?/?/P?/?/` 000h@00 0\p 0  hvhp@T0p h@tpp\T0 0hl\]@+5+5@/(4a0Aa+5,5a@,5 -$"LM0Sh0PUd pp`j|z` z@`l ` ` @` ` k k t yugqQ6 `0h0`0l ,h0@l ,h0lP ,p`hl0P \h@l 0\hl 0\h@l0 \`0h0`0l ,h0@l ,h0lP ,p`] 0- L0S0PU0h0l ,@@ @  @ @ Ih0HIlPT G,@@@ @LL@KK J J @H0] -LMh00 K $ PP@0  "!0 h0 ,h0 @ ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,+ 0+;S{ tthl 0\h@0T l\"246sl hw""h0 ,h0  ,h0  ,h0 C/,h0 0 ,h0 4 ,h0 8 ,h0 .,h0 < ,h0 @ ,h0 D ,h0 O/,h0 T ,h0 \ ,h0 d ,h0| l ,h0x X ,h0t ` ,h0p h ,h0l p ,h0h  ,h0d  ,h0`  ,h0\ ,,l8X p0 T0 P 0L0 ph0,h0H ( ,h0D , ,h0@ 0 ,h0< 4 ,h08 8 ,h04 < ,h0'0  ,`0hx7,  57\h0l4 ,h@0l64 \hl0 0\6h@ 6+R00l \hl 6\h@l$ 8\hl( h6\h@l, 6\hl ,6\h@l$ 8\hl( 9\h@l, 6\h( 5l\0Eh 5\hP 5\h h5\hPC/P5\hl 85\h 0l\ hH 0\hPL 0\hP 0\hP0 \h0 \hP0 \h00 \hP04 \h08 \hP0< \h0@ \hP0D \h0T \hP0\ \h|0d \hPt0X \hp0` \hPl0h \h d00 \hP `00 \h \00 \hPd 00$ \h` 00( \hP\ 00, \h0C/\hP0.\h0O/\hPx0l \hh0p \ hPX00F/\X h`00I/\hH0 \h@D0( \h@0, \h@<00 \h804 \h@408 \h00< \h@ ,0 \P0 T00@ L00P00 0@aAiaa Xa@!D! g/(5a] 0,57 h0 \h@0 \h0 \h@0 \h0 \h@0 \h0 \h@0 \h0 \h@0@ \h0 \l hP`!lx1 !0S P h 0l\0 0 !qQh0$ hl 0\sh0P" ,d2Py  t"xzrz 0- @LP,0@0 \ ,0; \X 0hR 0-.@LP9\0.\@ ; ,0= \0h, -LP`ႀ p.9\.0\.`0\0b/\.,00.\.,00.\.,00.\Bf/,0@@D t f/@0\WpG.9\.0\.`0\@0f/\.,00.\.,00.\.,00.\@f/,0@Dt f/00f/\b/,.,00.\' -LP`₀ p.9\.0\I.`0\0b/\.,00.\.,00.\.,00.\DBf/,0@@D&t f/@0\f/@0\WpG.9\.0\.`0\f/,@0f/\.,00.\.,00.\ 0b/\.,00.\@f/,0@@Dt f/,@@0f/\.,00.\' p-LM@P`0 K@!p p-LM@P`0 @pA-`@0 S pP  0R 18S8Pp  0T0 T  R1 0 TR]$] -82LM @`PP 0  "![Ui UR U; U# 'U 0!!q0S'S  !ZPAl h O40Pq0SڂSL8Al hm( 90p0SS@l hX $ 0p0S S @ lh <0P@0[SL)lh -P,0 $y]a] $]T,5 0 ᜻a R[040R0(0R>ӂ?00 K(5$]ha]aaa(](]8]0-44 dd_-<0$! /  /?  / O Ѓ) O)O`)O`)O`)`)  !6  ! QTA@@PUx!h/P ,  "iВ)iВ)iВ)iВ)iВ)В)H-@-" P ?@-@300LS 0S0@ 0@ 0$@ 0PP@PP ?@-`T 300     -LM,@0D 0  $ -LM?@00,D 0 T -0LP 0-DL@P&0000 4 0h1 0`1l!0h (4\k/ 0-XAPPPTL 0S@T0$0S Uy -L MP00 4X1,i0040 U? VRXaV(1 RAV' @Vp 0 P$0(0T0X0@TXAT 8`,KΠK 0$@ K(` $@PpTWd ?P@ dz0  `0```0 @Xa \XaN ]Rn/Tn/,5 p-LMXA`TP 0S@Tp$0S 0S $0 $00m,5 -LMXAT 0S@T$0S 0- 0L@t P0T 00P -LM0Q p8P9 @1@S  0!\1TX@P+!T01S(F!$a0S 0S T:Q 0S  QT#0 W 1@S  0!X0T@L 1T 01S D 8 4\`4ع4-5X4,5,5H4P5,5,54X!R0S`0(0S0S -`0L(j -5 -LM(0@S d10Sd1 `0\V `Xp\ `0 D 0`R:@P0Qt\,P400 PZ 0D40H0 P0P `E(0X P?@ 0S T0S  (0     0X1S 0S`00`0=L  M  N O P0  C 040  d10CSd1  040 000, H0n\, 0@PD0H 040 ,_ 4-5 0-(0LS@: `0- 0 `0# 0`0XPP `0 0D  bQ:@00\P4H00 ,400 d10CSd1 0 040 0Pt 4-5 p-L M @0@P4@P p 0X1S0 0S-  0PP0C P0L L QL5 1SP0  =M  9N 5O 1P0  C+ $p -L M `XPQpK 0SH  T0S Q\ \0^࠱ RQ3 V+ `400$ @TXp\`400  ` 0`AT   |TXp\`v40 0 @x/ -L M pX!RD 0SA `@V T0S T\ \0X@`VT \0SE P`400$ @040 P `X`T`i.-`400$j u 0T@X@`A400$x/ - 0L40 ( 0-XAPTL T0S 0@T0= XTU00P00 SP, 7 -LpM`K@p p08GF/V_ 8 PX( $ p$ 000,/ -LM 4`0p " @ KP @KL K~?K";P< @0D "H0 0 P0 P " L0P R0X0 TH0D$PL0X L PE PK "D$X0NT S񟗶|/d~/d~/d~/d~/d~/d~/d~/d~/d~/~/{/{/d~/T/T\L 0PK 0D^PP$PK 0@D$PK 0 D@ D$PK 0 D H$LT T\&L#11@QPK 0D$1T0\$ T B  R{K(B (L0H0P0D$ 2P.K(PK 00D$(L0H0P0@D$("L0P00H0 D@ D$L0(P00H H0D H$L A("$ P  (" XK2PLTQ  @KT\APK 0D$PK 0@D$@DPl dy0l 00 l00l @l000l @h0l$!l0h 0$1l@ 0$0S 0$d?PQp〠@@ 0UT \ PV d\ 0X0l TXl0PdZ 000$ 00 `p4 80 < @  R, :0Q4 R 0S` 000$0 00000@0p 00 00 80S! 0S< 000$0=0@00@0p00 0<00 23j<Q  0S QB < @R 000$00S80phG/000`02 H0 0!L0 D hG/00080Q, D <0d h0 DQD<: h QP  D0S DQ  00$*00@$*00 @ D$*00H $D P0p<0ShG/000H RH @ : @0RT0 4 HQ H R  00$*00@$*00 @ D$*00H $H0TpL0SL0D0: dSX L R L0Sn  00$*00@$*00 @ D$*00H $LX p,80h Qd0 0, h d0 +@Q 0S 000$0 <0<00p;00;00T0 000$p 00$ 00@$*00@D $D  00$ 00@$@D 00$w 00$ 00@$*00@D $D  00$ 00@$@D 00$ 00$ 00@$*00@D $D  00$ 00@$@Do 00$d]05 8  00$ 00@$@DD<@ 0p00$ 000@$@DDpD@@@ 8  00$ 000@$@D0Dp<@D0@0 00$ 000@$@DpCz 000$00S 0pQ, A 0` \ \0 S S,p `QR @Q 0 , ,  , R# 000$p 0` R 00$*00@$*00 @ D$ 00P0  H$ 0L@p 00$ 000@$@D 0p@ 000$,⁡ 0p}\ 0R,0x 00$*00@$*00 @ D$ 00P0  H$,0Lს 0@pD 00$ 000@$, @₡D 0p@' 000$0Sp0pS0pSp$ 000$pP@54@T,00 S,0 : 000$p 0$00000@0p00 00000000T@\ Td@@ -V/L Mr` , 0 4 >d2 Q  Xp@2 0S0"Qv St , R2 RVXZ PU X@PT@ T0X140 0, 00 R( d VP d @00@\ HPP \  X 0X P0 04 0 40  0 \ -PP \ 0X00X P ,P@@Q UPU@tzx@P1sw@Pt PpDPm Pix]R]05 4P5(4 -쐟LM`ࠟ @pF? R 0R$ Q PU P 1S`QV$p$@P0 P0 RT  0 R 0R3 -LM `4#0PU 0S; S XPU0030 0 S04 40@40PU ÖL†P Æ 1>00 P )P ?3Ά40 40Pφ 40P@  PQU&11@F? R 0R Q pW P 1SpW Q0 K_P RU Y 0R P 0R 0R 0 P@2"32#"22""20#3L–P 0TL2P $PP> 30CS D2D"3#<2<"2"424"2#04 "840S  CP0 43, 400430 400%4#4 040 L2P $pPT1T!3#L1L!2"@PQU$$@Mn0KifPZ0 `PT0 RpNN0 R= 0R:4 4 0| S X45t453X t H  8 !45!!!$!4545454555$55 0-03Ls@  E PP 04#, 040 430 4004# 00 4 p-LMP@T`8  T@ p5@E 83S4l4Y8C|44 08|! 0-LMP40@4 @0P 83 40h?0!L55 -LM@84%4h2 -QL,M@P`p?438K 400 P043 <0K40@ K0  0P@80<  4$@T43@ p400 4# 040 p5555 -@LPp` 3 $@T`V@ 3 $@T 3 $PP003 -L0M434pK P00 4\ 0`248K 40@d5 4005Lld\TS   40@P@65t45 (4656565657545 0-@X5Lsp ( 8 PP$5S"d%X 040 d5S 40\5s d5 400d% 400 0鶾 -LMP@Tp` T `dvd`dp\@hh 0 q`d@0S8`5dd`c4$75 L75 -`LGNF@DTPp *0P 0S@T:W@ * R 0R @T:Q 0QP0 P 0S P33 -LP -L Mp,0 p`KTP| 0M@ @40@0PmP͆ 4@02P^1 +Q1,+ @0Rˆˆ;2 d 0X KR4 h (1X!@0@JP P( 0\ P  0400U 4 00Uo`XPH"""t45"\=  4X4x75x5"L55757545 p-LM;t`@0Pp10; L0 400  0 40 8 "" -LM@PU`p0  U 5@ ;0Q;l0'\00m< 0$0s$0 "\= " 0-P@L B0 0 0-0>0LM>0@lP0 l @0ŒQΌÌ QÌ  0P  0 0:5 -0L* -LM@P`p 0 ` p 0 @ @0 -0L MЍ p-LMP $0$0x0. $0$0 h $0 `^ $0|Vx`@$ @0S}ITp$0$  N' -LM@$0 $0 -L -L$MX1PT!@  H00 0P@ 0S00 \0pS1J1 Q`0@4p0@@0à, < 0<K8 4@ 0 8 ; 8X0 L0H087pW`F(PEZX4K595,5,5/]/// -LM$0@ q -LM$0P@Plpl`@ \0 D·0S0  R  hS`144/ :5 p-LMPQ$`@  0@!0 !?C1 @$00 0R0#S 0S @ @ᦷ5L:5X:5 -LM$0@P 0h#0h 0-0L P@0,00 \0hd:5 -LM0 @Q@ 0( Q0 ,00 \00[ p-LMp`pP@X X0PP@(KH 0$ (@ P  p](4]$333?0t/ $3] -LLM \Pp@` 0W!Pꧨ? Q-LhWR 0-LM@PP0  00 0-P LR@ R 00Q |0Q v@@ @l R@80Q 00Q 00@YW ZW $ 0s 0s@<30T] -LM@T@T@9P $0 R T0@\]T] -鐠L0pP`Vʆ0lQ@i`HV Pp(0@A@W`]<30X] -PLM@ 00h0@X] R-L 0 h0 \] P0-L@P T00hz0h| -P2LM@Dl@PP( 2 "00080 0Q0_0404a04 4 `0< 4 `$8<0H _8 <0 8<0L T< `T400A`tRV8 `Vp p00A`t:V 1~ 1x 0r0 l00S@,0 0$0 (@ P B2,K 0T0x h@x &:0 T0D8 < 괻a/:583X3/x//]]](4X0/]p/ -L -L`a< X@ 40Q@u < T <p W41snp W@ T 40Q@u < T8@T00@p 8TL0@] RT  P Q18<Tq 1 S RP @TXT( m<1T41aL0| PRH 0S l0USpt@ P<8 x?:H Q@<S m8T00!r @TC ]]$0S0 \2] 0-P@L0PS0 \0!0U  0h]$0S0 \ ] 0-PL0S 0S0@004( ,d0 0 @04( ,4004X04X] 0-QL0S0$ @T(0S0$ @T0004(0#004$ X004$ (008 84#8$ X004(#0 004$ X] -LMx@0S0$ Q0S0$ Q034X034X]0 0 RR`a` l00d S S P0i 0^0 0j ]0 000 0 0`a` |/ -LM Rp@B R࡟t^(0KP0*0P`c( 0e(  0X( <X( 0X( 0X( 0X( 0X( 0X( 0X0S( 0 X( 0X 0(X0 S0 0(0p 0$ ( X0X( 0X($0 $ @]:5;5 p-LM0 @P` (V  V (pp0;5 -LM0 @P `p0T TU00Xi (08U#80 U0 lP;5 -LM0@ P` Up $ ULT0S i(085#8$ Xt;5 0-0 P@L 0X 0X 0X0 -LtM@4000\0@ 0SD hU8S0CP$ hI]pA;5(48/;5 0-t0L @04P0 \0P 04\00500h ] -0LMS q@hk p-0LM P@0`40\TT5TT" T pphT p04 X0\040 \004 , p5 ] -0LM P@PP @5004 , 004 ,@ ] P-L P 4hPh;5 -2L M P `0 04\0@4 1\5:8Cj040 \004 , Y004 , 004 ,P(pK04 0\004 , 8004 , 004 ,APU50 04\( 0? 0(0 l(!C3 0 ( ] -$1L R`P>U< T0 04p\0@4 0\5040 \004 , 004 , 004 ,@ ];5 -h1LM \1+R pW`Vp`@P, 0 4 08  MK5V }@ B v> rG n@TPZ@51 04 8,o-aAi 0-LM@seZ 0s]0 ZV0 t0x 0 P|0 P }.0S jqH0H H D008 <5/(<5/t//\///D@`c/le/tA` -L -L -sLPB -2aLMqP@4`KT01@T4 @1R@ T$ @1R @TZ@TT1@T0(@VUUU -P0 0S  0S 0S01H] 0-0L 0S 0 S 0SQ0@A0@ c c- PD00l/"b0H]Q0 0`H]Q -LM@hi -LM0@S eRRP0 00S 001 Rڴ0: -LMP |Z0PS @@^p`V@@ Th W^ PpUZ 0V 0pS0`帀0V oOVP0Ӽ09P000W0X0AP 0S W rm0VV QW 00Y00BaQJUPpW@:p@@p帀3:5gfff p-LM@P0`S 0S 00PpN00 -@Lp`P@PUPV0P0  0-@PLP000!0h -Lpa0`@S@P`PP|0S d@ VT_@D0Sd T`  -H0LM @#0P h] - LM0S0 @T0YS\hh0p,@ 8 #8~4P6 hp\]@B 0-LM@ P0 D0D0 @ 8 K0d00h X0X/3(4$3`0 0-LM@PP0U0StL0  H\0\  @H 0P0T 0 n T/4<5/ -LM@0L0S0P0e0L0 -0LMS@  S00P0HP 0hHFHD0P0P>0 -L@Pp`P PTU<@ p-LM`\PXP P@0dS:ph0dS: p-LM`F5@ TPPU $   00 00 @ Td 0h 0PPPp:A-,rM@`TR"00c@L0l01@Ѝ؁A0~0Ll1p@ A0c!10bS c 1 !\0 !R 0\ , 2q@?C0c ` 1 p0?00B0c !00aS c 1 !\0 !R 0\ \ q?C@0c ` !00?00]a|_VUUU 0-LPm@0hf -LM`PP \P P@@TX,K TpB IW!X10SW ppWT0\ `S, ( X, (0@@8, (0Tp`0\ 0 R@,0d 0llo(0h 0lPl,P e( Hh00`0aBaD0@H(00(0a긻aaL]5Mb]Q0Q00 W@R R | 0\q 0 Q  -LdM,3x0 | t3| , t0_40t#0 02  GP;.XK  @0S S P@0'\00p4tmt X2X0S0H1H!|&<2  |50|5(2  |5@0|5|5Y@C 2/@ H_50%0Px@K !t 0/x0Kl K P |100|0\0Y0lL1h! 0~P Y D11 ,0S ,,}|!0`/͊_0@@%0P0`@#Hh P 8`p@5͊P%00|d`,5L<5T<5(h<5<5]5h00<5$5~<5JHFD<5=5 -@L`$P P00$ ;004P$ @$P؀0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UQ0(]S[S]04]]]5 -LMD@!88#0![PpPR 5x30x3e $0S $Q? @5S&[?0Q  t 5=5 p-LMpc@?P$ph7 -L M @ 6@唬鰺"/ -L M@ 0@儬鰺"/ - LM!P!(P@C 0pP`)0S* |5` Q 8Q2 R  Z0 10  Z0 10 00`|50/|5i 0`|] - 0!4LM#PP@ 0pxP` U0 80  U0 800 Q fk] p-PLM`e<(0?00,8@4t 0s 0 0  {; v(04T0 .0$X0 00<$8p~=5=5WEV -LMPp@ `$((0"4400$L0t@0p1 \D 0K \h 0 t \< \ ( it 0S000/=5 - XX%tLM' `p $ P@l"  |Ő0s 1Vm (1V 1V t 0 l l 0l}1V ?Ke/ P1V8 :D10S  0psPl |% |%0 l"9 Pl t# 0S0000V |50|5[p" %44000 0|o l 00 "   0l2 0S00|5]mdedAsd rdAhdk~gd/ - 88@#DLM$`2Pp 0*H0 P(TBĠ*0 3qPPPP ] -LBCMB\`, p 8 8#T % P@ t# 0 SȀ(P?PHpDP`  0S ,0 S ,60`QH!ء00 t3 WNQⴡ0 Q_ Pa0|%S0000t00@0000( S0!d`lC0PA P( h1S00<0D0x0M0 S 00E4! A4!0(S 1 !pbS0!W㑓)`h@00,K0,0B[/tK/K<KKXPLH~|]`]=5]]=5=5=5(4 >5(>54>5H>5\>5 -L`tPP@ P P0pW U ,$( 6HK@00;00000Evvt#00>5~>5 p-L$Mt#@0PSp8`K |5 @0 U00K10K002K8 KT0t,0 P <2[2[  0u>5>5?5 p-LMP@8`P+ 00 00000 0 0 S0$0@00 @ 00 40 ,0, ,00 400ppd0H00 0- 0@ JLP 0h05 -L$Mp12l1,0,0 ` ^8p 6^~6 006@6 P :,  0$00$0   oO 0(+@ş@,tP0$0 o0@ ,@0S000 2080 080 00S 0% 0p4 p(x4 X0 ,q P0eQ0<0, 0b0`0C 0P4 Q0@04@ 00 E<$ "X@0 0@e 4 0   Y 0 5p%p@ 0D80HP0 (0$ @3 Pu0* @4 _Ƞ,Ƞ0  D L$0 0$00R c$0   0w  ""$0 0$0400@ 0P0 pp40 S 0!0(S Vڰ0S0K 0 9p)p<@2 P0.4@000 0S\0#1 0 Y0 1 yP ,{P 0 ,: 0(+@T @4 _Ƞ,Ƞ0  0 pp0 0 4p$p0 0p p,@g0000 o0P@]0f X,q P@T0(UT4 00Ś  0 ]0'5NEFX' -L M<`Kp@ P0<0K0 60K@?4 K7@KSK00 5 KP3[= -LM 00 0 @R 0S a0 0 0S -LMp\W`pP @WĠeT 0@T8YP ]]X4%5p+5$B5 p-LMD@`PC PP U @pp^( 0 PR ^ -LMP@ D?@0@T 0S( @T1/8B5f`DB5(4 Q-LP. `Pp@aFQ00`V00S00@0@T 0S @T`tPP 02$04 40f`PB5 -Lz$0 h:4'0ș5] -LM0 ,  R "4"@ !$"R`dpK0$PP@ 0a눤@T T 0Ku@P  T0 pK`K< 4R R a  Pc[@][նT0 ST0S *Q0  0P X0S) h[ TR R b Q4O 㩶P+[u@%[᝶T 0K\NP 0SD  r异 0 00S $\2 ,0S ,p,88 #Č`2` a P,R@ (Ÿ00 !((!4q"$0 T "U0s0 0 0 S00 0S񟗲*0*04,0+0*0*0[,((0 "4400$04 @DP \ v@M 1 RP# GP@0 开"4  0$ 020$0  ppnh000 hN`000t``O^^p64\B54]|B5B5B54B5P^O^B5B5h#P^B5 C5$C5 -L$MP(  R 4 <3, 0 (0580SP540  <0 S2<0(40P0Z 0S20(8 Y2,0`D08Z< I 8@ pH @ Y1T(0$<00 8 @003H P H d$0D0 4 WH o@ [x W 0BSEρ <0RfPWD0W00S H R:0(0 80S)8 0T0<0#@0(00 <00 i3P\340 H@(0e?CT 43R 4 R$340 0@e?CT40SV 00:0004,0 qP4 0S8"S4 dPp(He/4p R!0S 000S+ .S( S p 0 0^ *0S R: Rx 0> p rS S@ 0R@0 0D0 dp0S  0CSSp0D 0S 0Sx  P00SR 0S 0SPx x  0S 0SPx x   00  0! < Q08 0000,0S0?0,080S00, 8HC5\C5tC5WEVC5C5 -80LSP`p (0S KKT r> 1R0S PV# Q(@2@R0`! 0R 0R: 0S  P 0 0 V08re/e/WEV -LMp( @0D@8PEX, `L T(0 "<00 @ 2 P@jHo@  0S 0S`v  P00SR 0S 0S`Pv v  0S 0S`Pv v 0 01,0 0T0,0 @0(0<00  1P@H( @0e?C\ 0R 0e?C@T e/m000 1@00:00.0SP (HWEV -LM(`< @PtD8/\") T0S`Q@ 4<0(` 4# S0 S00Y0 4 8y0@4000;0000 -L M`, pNP@ V Q0 00 P0(00 00 /PP 0S0 P 㨝㥝 0 0 @ 0p㒝a -L M0@S K K 0 |yn Q-LpP 0S00@T 0a eP@ 0T p-PLM@` <,TA,!<0 phC5C5C5 - QL MpPH<0SB8P@; 00K4 K400 ,0K( KP` (04@KP  @"P@ <Bp0S ;B04`0 0lpp@4(00  0- PRL R1<@T  00  0p0Sl0 0 0-0LS@P0Pxx 00 S P <0 T  \0 0hCh 02]B0]5 Q-`LP6q0<@T/ 0R 0S 0 㯱p0S0p00p 0UP0@T<*4D5a D5a@D5(4^5^_05P`0LD5TD5 -LMd@P``p"500  0 0  0aX4$`p^a - (Lp(P"!$RO01SK RJ RF1<`VB @T$ p!20#p0 0lP!  0 Q0p0h 0P W 0 !,0 !, 00 0`0 X 0K<0 UpH^P0DS05+ -P1 L R gpI 1Rp <0Hp0:  0 .p0W 0  0(0  H^5 -LM@ぬp0  0p0y0$ (0  -PLM 0 0 P<W P-L`@ 0PU R@B $ph02T@D鄧5 p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dp鄧5 -2L@`p+  Q,10 XW 0Ra R R P-L P ?#?00cSa0a0a0a0h^^P Q hQ h - PLM@`PA T9 T# ,q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0(02o@ 0(@"P00R00S0P 0200 RpP0 b^HF5a -LM0Pp 0弁p@ᠽ`ᴽ@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP (0 o: (0 p (00(0o^ -LMܠHp0$H 400pPj`N 0p < P)$p 6 :w0 K`/P 0^ 0-h0 !Xp0 L0  8#UP@008#HT^ -!LM0, p 0岂@1 8C00C8#0 p04`0p0@P  0 P8  X#, R Z 0J  X^ - LM0p 0尢岼 J , 0 8p C04p@0`ḼP᜼  0J8 P #,0XY0I ^ -8!LM`p0 P@u10`00C8#8 4,0 傼p f0P  00 p04`0p0@gP K H0 !0 R8, Z#X0H^ 3 -TL M`p0  @JX 0`8#84,0 /p0P   00 40 0Jp 4p 0`@P \ 0I!48#00 R, X040S0C040 4^ 3 -LMܐHp0$H X0`40ۻpΏ 0p 8%X h`#80A40p᥻  1@T@^ 3 -H!LM0 -L@M0 48 mQ`( C PMQLQCQ _AQN -@Q (0S (G 0TPR35 nQ@1@!pg\ Š%5 TP45%D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDpHP0S 0 l gR@1@!aL^HD HPDp34fQ @XQ- "PQ(0TPpS>0 gR@1@! b\ Š%5 TP>%d45%.cQ0S$ T 0Q3S<$ pW@*L0 0/S50|000000000000000000000000000000000000000У0У0У0У0У0У0У0У00@TPp @TTK 0X@K@IPwT0X @p004 8PJ?F5F5i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U$L ȩ ^0 /R 19R00C P^L0 0 C000^L00C8G5AQ$00000000ئ00000000000!R,00 ,R ,0,00,0 p-LM,@AP0CQK(0P0X0X0X0`0|0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H00H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H00H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMP@p !0@Tp`@t 0!0@T@`@x 0!0@Tph4343 -LPp@| !0@TDD@`01| 0 !0@ Td343 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C 4^@78H5   P`0R P 0$ $ G00__^__ -@0L R 000 0S 0S 0___ -4L,\ \ __ 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L M; S, # Rr Re R n T PPM P P@0`0UAP Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A1l2,R0U0 R0002T; 001R 1R R;00A Rx!t Ha[0080 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; qT 0S 0 R R0U&0U#0 9,pK 0<0 0  -p!LM04 S\q1Tq080 0K  '8P`@`V@DPEAJ3[ S"[00b0cS  0K X8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3^^ 4S @08#<@8oS: S>; S P 0 R0,R3 -LM@Q 0(0L0l00<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S r I5 p-LM0`PP@ SvP -v0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ 冲 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0Sb I5I50Q 0`c Q- L⏳J5 0-0@l0P0 p00 LPU 0Sq0hn^(J5D5(4Q p-LM`0PSMX@T 0S 1P!00 S P0 pp㟊0`0CS0000 R000S0S0| 2c1הP{L0D ㊅00Օ]0]5" P00c R b00$AL| 0 ^P 0 R00L|L| p`0VP0 00X000 ^ 0 R00Q0 00W0L00|G-T`p@X 2,0 1 TPh$4L|DA 0TP PL|L|@ 0TP PL|L| 0TP PL| b0c 0@cLD1|b@  X0YVP P  T PRLZ| p-LM`@PT 0S @T  qkP@ p  00@p00p(^ -LMX@$p@% bT0 apGL Bw &R$  pG0w`@T0 -LM@p aPL `@  @0T0d0CX # $ ';<0A0q& 0Aq -LMpR@P`  0@T -QL M, `XD0@T , Pp0 @D0@T XSJD0@T ,0Pp0 @gD0@TXZ -LMRp`P@T0  @IT@XJ0  =@TZ -LMQ`PpD0@T`V 0pD0@T - L 0 ST0 S D嗧@00 0 000 0,0 0S01 K5X1< 1 1D 1H1@-A;A'<0<  0hh0@|  4 4006 600 0000@2 2T0 __ -LHM`\@p oT X !4.0 X@$P嬐 W& 0P 8PEpbu ( 0PE#200u0   @ \0 AD! 1000C0PE00u0 PEu00@___ -LhM`\@p oeT X $!4.0 X@$P嬐W W- 0P 8PEpbu ( 0PE#200u0   0#2000 @ h0 AD! ! 1000C0PE40u0 PEu000 @___ -L∡M`\@p oT X D!4.0 X@$P嬐 W4 0P 8PEpbu ( 0PE#200u0   0#2000   @ t0 AD! ! ! 1000C0PE80u0 PEu0000 @___A-` p!PX0!1, 1!0 P@$h 2L|` 0 0L0|0 0 Q0!L 0@RR|` 0Q@00000U0CSR0L000|333p@-@P$0 X0a<.1 0 R$@@D0"t 0 @D0#t0pph0h  @D1t 0p 00#0q0@D0#0t333G-0M, 0PP,@X0@ @@ p Q$, 0!0H x00`f pV0,$8,#$!,&<4<!4" W fP@,$8,#$!,2 <4<!4"< @LT< 1\ ,$8,#$.,2,<4<!4"< x!0 lQ ,$8,#$.,!<44  0P8 NPc~% (p# $Q@0N0x0~  01x0   00x0  01x0  00  0L00000 00000C0NH0~       0N~__$_@_(0$8 Q!0  Q:30@-P(P  $08@Dt @\ 0 0 A\(@Dt0 p-LMP Nw80`@T  @Tph=w_ -L4M, <jaP4 ,4< ,@$0 0⣡ , 0 404@TaP8 u ,  ,  0@ T,0D $0L0 L,0,$0, L0 (P 8 T@ H X@ L0pWLX0H ##,*,T  80@ 0<0 P*?< >1G0c @ @P`?>1 1@V3 0Q00AP :L pP0W:0D QX0T 0 P 0X0 T L 4 ,4  0($080804P48ka4ha4 4ba8 0-L@ vP%@vTP 0h(0-LQ@0 0R, 0 S _$:^_,0 P 0SP_ -Lp `PZv0@T U 0$ R @T IvV 0 RX 0( RW KP 2v_ -LM` (v $ (0Pvr@ R0P0u v0 00 0X0`01 Puuq@ R 00M u< ӌ$ (  W.W$ W$!W80B@@u R 08  80u088 ᰌ0@_8 @W W  W  W W W  W|  WWl Wd W<__P uP5``:^_5`5`06`6`7`7`7``8` -LM@ P`up P@& U ,0U 0S0,PV 00V 0S 00`00("X0ZuVuP -LP p`Ku@PU10  ?uU 0-@L 6uPP@ 0C(S"H &u0傜PK5@-0S4 S/0!0@ ^@(00^$ 0lQ T00^ 0@bS 0 S00T0P00SS0hE^ -LcMq0P@$0 >0@@R00}/#\B1tTTT k0P0 $0S h$ X^Ta0S0D!0000iK1 A0@00 1p`0`2SC@4 0mP$@T0S 008 R 0  0S0 00C0t[00T 80P0H 80P0`E^K5K5K5(4]=K531K5K5 p-LM0P\^ @L |0|@[Ql`lPll l0^ pP[P <ٜ8咛0Ԝ,E^P5`51E^a61E^L5 L5@L5`L5L5 0-L@t0PS0000 0@@0v0h ta -LM@t0S R 0 00  0  hsa p-LM0P\2S `0S @ 0 @4~0\2S 0S ? i00\"R P0Sx@002c1 T ~P0S , 00C0@L@ZE^L55L5 -LMs`Pp@ 0Tp  R0000 0  s sP@}@TaL5 Q- LL5 88#$R\\ 0R01SP0SQ 00E^E^,a - 8LbMؠ8#P( `P0 S F? l1 R001 P1 X0SP PR ,@I us00XP!U00R00S@U2I? PePU T0S # 0PUYχ 0 0S 00 4 PUT T 0U 0 13 p-LMPP!4P L0@`TeKLP XPephKeKeK@T4 - @LX `Rp 0PS 70 1< h` uPQDnX0qvX01X P1S`P5P5P5p@-|` @P  0 Č$ L0#Q `P8Sp0 S0S S3 -LM@ 0 S0 S  -LTMP$`0p0P,0 @ | oPd`  0S  @,4 ,0S (,q_0\@KTK\0K[K)0  Y0KVKZ`KX`KW`KU`KR[X00P00SQ@T PK?>1 1DQ@T XcXCXT#00LßQD  庈 0S 00>0S S3  嫈婈X 0f 3JP` 2T  0S00S 0S  ` KP ` `P L 00S 8 qV fJ0T0f840` poPPn &00>0S Sf IPd P010  P 0S}?d0000d>0S0 S`\ T @ 0T4`090 =P@*Tf 0   01 0CĠ UKV0K)`(4=5dR5R5X4K5L.4!5 Q58Q5DQ5LQ581lQ5Q5Q5Q5T1Q5 R5@R5 -L MT p, 90S 0S,`0Vʆ0AP P , `0VT 0 DXZ  P T0S  0S<  3 K P  T劇 UP 0  0 00  `PP   h r _  e ` d 0SS00D @4 ;0 R5R5R5S54S5XS5 -00QLT0 Q S R 1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S 4 P 0S0S   -LBM @0004@pPV`y0P q[ Z P 0 S]0\000S< 2@Rx CKA A Bf0FOd\ dmd>FOd d00Baꌮ15Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!PnP @T*0P\?@T:@T*0\%@T:L0W 1S c LKH0 eP P= i{>0S4$P 0 S00S=  X0S 0@Th 00S> 00S<  i]{PL c @ > < : 8S*0Y0 00S PS 00(4=5V5V5h4V5V53V5V5V5W53,W5T5LW5TW5\W5`W5hW5 -pL`@P@P(PU@ZlR0@0CS0%bRAT P=0W1 !0  gp@ -Q L1-  Q S 0S ih -L`p@PPPU@Z@P`@PPU@Z @`p -LM0@S  1S01 1SP P1 010C1P1 CyxW5 -LM`pP @ 0TP@@ Ƞ,Ƞ 0000 R P@@= -LM@PP`  h0!T` 00040 R Pࠁࠓ=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qrYc  g 0P00p000 0 0PPEDd 0 P@00 0S AxG^= p-L M0PS@- 0BS111$11$181h11T 0R0P RA R*R# T00CS000@  0PPpph9v0\# y Rg 0 T T 0Q0ph 8gD 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48@0TA KPK0K 0?0\0K00K0K0K@K@KK@KPPP[ -L M->@TA K0K ?0\0K00K00KK@K@KK@KP0 [0[4 p-L M->PUAd0 K! K p!0K@0\!@[ 0K00K0K`K0KPKK@KP p-L M->@TAT0$ KLd K p@0\ 0K00K00KK`KPK@K$K#`KKP00 p-LM P # H`@#b@TT !phy@tPZ5 -L`pP@P@U@2/02 3 -LM@ 220CS2hG -->pLWP@`  %X@ (T\`@( @TT &#H$HslZ5 -@Lp`P &Q P %( ($DP@(@TT hslZ5 0-@L_ 000S5  006S$   c->PU? 0h87 #80h  0@-HP@ 0, Q ^?0 -05L P <5Z mS @ @TaVp `5<5  c0SA@.0!lVp`5 -LM@ ]{ Y hT p-LMP  I`@ @TT ? ~$ ~ 3& ~/? $phP r'Z5 -LM 0S4D 0 0P 00|3 -LM`Pp@,r  r P@?/@@2"2#0RS"@210 KP@ xr0D 0?\b`!d2 p/p0`T`h2S l2S p2SI,@KP 5 Dr} ~`1!0p5 1!0  X0Pa1o!4018  @<0 !1pu8 0;E$ R "0o8"8p*5 ZX 1  ]I\ 0P 0 S00Sl" 0@T00Sp"00Sh"  Xq(4=5Z5 11Z5Z5|3fZ5[5 11X1p101111[5 -LMp@0So0P9X\\I5@ [E85W*"0 BR0"H\ _Q-0 Q->0 -RLM`pP P$ ; 0 0 PH@jPP 0 !!$ !0``1` `HU! H@j$H$ R 1 0+10 ,`(`@PQ0 + 5@ U U00U``V p202PUtph"04pb0St00t00`x00x0l[5 -LMP->pQ@0` 5@ R- R00R``V 202PT ̠\At0  @tH"0lpb00K 00 ^00S ,KA ^*0[0*0K*[Z l00l000 @0C00 0 0h  h `G 7Pl00l0 <P2 GU" 1[5 -P->`LVp0@ xG5X;e5 XXmkGt00t0c LpX xp00p0 H 1S z[5P-> R\# -LM-> @R0p'_o# 7GD  R ZV \!VX0"Vi"G,0 00 0S  1S >15 p-AMLAO0P `0{ P 0 C400x\\  P202p o\p' 1[5 -LM@-> R# = R 5+Q P 5;5Q 0S010C1<P5 ;%5r! --> LRP0p⁏5@@ F9}o @Tڴ5 H < | 7P9 7P3 H l% e ^Ct2S 5O@05% +%SF~U XEUT0mEUP mAF(n [515[5 p-LM@? ?`PP? 3`PP? +΄%'`d @oPP ̠t ` Pp 4np   1 1\58\5X\5 0--> LR_ = ( R $@T C0@TB0 0-@LOPB000,  0 -P->pLP@`wE1TZ1TD*1T4 1T ` E%# = S =@S @ 8C8`2%2  > ~2 3 @ f5050 R0q 024P`5@`02l0T `0TT0P\բڠD0T/04`2i 1i i i 5i i 6i( p-L Mt0@0t0P`m%EO0 K`K 1SEp9x\5 -00%P-@%LU  %TtPSxP:|P!`PpPP`PpP P = rǛbrbP |P0|2 cm ]mP xP0x2 xMm dGmP tPtR ,8m 2m\5\5\5\5]50]52/02 , -LM@ +20CS2hG -L M-Π ^`Pp  @0?0(0K:DCʠHC6 GD(K!K%K#@K"0K'PK&K$pK@T -LM->`pPP 00S S @ @K@K 0@ K l0 PT0@U0[ [0pll' T]5 -LM-Π P`UCĠp@ K 0Kih 0P} K L0v @40Po[T lzl! l]5 -LM42%. 6S00@ RA?< R 0, G0ShQl]5 0- 0 3_(0LS $@T A0@TO@0 0-@LOPn@000,  0 -LM->D 0Rp( 00 ,0  (0S (T 04K4 [30[ d1Q`hU&h@ P0K< 50 0 [0S/0KΠ =0!U @P``]5 0-.QI 0-@MLP 0@Kl 0X 0@0@ @D(1[#4S4  <0@D 0@DK <0@@yD 0@pD H0@gD 0@^0 04@WD~  0   0-@MLP 0@@D(g 0@7D ^ 0@.D<U H0@%DL 0@ (0@ 0@0" -LM 0S0 0!P 00(3 -LM`Ppj0l2 6P@"0 #?%@@"0RP#)H3@/2RP@ ljDb 3!H p/p_  `j0< D" 0S;9430@THKP 0 S00SX" 0@TA%>0r0 /$j%.0@  0`K0`K0`k 0υd υ0\!?@@.ej} X  X0PZ|10px!5t1 p!0l1o d!40`18  <0 H!H1p0 0]=$ R "00"0"- |P0  AD S00S\"x00ST"s ip=(4(3<2]52]5N]5]5]5``0 '\'4 2p 2X21 11x11^5^5 -LM00PS0`iP -> -dP9`P4hP/D!D'A2p0CS25@O w=0-s"2 0CS 2AD {LJHQ-0 Q->0 0-L@@CbPU $ 011010  1 @U0 @@&b$@$0S !0 0,(4 Q@0P`5@ R' RRPT 4# R4`0t4  4-`  0h00K`5%.00c[ 00S908#h  ,KV[2[0 0 AS0 'P00`0c 00 P@ h0 0h0 P ``V?<P*?00Sl00l0 2(^5 -LM@->P`Q0p ?V VVi?t00t0l dAhV d5e;5 偖 `1Sp00p0D^5P-> RDW -PLM@+ -> 0pR&_o" i?6< #R N \TNX0UNiU?,0 00 0S #1S Z25 -LMp%00P$K1 o< D2 @1T2K2[@@02KL V0 0㙗0@[TP  P d  @!0S2020K2KU@ 0 j@'02 0-@L 3S& 5+#PU 0S0  10C1P 00 5R!; P5P!0<P5 ;%50 -LM0p5`@@ >~7Pl, 7P %.0Pi /0"48 @"%>  D2 R95  0 ?H&> P jl Pg mf>?H? P Yl 4O`   5c%_@ %5 ;5A> 5MhM /M0m/M/0` PD `0 P, 0EPl,f`^5%&|^5^5 225^5 -<2LMQP@p`o2QY*2QI 2Q `%: = S$ =@S @ 8C8`p2)%p2  0 Kj [ 0[40 `Cp2 8 0 KS[ 0[ 40`@ e5050 R0j 0*4P`5@`0+h0Q \0QP0P\Սڋ@0Q/ 0,`2i 1i i i  5i i 6i( p-L Mt0@0t0lP` fe=O0 K` 0SQ=pb^5 -@L00%P-%UmL`PRdP9hP `PpPP`PpPxP0 3xrbr bdP hP0h2l el eNP dP0d2l xel de8P `P`Rl ,el {e^5_5<_5`_5_5_5 0-LM =@0TA KPK0K 0?00K00K0K0K@K@KK@KPPP[ -L M =@TA K0K ?00K00K00KK@K@KK@KhP0 [0[4 p-L M =@\AdBT0 K  p@0 0K00KPK`KK@KKKEP00 0-LMQP@ ?0@00KAĠ0EKK@KPK0KKK0K(P0 0-LM?0@P K0K 00KK@K@K@K@K@K0PS0d0_5 -LM0p5`, = <5 =?\ ! =@?\ QU@ P5<5% =@(;;1@"  tT0S (;;!@0U@P5t5 -L M =@ \K @00K 00KKKKKKKPsYdZ5 -LM 0S4 0 0XP 00 H^ -L MP`p@$2d .d hPR!1 p1/p2..1/2bb, KP  d,@ 0PT,PL 0 S@00S," 40@T(@KB;P' c} R0 0@5 0 0 X 0`S.z' J0  ; 00S0"00S("  8c(4=5Z5&h2&2Z5[5 $2 2 &2_5 -@LJ`-0S0P:5p@ j';00: I2Q-0 Q =0 -RLM`pP P$ ; 0 0ؓ P:@\PP 0 !!$ !0``1` `:U! :@[$:$ R 1 0+10 ,`(` x_8 d_P 4$P4R) ,_# _\5\5\5\5]50]5 0-LMP"D@0K 0KK@KPKKKKK0 0-LM8QP#@0?00K@!Ġ0%K K@KPKK0KK0K0 -L(M`0KP@Y$0[# [4Sp{_d4K8 KP@ H@!0m_4Pp,g_ 000 P@6 0  P@$   0 P@ 4W! P0n L-_4F! ({ $`5 `5L`5|`5`5`5`5 -LM05P <5 ͠000  m@ -A0T00p` @ 0ȠȠ W p" NP `D#MT@5 M<5 D 8  #8! 5 -LM @P/P ^ hZ5 -LM 0S4! 0 0P 003 -LMpBP KP  ^ `0@VJ$2S (2S !0P|1 fPDP 5!N@`!P $I^} L1!0@5 1!0 X 0pM!0  5 P 0 S00S(" 0`V00S,"00S$"  4^a5Z5Z5( R J 0 4(0 '(0 Sl00l0h00h0( P 3 7Pl00l0 <P 332[5 -P =`LVp0@ 35X;e5 XXm3t00t0 LZ\X 4(p00p0 囊 1S >[5 p-AMLAO0P `0 P  0/"-C4? 0@ 4\X  bPx20x2pl \Xp52a5 -LM@ = R5+Q P 5;5Q 0S010C1<P5 ;%5 -L M0p5P@` ,3@}υ 0@ - 005  00 @ 7Pp y7P 02S %@ %5;5i2 P  [[5[5 p-LM@? #>TPP? KoPP ̠0 L Pp g[p 328\5X\5 -P =LP@p`j21T[1TE*1T5 1T ` 2%$ = S =@S @ 8C8`<2N%<2  =  ]<2  =  @ [505.0 R0^ 04P`5@`040T(0P\եڣ2i 1i i i i  -LMP0 -@|To t00t0Z'20 K pN A1S2x\5 -0 5P=5U@0LPP4P78Ph`PpP`PT`PpPLPLr؈Tb`r҈hb,P 8P082 tZ nZP 4P042 x^Z dXZP 0P0R ,IZ CZ\5\5\5\5]50]5 0-LM @P0PP 0@  ;PP 0S 0\3 -LM`P@ Z  Z02 "0 P?/0@2 2u P`Y022 @Tp>2s$ 2s 212}OP$K0` H} H? 1 _ Y1!0@5 1!0 X 0`cI^1  1 x AP 0 S00S"  Y0@T00S00S" $ P ,T}(0!R@TuPp 0 S ,(0!0 "(1(4=5\3a5a5a5*D`[54F2C2LG2n(T5T5b5 -PL0Pp`00@S 5@ 000ln -LM@"> R5+Q P 5;5Q 0S010C1<P5 ;%5% - !LM MPp `0ˆ?  P ||  M0S`20`20K# p F'(M2 -0 5P=5U@LP7P4`PpP,PL`PpPDPDrLb,rކ4b8P ؿP02 pX \zX"P ¿PR $kX eX\5\5]50]5 -`">PLP@p3/0T 0T  /50540 R0\h0T\0Q\ @ @ bi i i -"> Rt00t0 Xx\5 -LM0`5P@ [/7P: 7P4 !> ? 㺾Pp B Wi>/? ? 㩾Pp 1 tpO0\  p ;%@ %5;5W[5X\58\5HK2[5 -RLM`pP P$ ; 0 0% P.@RPPP 0 !!$ !0``1` `.U! .@7P$.$ R 1 0+10 ,`(`PU`0p -5V;U5 VV t00t0 VV -N(K 0 P(0St0p000t0p01S -5ꪄ `[5 0-LP@ 04 P*0S 0P:00SQ-0 Q">0Aq- $0A0 0!q "TH^ -LM 0S4 0 0'P 003 -LMP`p@TV HU 7P@$ #?@"0S#@2/@3S0 KP@000400 4 ?i080@0<0 `Tk80se <0sb @0s_ -,`K 0P@JG U C tPQE1tp!51 !01o !4018  <0 !1p  0@($ R "0"   P;0 2, 7`U ,02YU4P  0S 0S 0@T0S@0S80S0S<d1UP(4]5Pb5i2lb5f234^2c2e2@j2j2k2h2h2tb5b5b5b5 -@2LSPotP;0X0U^,2p0CS25@ (, 02B,0 㷺 -PL M@`P P`^EtF(K ”?00(0K%K#pK!K'K&K„$PK"`K2P0CS2 -PLM@p` R`pUFG,K @00,0K)PK*PK+K'K%K(`K&pKľ2P0CS2 -PLMK B KT0  P00[ -PLM@p` R`UGF,K @00,0K&PK+K)K'K*pK(`K%PK倾2P0CS2z -LMP`B咏Tj+p0/y 0 5 T  7PE 7P = y} u m (H0S D0SP5P@@05%+%7+b: T):P0*:)+S$< [5h25[5 p-LMBPT p+ >$ 64`0@  1Tph1'Q-0 Q0 -LM┡2 S`( tp5 U  <5   (0S ( <0K <)[ 0)K@RU@ P5<5  0  C0S 6?0 00U@P5 `b5 p-LM2`SP4"8 "4D0 ܹP&4<H0 չPOD0|  `>l20CS2p%E ,R`> pa28\5X\5 -RLM`pP P$ ; 0 0M P!*@zKPP 0 !!$ !0``1` ` *U! *@_K$)$ R 1 0+10 ,`(`0-LP $@7P  0S 00刺P(7  TP呺7  -LM+N0 S   0iP(7  5Pr7  -LM@2S"2S 5+Q P 5;5Q 0S010C1<P5 ;%58 p-!L!M+^0@ `0Ձ @;\< l1L0 H   -202X2@0CS2T20 2p+ 8Q0  ;<`2b5 -PLbpVt@ )5X;e5 XXm)t00t0 tQX 2H02i20CS2Ŀp00p0  1S C[5 -LMPp2S@t` RA R00R``V h0l0h0tP(T AD0  @嗹202¸20CS2}2D0220CS2ph 02Qh`,0K 巹 04 C, x00x0 R l00l0 @V?h00h0, ` g( (7Pl00l0 <PN T(a2[5 -`L2PS@pkA(1TN1T:*1T* 1T p 0(5 - R @R @ p9 L1 @ g505g0 RtmT t#4Pp5@ txl0T `0TT0P\ծڬD0T/00p2i 1i i i 5i i 6i( p-L Mt0@0t0P`eP'+N0 K` 1S'px\5t -5@=P5LUP6DP9HP `PpPP`PpPP02Qrj~bKrd~b꾸P H^P0H0b pP\ \P꨸P DHPDPM $OG O\5\5]50]5 0-L2_S2(0S0h#$@T ;%0@T0 0-0L"RPO 5@00"000#000,  0P2S0 -PLM@* 2tpS&_P`" &#"R 6 \5X05i&,0 00 0S "1S <h252/02 T -LM@ K20CS2h铽 0-PLM@P 2 SQ 0 @      K0 T [0[Ă p-PLM@`P 2SQ p @ FĠ0 K K`K]     0SH08 #\ 08S0 S hL^ -LMPp`ṿ@ N N P R!1 `/`$ KȷP N$@T0PT32S 2S 2ST&0@;@!\0<1 8!0>` 5X0p G>!1PZd Y0XP0P%  T$P 0 S00S" 0@T00S "00S"  4YN(4=5Z5Z5Z5lx2t2dy2{2j_5 -@L%`p`00PS 5@ 00%  %jQ-0 Q 00i -RLM`pP P$ ; 0 0 Pg%@FPP 0 !!$ !0``1` `O%U! L%@F$D%$ R 1 0+10 ,`(`0-LP $@7P  0S 0 εP7  P׵7 -LM#N0 S  0  尵P7  |P幵7 -LMP0p(0 0`S0@ 5@ R- R00R@@T l2'0l2uPV ˠA$0  @嘵ƴ$#᤼l"0GMlB(0K ̵ ( ~;h00h0( @ $  7Pl00l0 <Pv |$Fiq2[5 -0`LPpU0@ h$5X;U5 XXm[$t00t0S PLX (ŵp00p0 8{ 1S 2i[5 p-AMLA#NP `0| P (XX  9P`20`2p L>pLs2c5 -LM@0 R5+Q P 5;5Q 0S010C1<P5 ;%5i p-0LM @R0P5@ p#`7Pl 7P $2S %@ %5;5ph# P TLi[5[5 -LM@? ?PP? 3pPP? τ$" @p>oPP ˠ$ ` P_即n 4Lg c w2q2\58\5X\5 p-0LM@PQ00 5@ R R00R``V' px20x20SU$ph鰴3l"0 Kxbil[5 -0`@LQPp+ #0T 0T p #505-h0T  R\  @ p@ "ii i i 0-P@P0L HR 0t00t0K 1S 0hix\5 -0 5P=5U@$LPP(P7,PP`PpPHP<`PpP4P邳4ry j XH0S D0SP5P@@05%+%. p~.l0.~ H@$  /[5.`25[5 p-LMBPT pLD <` 00@  %T ph%.'Q-0 Q0 -LM2`Sp`t5 X  <5  o$  @RU@ P  70S- P  0@pU@P5<5 Y   H@ o 5 &* p-LM2`SP4"8 "4D0 /P&4<H0 (PO̠D0x  `呯忮20CS2px꘶ (0-LP $@7P  0S 00ܮP7  P7 -LM+N0 S   0微P7  PǮ7 -LM@2S"2S 5+Q P 5;5Q 0S010C1<P5 ;%5 p-!!LM+^@ `0,v @@;T<d+ H  @勮202嶭2@0CS2T20 2p鉵 4-F0c ]/<@82|c5 -PLbpVt@ n5X;e5 XXmat00t0Y tEX 2H02Ȯ20CS2#p00p0 4t 1S L[5 -LMP`2S@tp RA R00RppW h0l0h0ӰP(T ̠AD0  @2 02!20CS2ܳ2D02t20CS2ϳh 0Ehp00K  00 300S,KA 3+0[l00l0h00h000 0C00 0 0p 37Pl00l0 <P }82[5 -`L2PS@pj1TM1T9*1T) 1T p 5 - R @R @ p, V$ @ g505y0 RtH t 4Pp5@ t l0T `0TT0P\կڭD0T/0 p2i 1i i i 5i i 6i( p-L Mt0@0t0P`D +N0 K`F 1S px\5t -5@=P5LUP%+DP9HP `PpPP`PpPP02鲬rrbꬬrrbP H快P0H0ó pgD꽳 \aD P D婫PDPꮳ $RDꨳ LD\5\5]50]5 0-L2_S2(0S0hL$@T 0@T0 0-0L"RPO 5@00"000W000,  0P2S0F -PLM@* 2tpS&_P`" Y&"R }* \D*X0E*iE,0 00 0S "1S G`252/02  -LM@ 20CS2h p-PLM@`P Q pV pU UPpU] U 0ll CP`P`0U  X}U Q_0UPc53B7F p-PLM@P` 2SQ pUUphU] U 0h hXC`P`0U   nU Q_0UP03c5B7F -LM 0S4' 0 0:P 00H3 -LMp` WPP@ C  C( KPP  B(1!p!1 ἀ#<㳀x!x1`Pp!p1PP瀫0pU@(|P> 0 S200S1+ $0@T 00P P P 0   p0 ~00S0 00Sl0   TBZ5(4=5Z5""#"8*<*P*# *[5[5c5Q#2# #[5 -LŸ2 RP0p  0  0SXb0S;(\B @wK>!@00CS0e 0S A ` 00C! 0Pa0 S AP?AP#xAP d1 ɪX iP00l Be  B걪X QP00T AM AꙪP 9P00< hA6 TA$iL*P#Q#c5L# ** ###"]50]5\5\5\5\5 -0L#lMSp  !$`B!@%=?ZDP U@@T,0 @ / eg+d+0    ʩP0ְ0, LyA0tArAc5H3** d5**#'24d5 -LM?pD0 \`,0 G \$A0S Q00C!0e0 S1 @G#\$P0 p*<pᴠᶐ,0@000*0@ @|  *| @b D*<P@@HoF" **)#,2' -2LM 2Rp` l2R `2R #\$PH2H"p 0 00@0*2@ BŸ   @-8 0@? SO 1 R 1R" ʌ1R 1R T|1 @p1 p p 0 00 0 1R 41R0ASꐥ2222ĥ2ĥ222ĥ2ĥ2ĥ2ĥ2ĥ2ĥ2̥2 0P 0S0S? 2K"K,pKsH0 ,pK2K"Kk" ))#,2'*D "( -L@M`83? Q@ (3\ 3Q d3QA  #\ C0?p$P% W@-00 00 Rh)2  mŸ 8` pU 7l2P@ @    B<.%-(? 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&)V?G K5K-]PpPW 0"K0C "K St222222222220,`K2KT0000000S:T0,`K@KBK" #',2)Hd5(  " -t0tPL @`T0 0 q @ 40P 0(00C ` 0@ " *** p-QLMd@ P L0L 0 S `f-`p0` \"** * p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S )-pp40P$0P" ***4*0* p-LM 0@0 0`=P Pt0q PL#ld55X3xd5 -0@LQP U` UUh P>UHp  80  Q00CS0P#[5L## -0P@ LR0` Tp TThᲭ |V>T h@h 00000CS0z+f-1S P#[5L## 0-t @P0LS0\0@ &>0S @0=P%7  P7  08#d5" 0-x 0P@QL` 0@0 >Q @0P%7  P7  0$#d5" p-LMP L1PHA #< 0 㦤P`A1#<0 㜤P40$#< 0d PѤP0#L8@%͠   `` 00CS0p׫ L=` 4 (L# #"##2#2\58\5X\5Q Q Q-0 Q0 0L*P# -LM`0p 0 0S"R; RR0 R. R 1QA 0%͠  @匥000巤00CS0q,A$!00000CS0b ၬ0 $= 0K 媥 R0 Q# Q 9CS񟗹ꐳ2222X2X2ij2г2<~I@<8  P##L#2[5d5d5 0-l0@LQR RR R@P 0 40  祥00CS00hP#L##- 40,?0Q* B$*<  x) 0-P@L\ # 0S 0  00 S8:0 S B@0 8  0hP* 000))-0 0,B$ 7)) 0-0@P00Ld0000* p-LMP@T` 0* S0  Qpho0  ** -@LP p`Pxb00h4*0 \ 2 p-LM p0@P|`0SH  0000Sphh0 "L*x5 0-(P@L00h-"x5 0-L0 L@H8P 0000S0h:"L* 0-L0 L@/8P 0000S0h!"L* -LMU0@$2$"5 2 0"20 ( pH( g 1!; !!!  X0@0!<,= 1 1!1, K 0!#R00@1  S0C⠐81  @$0PP |2!$ ! ! U  @( 0$$ R 1 0+10 (,d004!p00>;   喜ěP<@0<0 ,0S , bN @PP p9P FK"4 0 9KoK "4 0t0   )\KE  j,-1 0$A 1 ! , 9` 2f5 -LGMdŸ0P0p @ p,0 0! 00X ,20S2}??009  uK@微0 k  L)'> 01 <S2; 0c00!^00>; HD  )P<@0<,0 S ,MaN @ 9 FK"4 0 9K_K "4 00   1,K:)01B01 i,-1 0$A 1 ! ,  P7`  2g5 -LM5p=@S`0P XIT# <S0S\9X9`90C`9 $  P $ P04<05_5;59S@T 0S0010C1,R"<P$ K)P@ P$ P $Qt00t0%*'00 5R!; @5@! -LM0 54<@SC\04̂5 h2t00t084 -LMP@`( l1T0p! CT1T2 L1T  p4W  5A0AS p505 0S 5 @ @  Y6 y4Pp9S"L00S@0T  \4Pp i i i ϖ1i -L Mp@Cd? (K 'T(K'K%@K#PK!`K&@K$pK"0K农P騡 L2g5 p-L M@?0P$` K " K 0K0KK0KPKPK@KPKeP[p醡 *2p0g5 -L Mp@Cd?(K 'T(K'K%@K#PK!`K&@K$pK"0KCPe  20g5 -L M@p`&@0(K  'T(0K'K%K#PK&`K$pK"@K!@K!PC 1Xg5 -L Mp@Cd@(K 'T(K'K%@K#PK!`K&@K$pK"0KP# 1Xg5 -LPp`@Mp @TT $h h1g5, !0-"(LXP@MQ @TT G0 10g5 -LPp`@x4  @TT 46@A%C("(4$He a1P|hb1g5 -L M0p@43PPE 0 #0Q1#.0S22222$2,2,2,2,2,2,2,2,2,2,22$# 3 1 #@ 9S 9S FoZ  FMN o"|2 1 v#)D p`"Z -D"f@2 1 `#@ "Y2 aC0I D@Oܑ JZ  -D!@1` : 6Z  , d!,h1 1 &#)D  18!Z (1 A0 a!P   0@ #)D 0U0 00 0 S  2 SB  #@  _ 444d4,444 4D4 -LM> @R P<)T<@ h 0-h0PL @0)3H<#()9S -("9S  0hfdh p-LM\00 @  P PP0[o@`  ph  -LM0@ 9 ("(  hT-<004S  9 l.    V_ 0-0 @L$8P0 $  0$0h   0-0 @L$8P0 $  0$0h 0-8L@0PP 5 ( "(  0hDP22222222222222222840,($ g5g5g5g5g5g5h4h5 p-LM K0@1[8#Y#h #͠##: 0P`".̄<\l0.  0.<0p -L`@0@# cTdTDP@p  @TTP /D4h5 p-LM`P\V@ V@@> L\R@ 0P@  4( @ ph 0-L@P,T T.00CS  0h -LMP c0@1 @T@c0>S @ cTdT  "dP9l0)Nl..0 N`H r< 0~ @pm !0@T`pڌ 倖P O 1 > 0 #PQ1 >0 PAPH41P-N @;  t墕 Q 5QN n   5;5%@ %9 S .  _ \.Y H@-4"VS(h5 Lh52Dlh5h5h5h5 0-@P4\5L=05U   t P;S ;S&0hi [d [[D p-.LM `/MN0P@| 0 +;++W0CQ  T 00HSAQ B00HS0 ph5 -LM`? (K$K(K^T@L0p 'KP#K @&@K%@K"pK!@K幕 ҔP2 0-@LR/̈́|P|0 0hK-0t  t P0P 0<0˄ ˄ $0 0hJ h5F H D 5p@-!L?@@1cTP  \0 0S0W0 0CR  P 0P00 \00S000p00h `?CT00 R 0S0 00 S 0 0 00P0C0gfffVUUUQ- -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 lP $000S$ 0040$0$40D`(00(0 6+X22Di5 sr-LP`p  0 $@T uv u 80U 0@Tv D0VW WP + +li5i5i5 p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@"*i5 -QLM@8 0C?. B"0, ,j5(j5 - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  h*40j5 p-LMT P0`@H \ 8  0$ P@0 8$8P <8V @ $8P@40 + }TppT0 p0h@T0 m0l0 T00T0| ` X08<#30$P 8T0@ \ 0 <$ 8P< 25Xj5 0-P(0L0=T0@08T0$P0 4PL0 0h) p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@@ppp p-LMT0@![Y$80 P8}`$8P0 4P ` tcVH0S T0  p8$;P8 T0hT -LL  -PP 00LR`p @$<0 T ,00@Nh, \00Q0S p-LMP0`, P@ @@0|[0Td0`[@P`dp 0-T0L @PP X0  v k _ U\0   B 1   X00H  00hHT 0@ T d00<0H 008T 0@ T d00<0H0 0(\0HT  0d0T 0+ \0T H 0d0T 0+ \0H( 0H0& X0H0& X0H0# X0~H0# X0sH0"iHPQ- -LMT0@h0S 0 ?C5A0P 0S0Q T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000. 000008P0 $4P0@8$ 4T0@@ \0 -P   006    0000000  < 000 006 000@006 000 0008P0$ 48PP0$ 4 -L>P ,4 p-LM@P`/  |((0tH0 L8 P`0 T0d  $8P4 00 X0pphX,4|j5 4 0-(0PL@ F 0ES 33L3@3 H0"S 00 H0"Syp H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 80 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4# 8P0 $4P0@8$ 4@ 000 006 @006  0000008$P0 4@ 0-@L8P0$ 48P0P $4$0 S8P0 80 -L)P P4 p-LM@P`  tw'(0lH0 L8 P`0T0 $8P4 00 X0pphEP4|j5D4 0-(0PL@ 7 0ES 3 3 3P 3 H0"S 00 H0"Sfp H0"S 8P0 $408$;P 80% }0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0 0,0P0@8$4 00 0,   00300 000 0000000000000006 -LcP 4 p-LM@P`T  t&(0lH0 L8 P`0T0 $8P4 00 X0pph4|j5t4 0-(0PL@ 7 0ES 33 3h3 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DT3@3@3@33@3@3@3@3@3@3@33@3@3@33@3@3@3 3000000000006006 -LM@E8$P 08 -LlP 4 p-LM@P`]  t%(0lH0 L8 P`0T0 $8P4 00 X0pph4|j54 0-(0PL@ 7 0ES 333D3 H0"S 0"&0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 000008$P0 4  00000000000006 -LP 4 p-LM@P`  t$(0lH0 L8 P`0T0 $8P4 00 X0pph4|j54 0-(0PL@ 7 0ES 333l3 H0"S 0X\0 H0"Sp H0"S 8P0 $408$;P 80% )0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 4000  00000000006 -LP 4 p-LMP@`  '$(0 H018L0P`0d 0T0 P2X!3SC L T0 @4H00-bH00@ [H&0!,SH&0*LH#0,DH #0=H  0ph5H+-0?> S$  4 T0 0T04|j54CP 0-@L8P0 $40P$8`0 88P0 $408$9P 8P$8P0 4 P }U8P0$ 40P$8; 88P0$ 408$Pp0 8 $80P8$8P 088$P 080 p-LM(0P`@ R= 5R pH0,S p5 8P0$4P0@8$ 40@`0d 0S`0L0`@ppR H0"SH0 S 8P0 $408$;P 80% 0S`X3P3P3\3P3P33P3P3P3P33P3P3P3P3X3L0$8P =8$8P 08L 06S $8P0$8P <8$8P @0L 06S $8P :8$8P 0$8P !<8$8P <pT0NL0;p -Pp@ 0`,@00L 8P0$4 P8P0$48 P0$ 48P0 $48PP0 $48 P0@$48P0 $4P08 $4,00,0 00300T   ; S 00000 + 000 00000000 00006600T0      004  P  P ; S00400; S004  00 0 p-LMT0P@ E$8P >8$8P <8$8P <8T `P08 $48@P$ 40@ `}VppT0  p0h@T0` 8 00 $8P >25 -LM 0T@ P  @%#,00R0S ? k5Z p-LM@P`!(0H0 L8 P@00T0( `R phr! $8P4 00 X0pphIk54l5 0-(0L@P0  H0"S0ES"3"3"3"30%0jp004l5 -LM@8$P 1<8 0-hLP@P   L5#?, 0 0 v P4l5 p-LM@P`0S   ( |H 0LP`8000T0 $8P4 00 X0pph 4|j54l5 -(0L@pPA H0 S?0BS%3$3<%3%30% ` V b80P$ 8 0$8P 8<@8$P0 4 . 56l5 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@  000 006 @006  000000$\ 0  P8$P0X 48$P0 4 l5 -LP 4 p-LM PL5 3S@`* L5 3S?  (0H0 P`8 0L T0 $8P4 00 X0pph\,0L0? 0L0 4|j544 0-(0PL@ 7 0ES d)3)30)3)3 H0"S 09=0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMP` 0P00,P08 $@4 ,0 0,0P0p8$4 00 0,  00300 0008P0 $48@P0$ 4@ 00000 00000000 006 -LM@8P0$ 408$0P 8 -LP $4 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph$4|j54 0-(0PL@ 7 0ES ,3,3,3T-3 H0"S 0^b0 H0"Sp H0"S 8P0 $408$;P 80% /0 -L,P H4 p-LM@P`  tz(0lH0 L8 P`0T0 $8P4 00 X0pphHH4|j5<4 0-(0PL@ 7 0ES .3.3.3D/3 H0"S 00 H0"Sip H0"S 8P0 $408$;P 80% 0 -PP0 @0 ,0L8 P0$p4P08 $4,0 0,0P0`8$4 00 0,   00300 000 00000 00000000 006 -LM@;$8P 088$P 1<8 -L[P 4 p-LM@P`L  t(0lH0 L8 P`0T0 $8P4 00 X0pphw4|j5x4 0-(0PL@ 7 0ES 23$231323 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 400000000@006 -LP 4 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pph4|j54 0-(0PL@ 7 0ES 538534353 H0"S 0LP0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 4 00000000 006 p-LM 0`0@P, 0?.AB"$(0H0 L8 PP00T0P0 $840  X X0 \0  ph,ph$8P04\m5n54n5 0-(0PL@ 7 0ES `8383,8383 H0"S 0z~0 H0"Sp H0"S 8P0 $408$;P 80% K0 -LHP 4 p-LM@P`9   0?>C2<0( H 0L80P` 0d0T  $8P4 00 X0pph^4|j54 0-(0PL@ 7 0ES h:3:34:3:3 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 400000000006 -LM@I<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -L6P h4 p-LM@P`'  x(0pH0 L8 P`00T0 $8P4 00 X0pphQh4|j5\4 0-0BPL@ S >3>3\>3?3 H0"S 0& H0"Svp H0"S 8P0 $408$;P 80% -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000B 00000$8P0 4$ 8P0 $4P0@8$ 4@ 000  @006  0000000068$P0 4   006  -LJP 4 p-LMP@`;  (0H0 L8 P`0 T0d 8P0 $4T   0XX0 pph]H'H' 04|j54 0-0BPL@ S B3B3`B3C3 H0"S 0 H0"Sup H0"S 8P0 $408$;P 80% -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 000 00000 00000000 006 -LtP 4 p-LM`@Pe  (0$H008L0PP 0T d0 40  X X0 \0  php$8P04\4|j54 0-(0PL@ 7 0ES E3E3E3LF3 H0"S 0 $0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0 0,0P0@8$4 00 0,   00300 000 000000S S000 00 000, 00600S00 000P08$4 00<000 - LN5 Ó0 ?0 0 PP 00(c5 p-LM`@P0 R %( H 0L80PP0 0d T0( Rp ph $8P4 00 X0ppho5O^p5( 4 4l5 -1`LQPp@V(0Q 0GS I3J3I3J3 H0"S "H0,S 5 `8 P0$48@P0$ 4@@ `0d 0S`0L0`@p H0"S0%  6O^78 4p5 -LMT0P`SPJ 000,8(!P0$4P0@8$!4p,00,00S ,0 00 P0$8 4 0008P0 $4P0@8$ 4@ 000 00000000 00600 O^784 p5(p5H 4p5QR*0S b R*0S -R0 0c BSR48 R p-@P`x BRpR0 BRRRR-0^0  R R0 R00-P@cbP L0 p-QL MP@`S K0 V Ks 0K Kp@rPp`@- a0`S@@BR0-P@ 0bR3 B1 010QP:  QQ0Q00 0cc 0S !1 0S 00S  p-QLM`P@S 0 8V pp@rP`&p`R 0R\ Q- *0 Q*0  aQ! -LM`pㅑ P@! P P @T00PU0S p@W l`FpGP  PH00PW pW`FZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0    4` `! R0-P@ 0bR03 B00O^``0 B`3`1`1c11c!0"b2c3c0acP@O^_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q444444,4D4\4l4 4 4 4 4 4444444444444 4 4 4 444 4!44"44#44$44%L4&L4'L40w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@ l @@ l @  88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx (!!!!!!!!!|"!,#"Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2006 OpenBSD. All rights reserved. http://www.OpenBSD.org  $ d14X444l14t14|1414@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U8 &-&-&<.&,#.&/&,#0&0&%,# 1&d n;0&AvQkkXaM~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@hu)))))))$))Ԑ)))) K*)W*))Y*[*\*_*`*I*`*)vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ-̈-p#T44X44d44h464 DA4DA4 l4DA4p4t4 |4444444444p 44p 044p `ķ44p p̷44P Է44P ط44P @ܷ44P P44 444444444 4ܷ4 44 4 4 44 44 4  4/54/5$4(4@,4(44484 <4@4 <4D4/H44oL4P40/h44p T4 4 4\4 d4\4 @h4\4 `l4\4 t>4\4 p4\4 t4\4 x4\4 |44 044 @44 `44 4\4 44 4\4 444444 44044@44P44`ĸ44pȸ44̸44и44Ը44ظ44ܸ44444444 44044@44P44`44p 4444444444 44$44(44 0444 8444<4@4H4L4 T4L40X4L4@\4L4P`4L4d4h4p4h4t4h4|4h444444444444444 4444 ȹ44eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0-$-#4 444$4,444<4D4L4T4\4d4l4t4|444444,444<4D4L4T4\4d4l4t4|44444$4,444<444ľ4d4l4t4|4Ծ4 444444444T4\4d4l4t4|4(4<44P4d4x444D4L4T4\4d4l4t4|4Ծ444Ŀ4п4,444<4D4L4T4\4d4l4t4|4Ծ4444$4,444<4D4L4T4\4d4l4t4|4Ծ44444Ŀ444<4D4L4T4\4d4l4t4|44 44Ծ4$44Ծ4<4D4L4T4\4d4l4t4|4Ծ4444Ŀ4ܿ4ܿ44D4L4T4\4d4l4t4|44 444$4,444<4D4L4T4\4d4l4t4|4VAt4̍3PVA4̍3VA4̍3VA4̍3VA4̍3 VA4̍3pA4̍3qA4̍3qA 4̍3qA(4̍3qA04̍3qA<4̍3rAD4̍3tAL4̍3tAd4̍3A|4̍3A4̍3 A4̍3A4̍3`A 4̍3`A 4̍3`A 4̍3PT4̍3A 4̍3 A 4̍3D 4 3D 4L3i 43 i 4̎3 i 4 3 $i 4L30$i 4L3 ,i 4L30,i 4L3!i 43 !i (43)i 43 )i (43-i 43Ai 04 3 -i (43Ai 84L3Ai H4L3Ai X4L3h4t4p4|444444444444444444 44$4,4,444D4T4d4t444444444.4 .4.4 .,4.@4`4.x44.44.4 4. 4@4.X4x4@````` ```444 444\4t44444$44H4\4x444444(4H4\4t444 4D4p4444 04 `4 4 44T44444 4D4l44 4 4 4 4 4 (4 <4 D4 p4 4 4 4 4 4 @4 l4 4 4 4 4 4 (4 T4 4 4 4 4 4 <4\4x4444444(4X4t444 4 4 4 4 L4h44444 484\444444404\4x44444(4L4t44444D4t4444 44`4444 4(4P4t44444404L4t4l44444 4 $4 P4 t4 4 4 4 4 44 X4 4 4!4!4!4" 4$T4$l4$4$4$4$4$4$4%4& 4&,4&D4&\4&4&4&4&4&4& (4& T4& p4& 4& 4&4'@4' 4'(4'P4'l4'4'4(4(4)4)H4)\4)t4)4)4)4)4*04*4*,4*D4*\4*t4*4*4+4,4,,4,H4,t4,4,4,4,4, 4, ,4, T4-4.4/404040440`404040404040 @40 h404141424243 44 45445P45p4545464748 48(48L48d494:4:4:4:4:4;T4;t4;4;4;4; 4;4;44;T4; h4; 4; 4; 4; 4;4;4;44;T4;l4;4;4;4=4>4>44>L4>d4>4?4?4?4?4?04?L4?h4?4?4? 4? 4? 4? 4? $4?<4?\4?t4?4@4A4B4C4D$4E<4FX4Gp4G4G4G4G4G04GL4H|4I4J4K4K4K4K(4K84KH4K\4Lx4N4P4P4P4Q5Q$5RX5Sh5S5S5T5U5U5U5U,5UD5Uh5U5W5X5Y5Z5Z,5ZP5Zp5[5[5[5[5\5\5\5]45]\5]5]5]5](5]`5]5]5]5]05]h5]5]5]5]05]`5] 5]!5]" 5]#D5]$|5]%5]&5]' 5](T5])5]*5]+5],$ 5]0` 5]1 5]2 5]3 5]4H 5]5 5]6 5]7 5]8( 5]9\ 5]: 5]; 5]< 5]@@ 5]At 5]B 5]C 5]D 5]ED 5]Ft 5]G 5]H 5]I5]J05]K`5]L5]P5]Q5]R05]Sd5]T5]U5]V5]W05]X`5]Y5]Z5][5]\$5]`\5]a5]b5]c5]d45]eh5]f5]g5]h5]i45]jh5]k5]l5]5^85^P5^t5^5^5^A5^B5^C$5^ED5^G`5`5a5a5a5b5c5c 5dH5dd5ex5f5f5f5f5g,5gD5gt5g5g5g5g5g5g45g L5g l5h5i5i5i5j5k 5k<5kX5lt5m5n5o5o5oH5o5o5o5q$5rP5rh5r5r5r5r5s@5sT5sx5s5s5s5s5p"5x"5"5"5"5X45 5X4 5,5@5D5P5X4X5d5X4l5p5X4X5x5X4X55X4X45X455X455X455X455555X4l55X4 5 5$ 5( 54 5H 5( 5P 5d 5( 5l 5 5 5X4 5 5X4 5 5X4 5 5X4 5 5X4 5 5X4 !5 5X4!5!5X40!58!5X4`!5h!5X4 !5x!5X4 !5!5X4!5!5X4!5!5X4!5!5X4!5 X4X4X4X4X4X4($5X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X41515z 15(15 015815D15L15T15\15T15d15l15x1515@1515@1515D151515@3D4595050505l15D4515HD15D452525a425D15 25u4tK5`D15025<25D45b4D15D45b4@25HTP25D45GC\25`2515l25D15p25 2525D1525HT252525@25D45b4@25 2525`CGCZ)IeI2525$35ZIZIIIIII0I0PI0T15,35I0ET15435]I0ET15435PI  I@35H35T15,35@"P35\3515-/d35p35d3535d3535d3535d35353535d3535 ")A4545u 045845P45 5@&o@o @o @  @& 3BI0E@I0EHTI0ET15435@I0ET15435I0ET15435 I@(#0Vwd3575d357575753585853585(85485D85Pttt3V45T85D85V`85485D858Vl85p8585V85858585D85V858585s859585$95oo PM095D95k&h= = s qPs&! qhl95t95l C9595 9595a(]/P;/8/9/d/680~9o:k;lL|=>@ApD FPQSTXY] 3 ["$&'X4gklrdK23<H///   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000vt100(000X0$0L0  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_ABCDEFGHIJKLMNOPQRSTUVWXYZ888????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?T1111A1A1$N58N5DN5XN5dN5lN5tN5N5N5N5N5N5N5N5N5N5N5N5N5O5XBBp@m@m@m@ f(  pt""(4I@@@@1` #UQFb '               <Ԃ1111`(111(1111ğ111ܫ11H13(1t11L1abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8 3R3 F3]l3&3IZ33J\3R373 3 (3 83 \3K633@#3333 33H@3 N3 _x333\3 3 3 3E3 3m3K3A43[3l303 33j33<1ܵ101111D1111(  v      W 1 Q `  (1@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   D1  L+ L 1L2 D   O  {1o  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9 01111 B  w W  1b0{&"=F@n a-88111D2X22H22@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0-2/202\12{%1" `s%p>2L?2B2N2 O2xO2XS2\Y2|k2l2n2 o2 }2}222 P Q@9@WPurl_int_miibus_readregurl_int_miibus_writereg:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,-MNO`abcd e f g h ik$%b(&b,'b0(b4)b8*b<+b@,bd"h"l"p"t"x"|""" " ")$+$-$/$0 2`22(2!A  !@@@@3P33hj5T 3` 3\2j5j5l 3x3,3Q`j5H3T3\2j52j53 k5p3|3\2(k55(k58333 Dk5 Dk5 Dk5 `k5CP|k5CPk5CPDk5CPk5CPDk5CPDk5CP `k5D"33"3$3%3\2 dl5Ðxl5(3)3 +3(33 +3l5l5X,33\2m5H.3T/3T03} m5}4m5}Hm51323\2dm5|m5m54353\29m5733\293:3<33?3\2n`o5@`$o5n`8o5n` Lo5`o5(B3C3\2!|o5o5o5PE3\F3\2o5o5DI3J3\2urlphy_attachurlphy_serviceurlphy_status  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.9RAMDISK#12 @(#)OpenBSD 3.9 (RAMDISK) #12: Thu Mar 2 02:16:54 MST 2006 OpenBSD 3.9 (RAMDISK) #12: Thu Mar 2 02:16:54 MST 2006 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/RAMDISK dackirqtargetlunsizeintrcontrollersocketfunctionchanneldriveconsolemuxconfigurationinterfacevendorproductreleasereportidphywsmuxloopbpfilterdrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl IBSSwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: Error decrypting incoming packet. %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wi_ioctl%s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=0x%x whi=0x%x Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: FREE(sta=0x%x) wihap_shutdown: sc=0x%x whi=0x%x wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) ne2000_attach: setup failed : where did the card go? ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s comcomprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : pxa2x0, 32 byte fifo (SIR)comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes version %d.%d%s %s: unsupported OHCI revision %s: reset timeout %s: SMM does not respond, resetting ohci, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command Malloc debugging not enabled. the kernel did not panic procscalloutallbreaksextentsmallocobjectpanicpoolprocregistersuvmexpwatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslinesUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangman/etc/firmware/%s, address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed arc4_stirextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocclosefkqeueplknoteplkqreaduser mapping failed kernel mapping failed %d init died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: unknown locktype request %dlockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myself lock type %s: EXCL (count %d) by processor %lupid %d with %d pending not locked lock type %s: SHARED (count %d)malloc: allocation too largemalloc: out of space in kmem_map%d,rwlockphysbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCFSTRACESSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCKPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsensorssensors kthreadsigaplpauseissignal procfs debuggingpid %d was killed: %s sorry, pid %d was killed: %s coredump%s.corehashinit: bad cntsysctlsysctl_disklockkern_sysctl%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%lld%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitfindlistquittimezoneverbose--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vnodevgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLsyncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputroute%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_crypt%s: %sassociation failed (reason %d) for %s %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) %s: received %s from %s rssi %d %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodenot in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u null node%s: no node for dst %s, discard raw tx frame %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d flags %08x 802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) beacon bigger than expected, len %u calculated %u%s: station %s power save queue overflow of size %d drops %d assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthreserved#13reserved#14reserved#15INITSCANAUTHASSOCRUN0x"NODS %s->%s(%s) type#%d %dM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %uMb %s: bogus xmit rate %u setup APL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeamarauazbebgbhbnbobrbybzcacncocrcyczdkdodzegf2fifrgrgthkhnhrhuidiliniqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamcmkmomxmyninlnzpaphpkprpyqarorusasgsisvtntttwuaukuyuzvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5Finalfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim%s: optimization changed from TIME to SPACE dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free pos = %d, i = %d, fs = %s ffs_alloccgblk: can't find blk in cylffs_alloccgblk: cyl groups corruptedffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizeffs_isblockffs_clrblockffs_setblockffs_isfreeblocksoftdep_flushfiles calledsoftdep_setup_inomapdep calledsoftdep_setup_blkmapdep calledsoftdep_setup_allocdirect calledsoftdep_setup_allocindir_page calledsoftdep_setup_allocindir_meta calledsoftdep_setup_freeblocks calledsoftdep_freefile calledsoftdep_setup_directory_add calledsoftdep_change_directoryentry_offset calledsoftdep_setup_remove calledsoftdep_setup_directory_change calledsoftdep_change_linkcnt calledsoftdep_load_inodeblock calledsoftdep_update_inodeblock calledsoftdep_slowdown calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): Sorry, no UFS2 support (yet) ffs_statfsupdate: rofs modffsinodino1pl%s: typeffs_write%s: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpathext2fs_writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedpwaitscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = BSEARCH number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p swapsysuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_mrouter_doneadd_m6ifregister_mifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fcip6_mforwardip6_mforward: ip6_mrouter socket queue full ip6_mdqregister_sendip6_outputassumption failed: hdr not splitip6_setmoptionsip6_setpktoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botch scp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d not found swapped out at %p frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08x p%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uK) %uMB cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**%s: IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufThe operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... %08lx -> %08lx @ %08lx cpu not recognized! OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap initarm: out of memoryglassbootfile: %s bootargs: %s ffuartbtuartstuartunknown option `%c' attempting to switch console to lcd screen %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs only the first 4,294,967,295 sectors will be used. scsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksscsi_probe_busPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260cd%s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasd%s: WARNING: unable to establish shutdown hook drive offline%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec total%s: not queued, error %d SCSI opticalSCSI disk%s %ssdgetdisklabel%s: WARNING: cache synchronization failed /usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %dpxaip_attach: failed to map CLKMAN: CPU clock = %d.%03d MHz pxaip_attach: failed to map RTCpxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO! addr 0x%lx intr %dpxa2x0_probe_sdram: impossibleWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_io_bs_alloc(): not implementedpxa2x0_io_bs_free(): not implementedpxaintc: Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_establish: can't malloc handler infocouldn't establish interruptirq %ldpxagpiopxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller %s: Can't map registers! pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN%s: failed to hook main GPIO interrupt %s: unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_set_intr_level: bad level: %dpxaost%s: Cannot map registersclock: hz=%d stathz=%d clockpxaudc: cannot map mem space : USB Device Controller : unable to establish interrupt %s: init failed, error=%d %s: cannot establish powerhook %s: unable to establish interrupt at irq %d: failed to map registers %d%s: Unknown depth (%d) apm%s: battery life expectancy %d%% %s: AC on,off,unknown, battery is undecoded (%x)highchargingCRITICALbackup power,%s: failed to create kernel thread, disabledapmevpxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO pxa2x0_apm_sleep: can't map OST bogus new frequency 0 for rate %d maxclock %d manufacturer 0x%x%sproduct 0x%x function %d "pcmciapcmcia_card_attach%s: error %d detaching %s (function %d) (pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized@ %lx%s%lx%s%lx; iomask %lx, iospace %lx%s%lxunknown (%d)multi-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus AdapterPCMCIA 1.0 PCMCIA 2.0 or 2.1 %s: CIS checksum failed %s: CIS version PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecified, ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x;%s: %d errors found while parsing CIS audio readonly powerdown irqlevel irqpulse irqshare io16 io8 bvd_active wp_active rdybsy_active mwait_required; maxtwins %d; memspacepcmcia_parse_cis_tupleSVECFD605 PCMCIA EtherNet CardV1-1%s: using CIS quirks for AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650DFE-670TXDLINKSYSE-CARDI-O DATAPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: no suitable config entry port 0x%lx/%d, %s: can't match ethernet vendor code : can't map ASIC I/O space : can't map NIC I/O space : function enable failed : can't get subregion for asic : unexpected I/O space configuration %s: couldn't establish interrupt %s: can't map mem for enet addr %s: can't alloc mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapter: can't handle card info : %scan't allocate memory for command queue ,0x%lx/%d: can't map second I/O space : can't map first I/O space %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler %s%s : can't map io space : can't alloc i/o space Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCM: %d slot%s pxapcicpxapcic_mem_map: bogus kind%s: unable to create event thread for %s pxapcicevpxapcicsspcic_attach_card: already attachedlcd_pxaipzkbd: unable to establish powerhook : PCMCIA/GPIO controller : failed to map %s %s: failed to map memory %x for scoop%s: invalid CF slot %dscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statezssp: can't map bus space %s: can't establish power hook zssp_ic_send: invalid IC %d zssp_read_ads7846: not configured apm_acapm_bczts%s: enable failed wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE disk%s: %s wddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifieduse one of: %s[a-p]parsediskrootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. invalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedwsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch3: giving up wsdisplay_switch3: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$u/wsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOowsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %s attach error=%dwsmdetwsmouse_detach: %s didn't detach wsmux: attach out of memory wsmux_getmux: no memory for mux %d rasops_init: couldn't lock font rasops_init: font table is empty rasops_init: fontwidth assumptions botched!fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedpre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create task thread usb_create_event_thread task%s: unable to create event thread for usb_create_event_threadconfigusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04xproduct 0x%04x%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected %s: %d port%s with %d removable, %s poweredmultiplesingle, %s transaction translator%s%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: could not read endpoint descriptor %s: unexpected endpoint %s: no report descriptor %s: no memory %s: %d report ids uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassCBIBulk-OnlyRBC%s: using %s over %s %s: atapiscsi not configured %s: command protocol=0x%x not supported %s: bus attach failed %s: isdata not configured %s: unable to get Max Lun: %s SCSIATAPIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: watchdog timeout %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemiiaxe%d: getting interface handle failed %s: %s, AX88172, AX88772, AX88178 couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: couldn't get ep %d %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk in %s: could not find data bulk out %s: no union descriptor %s: usb error on rx: %s udav, setting config no failed udavmii, read MAC address failed , missing endpoint , couldn't get endpoint %d , failed to get interface, err=%s udav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthrural%s: could not set configuration no %s: could not get interface handle %s: MAC/BBP RT2570 (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not allocate beacon %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_mgtural_tx_data%s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not write to BBP %s: could not read BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d nsphyterDP83815 10/100 PHYDP83843 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1000* Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1000S Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83891 10/100/1000 PHYurlphy: RTL internal phy %s: %s: enter down%s: %s: link %s  4ad'(p@@ @ @ <>4p 4x 4| 4 4H4 4 4O5 4 4 4 4 4 4 4P5 4 4 4 4 4 4 4  $,*&% #! $]]<55]]H5D5]]<5X5L]`]|5,5]]|5,5]]H5D5]]T5H5 ] ]T5H58]L]t5H5`]55H5`]55H5`]5d5H5(]<]T5H5P]<5T5H5]]|505 ]5|545]]|545]d5|545,]@]T5H5d]x]T5H5]]T5H5]]T5H5]]T5H5 ] ]T5H54]]T5H5\]p]T5H5]]|585\^H^5<5p^\^5&5^^5L53E^<5T5 3F^<5P5 (F^F^<5 5!43\G^<5 5!H3tG^5@5/|3G^5@5/3G^<5 5!3G^<5 5!3G^<5 5!3H^<5 5!H3,H^<5 5!3@H^<5 5!3TL^<5 5!3tL^<5 5!3L^<5 5!43d5<5 5!4L^<5 5!L^M^551M^0M^551DM^XM^551lM^M^551M^M^551M^M^551M^M^551 N^ N^5514N^HN^551\N^pN^551N^N^551N^N^551N^N^551N^O^551$O^8O^551LO^`O^551tO^O^551O^O^551O^O^551 4 4( 4h950h&``&(4!l   h L @4I M Q \W U V x@ j hw ] } G 7n`=5THIS is A memory TEST pattern4%K 4     D!T !!@!P!T!!T!!8(!<(!)!!@(!t(!(!(!)!!)!8)!)!)!)!!h,!,!-!-!)!!)!,*!0,!8,!)!!/!2!2!3!)!3! @ @   )h956! _ 4d" 4G# 45 4B!$ 4HG!, 4F!4F!4 4F!\4G!< 4G!D 4LG!L 4\G!T 4r!` 4|G!h 4܊!pd5I!p 4J!34 J!x 44J! 4LJ! 4dJ! 4O4T! 4Q!/5Q! 4V!X4\!pt4@!P4@! 4B!L4B! 4B! 4t! 4! 4w!K5w! 4lx!4lx! 4w! 4w! 4w! 44K!!4H! 4d" 4G#!4Џ5!45!4G! !4!(!4|J!x!4XK!|N!N!O!P!$P!,P!xx _ _P54a&4Г5$&4<5,&4̓58&4ē5D&4ȓ5|5_ ##$``!`!|!!PXH!!TF!`!PNl!RR!CE,!ST!NML!!CL|!0PL|!0RE!@RR!CE,!ST!SL!RR!CE,!ST!ER!CE,!ST!5T%5D!D5,#p5,#5"Ȭ5"5" 5"L5"x5d"5,#Э54#5 "(5p"5%54#ܮ5,# 5H"D5,#p5,#5,#̯5x"5 "$5"P5%|5!5,!԰5"5",5!5"X5"5("58"5,#,5%P`\55%5" 5"L5"|5!5,!԰5"5"X5"5("L`55D%5" 5"L5"|5!5,!԰5"5"X5"5(",5%T`5@h'"Й54 "Й5native-0,5@,"-$"-(-native-0,5T"--(-*4*4*4"|"" l# # y%R"4""%%"`w%u% %,% `%,+ " "H"g%n%,"""" $ l$<$ T$ \$ <$܊%%ȏ%p% ""\""G"8#"ܼ#" ""$"" """8" #$J#%H% % x~"ԣ%w%"""""""1+1+"+|;+ <+ >+"" 3+""p"" (;#"":#"""H"" J"@#"H% " 8$ $ """"- <$ $ܾ$" """"" " "" 7#l"t$" # `#7# <%4%"","%""hb" %$$$8%T%ȗ%"l8# """"""h"\q%" """""""""""p|%"""f.""""""",%%""""""""$""""""""0%T" +""X% 6+"l%%%#>+?+"H%"*"""""""""""""""""""""""L4#4#5#"""""5#""""""""" =+H" #" Д%" :+""" Tt%q%r%$x}%"%ܥ%<%i"j"@+\@+ $""""""" " p" " "" 1+$f"0"""Ћ%XS"%%"""2#"""""Pu"Xu"`u"hu",g"u"(v"dg"g"g"h"h"g"555أ55 05 h5 0 ""@"555 5 5d@B \5X4<54P54T##5 ##$#H#ء## ! t>4P4<>4DA4x>44>4a4>4L4>44>4_4>4`M4!4\4>4@5D&4hN5>4_4!4K5>464>4T:544\4X4X4#8$ $$ $$l $ $ $ $ $ $ $$$ȥ$4$$ttyclsttyopnttybgttyinttyout+$+$<,$,$$0$03$09$J$$0$,1$ # # # #J$ # #2$ # # # #J$ # #2$ # # # #J$ # #2$ # # # #J$ # #2$ # # # #J$ # #2$ # # # #J$ # #2$ G4(5x$(5x$&d&l&&H4|$$$5(5X$$X$ئ$D$ħ$P`3ffss)3ext2fs J*n3cd9660!t3msdos555T555<5̶555L5<5555 %$%2lockf@`  5T%Ȭ54#5e%|5\f%54#԰5%5%X5f%5%w`H5ܬ%%P%ı%|%%X%hK4TN45dN45 pN4<5 |N4h5 N45 N45 N45 N45 N4D5 N4p5N45N4ȭ5 N45N4 5 O4L5O4x5O45(O4Ю5 4O45 @O405 LO4h5 XO45 dO4į5 pO45 |O45 O4H5O4t5O45O4̰5 O45 O4$5 O4P5O4|5O45P4Ա5P45 P4(555,555D5p55Ȭ55 5L5x55Э55(5T555ܮ5 5D5p55̯55$5P5|55԰55,5X555ܱ55T%5%D5Ⱦ%p5Ⱦ%5%Ȭ54#5% 5%L5%x5%5%50%(5%54#ܮ5Ⱦ% 5Ⱦ%D5Ⱦ%p5Ⱦ%5Ⱦ%̯5Ⱦ%5%$5%P5Ⱦ%|54#54#԰5%5%,5d%5%X5%5%5%5%,54#w`55T%5p%D5%p5%5%Ȭ5%5% 5%L5%x5%5p%Э54#5%(5%T5%5%54#ܮ5% 5%D5%p5%5%̯5%5%$5%P5%|5%5@%԰5%5%,5%5%X5%5%5d%5%,54#w` 5d%%%h%devopndeviodevwaitdevindevoutdeviocdevcls5T%5%D5%p5%5%Ȭ5 %5% 5%L5%x5`%5%Э54#5\%(5%T5T%5%5%ܮ5% 5%D5%p5%5%̯5%5%$5%P5%|5%54#԰5%5%,5%5|%X5%5%5%5t%,5%w`5. .. 5T%5 &D5\1&p5d3&53&Ȭ53&54& 5$5&L5 8&x5:&5(=&Э54#5C&(5C&5C&ܮ5D& 5pD&D5D&p5K&5O&̯5P&5P&$5X&P5%|5%5%԰5X&5Y&,54Y&5Y&X5Z&5$Y&5[&5P[&ܱ5Y&,5% y`5 n&o&20123456789abcdef^^3333#4&Խ&#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@BC =D$E =F$cde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ p5Ժ5&p'd&x'&<'X4&5Ժ5d_4_4_4_4_4_4_4_4_4_4_4$5`4`4`4(`44`4<`4D`4L`4T`4,25,3(t("(#(0(5(`(D(<((T(5,^((d((H(((8(5Q(R(U(LV(5'R(U(LV(' (5`(R(U(LV()5)`(R(U(LV(5̾'R(U(LV(D'''5Q(R(U(LV(Q(i455X& dX55555}E#(D<8Q @X,5ľ5̾5ؾ5Ի5ػ5ܻ55555555555555552(@AAA==(A* dd%(i @@@@@@@@@(55<^a0^a55 5505H5L585$555`3`3`3`3Z)0W)<%)F)tL)l)5T%5L)D50)p5)5\)Ȭ5)5) 5)L5)x5X)5\)Э54#5l)(5t)T5*5%5̠)ܮ5) 5)D5)p5X)5x)̯5)5)$5h)P5%|5t)54)԰5)5,),5)5X)X5)5H)5X)5)ܱ5!),5%`a55%Ȭ5)5) 5)L5)x5)5)5̠)|5t)54)԰5)5,)X5)5H)`a55D%Ȭ5|)5) 5)L5)x5)58)5̠)|5t)5)԰5)5,)X5)5H),5%`a\5 ... ...*L**** *5555T%5-*D5b*p5b*5c*Ȭ5)5c* 5d*L5e*x5@*5,C*Э54#5l)(5t)T5%5~*ܮ5j* 5k*D5m*p5w*5z*̯58{*5(*$54|*P5%|5t*5*԰5)5,),5*5X)X5)5H)5X)5|*,5%\ba`55%Ȭ5)5c* 5d*L5e*x5)5)5~*|5t*5*԰5)5,)X5)5H)`ba55D%Ȭ5|)5c* 5d*L5e*x5)58)5~*|5t*5*԰5)5,)X5)5H),5%Xba5L*h*@**d*X*<*L**x* \55T5`+4+D++ ++,+,e+,+(WEVrdroot2.5M@WEV  08D/<  iD8d@`  /mntp,"22@@<@`bT 08iD/<  iD8d@`d]@@<@`bTU ~D`  PT`((((((((((((މaA lD~D,~D,)DAlD&DpDSu pDSu MA lDrD6rD6$7AlDrD4(rD4(ZAlDlDlD6]AlDlDlD-0AlDlDlDTVAlDlDlDSu hwAlDSu ~Dߢ~Dߢ ClDSu lDSu lDSu JAlDSu lD !lD'VAlDSu pD&DpD&D!aAlDSu lDSu lD !(eAlD !pD!pD!bAlD !lD'lD'>#AlD?"rD)rD) @AlD%lD%lD'WBAlD4(lD%f)lD%f)ClD(lD(lD(qAlD(lD(lD(jHAlD(lD(lD(8VAlD%f)lD%f)lD%f)1aJ=xmD("oDf6 ~D,X`hpxH /rDpDV2pDV2 G!qD*.qD*.qD*.={!qD*.qD*.qD*.Ę5J!qD*.qD*.rD):!qD*.qD*.rD +ۘ!qD*.qD*.qD*.V!qD*.qD*.qD*. $|!qD30qD30qD30il!qD30qD30qD30p9^!qD30qD30qD308!qD30qD30rD7')R!qD30qD30rDοP1n!qD30qD30qD30o !qD30qD30qD30VK!qD%1qD%1rDdXc34!qD%1qD%1qD%1V4aqD%1qD%1rD!qD%1qD%1rD5̞:aqD%1qD%1rDGǚ!qD%1qD%1rD}aqD%1qD%1rD ,!qD%1qD%1rD$jZaqD%1qD%1rD2G k!qD%1qD%1rDhaqD%1qD%1rD#/!qD%1qD%1rD"%aqD%1qD%1rD6|!qD%1qD%1rDwaqD`1qD`1rDR!qD`1qD`1rDeaqD`1qD`1rDks!qD`1qD`1rD<aqD`1qD`1rD`[!qD`1qD`1rDKzdaqD`1qD`1rD {!qD`1qD`1rD ZZaqD`1qD`1rD jR;!qD`1qD`1rD QaqD`1qD`1rD ]T!qD`1qD`1rD +6caqDV2qDV2rD No!qDV2qDV2rD *"aqDV2qDV2rD kn !qDV2qDV2rD 8e8aqDV2qDV2rDv!qDV2qDV2rDaqDV2qDV2rDX!qDV2qDV2rDtaqDV2qDV2rD5~!qDV2qDV2rD`YeaqDV2qDV2rD #!qDV2qDV2rDe&iaqDV2qDV2rDDL!qD2qD2rDaqD2qD2rD<!qD2qD2rD\aqD2qD2rD!qD2qD2rDK)aqD2qD2rDȤn(!qD2qD2rDsNaqD2qD2rDhv!qD2qD2rDgw=aqD2qD2rDQbK!qD2qD2rDaqD2qD2rDG!qD2qD2rD$aqD#3qD#3rDzG!qD#3qD#3rDd+aqD#3qD#3rDVh#!qD#3qD#3rDG[u aqD#3qD#3rD{-!qD#3qD#3rDV aqD#3qD#3rD& !qD#3qD#3rDgaqD#3qD#3rD!qD#3qD#3rD;UaqD#3qD#3rDcLE!qD#3qD#3rD )aqD 4qD 4rD!qD 4qD 4rD~aqD 4qD 4rD-8!qD 4qD 4rD'|aqD 4qD 4rD4?z!qD 4qD 4rD^waqD 4qD 4rD f!qD 4qD 4rD 4MaqD 4qD 4rD!qD 4qD 4rDzѵaqD 4qD 4rD!qD 4qD 4rD*!qDA7qDA7qDA7<3!qDL8qDL8qDL8(&!qDL8qDL8qDL8(!qDL8qDL8qDL8(n{!qDL8qDL8qDL8(j!qDL8qDL8qDL8(O!!qDL8qDL8qDL8=1t &!qDL8qDL8qDL8"!qDL8qDL8qDL8"ӨrD6IrDrDm:UrDrDrDX ` h p x P1)rD !rD?"rD?"OArDDp#rDDp#rDDp#hlrDq$rDq$rDq$/tmp/disktab.shadowD rD%rD%rD%/tmp/fstab.shadowŴrD'rD'rD'/tmp/resolv.conf.shadowԩ rD4(rD4(rD4(/tmp/hosts3k rD)}D4(}D4(6f~Dߢ~Dϝ~D+ߩ~Dg ~D ~D 6Xh~D7'~D("~D("PIm~D~D ~D+~Dcz~D!~D+  Ԣa6s~DDp#~DR*~DR* : G0(zȃ7JCF1r! C?*`ң)V?Nu6[{`VMcp+byڹ`W&\6ry(- L0`L@i}HB="`0F*Vc/fRGmc{7~:7:5>D rKKqO1*ARQ$kRStVq) [Ӽ2DI4{I1Oi@%Їp:BV}3d)(GN]:vm%,<LHI8_QDFa$g}AlsaͶ0|'IgaOl_ Ge-=N _RWHƑ*L̮bAR,S|`ed*:'CviLZi+%{eby3cXm8KS@~Wc2u=A0u &ؔ<&$ L3lY Hr@_Rmѕo[ɑ BP^֟(]~USTij_Ob`ﲈTny2.|,\"Jrzg%)=NWJrֺU$K\Vfz\nZGHAuxB7de7J jPYgmK _PxU'^r2ʛ%/h{Y+ &v!@›w((O'wNVkb`4RksSe#X3p_&yH$=FR;(D$A H,Š;rQ55] G^\+_E6ka7ML-x}T+"Wz3+V>wd ![$mp\ ݀*cZ%!_@pGBW>utFl1xqĪ r.m~|uFA]lO^DA;~qtC#G:M wr[59ࡊdoz.߬<1.)ϫc MArIvۙ 1|Me?a|'Έɧz=_+mϋfvs vQOeΠ)Ӭ$/eI rb֜8_p7$Sx9ZQ/)o" h'$K ^3;IJ //]G`n9YXքvs~zQ$V(^;hzr^)lְt#P;2 (h茮@UͿIGpՓ8)sbS=F't2V_ SDZ% sJȟx;vAQ)]qN⠏H$Br#%8p+a@T'R_,RПr8[!ک\ǟ%,!].t4yJ P)UrHYr 18p(j٠p9!һD=}&o1Vq. 1dUh#uEN-l^^6@DÂi/ P0_)]D m ,o!!p-e[n3&R *^larr:8FhJW-   . .. catchmodochgrpo cp dd df edexprohostname6 ksh sh ln lsmkdiro mtejecto mv pax tarcpioo rmsttyosyncosleepoip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  . .. pppfirmwareoɢgroup6spwd.db protocols)services) disktab fstab* resolv.confL hosts* ... ... ... ... . .. bin dev etc mnt mnt2UN sbinUN tmp usrvarinstbin.profile) install.mdupgradeinstall install.sub . ..chownodhclient6 disklabel6dmesgofdiskofscko fsck_ext2fsfsck_ffs6ifconfig6initomknodomounto mount_cd9660r* mount_ext2fsr* mount_ffs6 mount_msdos mount_nfs6newfso newfs_msdospingoping6oreboothaltorouteortsolo$umount ... . .. binmdecUNsbinUNshareN . .. ftpgrepofgrepoegrepogzipogunzipgzcatolessomoreo\sed . .. . ..ztsscale6 . ..miscUNkeymaps . ..termcap ... . .. tmp db runemptyN ... ... ... ...ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 random wskbd0 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 M xf86 c 2 4 600 M reload c 2 20 640 kmem ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; pci) M pci c 71 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; hotplug) M hotplug c 37 $U 400 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 R uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 hotplug ptm R local wscons pci iop0 iop1 uall tuner0 radio0 audio0 uk0 R random lkm tty00 tty01 tty02 tty03 apm crypto pf systrace R wd0 wd1 wd2 wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: dialer:*:117: nogroup:*:32766: nobody:*:32767: Xrwd1hoYwd1ioZrwd1io[wd1jo\rwd1jo]wd1ko^rwd1ko_wd1lo`rwd1loawd1mobrwd1mocwd1nodrwd1noewd1oofrwd1oogwd1pohrwd1poisd0aojrsd0aoksd0bolrsd0bomsd0conrsd0coosd0doprsd0doqsd0eorrsd0eossd0fotrsd0fousd0govrsd0gowsd0ho . ..MAKEDEVconsole tty memkmemonullozeroo stdino!stdout"stderr#ksymso$drumo%klogo&xf86o'reload(bpf0o)wd0ao*rwd0ao+wd0bo,rwd0bo-wd0co.rwd0co/wd0do0rwd0do1wd0eo2rwd0eo3wd0fo4rwd0fo5wd0go6rwd0go7wd0ho8rwd0ho9wd0io:rwd0io;wd0jo<rwd0jo=wd0ko>rwd0ko?wd0lo@rwd0loAwd0moBrwd0moCwd0noDrwd0noEwd0ooFrwd0ooGwd0poHrwd0poIwd1aoJrwd1aoKwd1boLrwd1boMwd1coNrwd1coOwd1doPrwd1doQwd1eoRrwd1eoSwd1foTrwd1foUwd1goVrwd1goWwd1hoXrwd1hoYwd1ioZrwd1io[wd1jo\rwd1jo]wd1ko^rwd1ko_wd1lo`rwd1loawd1mobrwd1mocwd1nodrwd1noewd1oofrwd1oogwd1pohrwd1poisd0aojrsd0aoksd0bolrsd0bomsd0conrsd0coosd0doprsd0doqsd0eorrsd0eossd0fotrsd0fousd0govrsd0gowsd0hoxrsd0hoysd0iozrsd0io{sd0jo|rsd0jo}sd0ko~rsd0kosd0loɀrsd0loɁsd0moɂrsd0moɃsd0noɄrsd0noɅsd0ooɆrsd0ooɇsd0poɈrsd0poɉtty00oɊcua00oɋrd0aoɌrrd0aoɍrd0coɎrrd0coɏwsmousewskbdoɑ st0rst0oɓnst0oɔnrst0oɕest0oɖerst0oɗenst0oenrst0əttyC0oɚrandomɛsrandomurandomprandomarandomwskbd0ɠ apmtapmctl . ..chownodhclient6 disklabel6dmesgofdiskofscko fsck_ext2fsfsck_ffs6ifconfig6initomknodomounto mount_cd9660r* mount_ext2fsr* mount_ffs6 mount_msdos mount_nfs6newfso newfs_msdospingoping6oreboothaltorouteortsolo$umountdhclient-script dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi _set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos MDXAPERTURE=2 ARCH=zaurus md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf echo $val " # see ztsscale(8)" >> /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P ELFa(t44 (ʒʒВВВffyy$$u 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 xg/ P000`P`0 R ^ *0 0 Q P:00bВb 0S SX 00-SL@  @1S@DQ@Dt @Dt0y -LM$@0S0Sy -< L04S0 00 h.Ԓp 0S00ؒ -LM`pQ 0S5/Qp@PPPQ 0P Q088 8Q  ܒr,r p-PLM@@P` ph 0-@L PP \X 0OSP8  (00SPXܒ4r,rT -鸢帒<LMP000圂S0: ZpP=xw @T` 8KX0  \ , (Ÿ8 # RŸ8  0 8 =0000S0A  10S000 B jX 1p0S0 Sl+ h10S X1X!0T!0SH!@1  !8 700011000S `R PpU<0pd @0S 0S  0<W @0S 0Sl <`$$tuu0u `u|uTTXuuuu -LZ 00 -LO0T -LG P00P -L<0  -0L0000 -0L000 -Lp08 -Lh0 -L1<$v 0-LMK PKp@81 0[W  R@ 0b0CS$,,,,,,,,,,,,,,,,,,0D0E0J0AS00 0xS S *S 0S "/, 0 $;0 ;0,, ?R0S@p @&0"Sl 0<6Y000 LPH00D 0oSP %6L\yty|yyy -||LxM@P`pd#apA P0@$S3th`p2`2`p22qx2 Rl2L2\"0QQ@c (2 R}`KB0PpP0S'pW PU `@UP@Tjo U P1 R  \W  j{$0pS `K@P40: S S' A?P0 R 0  DWP pjO0S  D PP8PPLP}<;5y$cpyz z,@z\z -LMp K/@T` P P@ Tj_ 00T 0-x0L0PS0@Q  P 0S(0 R00 R0$ P-L` 0S4nS 0@ ,3P@l0PP@p` ,!Pp@0oS` Oz$ -蠟L0S 0 R0 R  / X @ Pp`0DS 0 PUjOvP D0\j/T0 'joj@>$ p-L M `K P@0s  冀p鄀p$z -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 W2  B 0R00 0`p @T T( (4 Tv Tt( (Te Tc(0(,4  0" Q ZP@E10 )Z/  p l1 R/ @pTg' Z`PT0   P@0  PTo  `P@0x P@Xq(0 k( f( 4 { 5Y@AzzzzdF -0LMPpP`)0 R @;$0  0 @0 R |W@ $0@Tj_\{ K$K+@@@$00 zz{{${<{D{ -1L4M`, P!10 00 @,0P 1PJTBp< AH0`JZ/ 0@K 0\@`T9 T7 ' 'T) T' ''T T '' 0@K,0<T00 Zj '0 ' ' 0P@0  0PKY@h{t{{{{ -`L@PP pJ0S p%9Ppy, -LM`@P0p_$ P@ \{0S T ڿ0 $$K{{ -0L ~В{ -qLMʠ`0 P6 \P0d .40( 8%P<(@dl @ed, 0C0  $H0QZ Tg( Z c(D x T D(| -HL M, 0 [PnP #1RL0S @D@030(&Pp g@&B`@&v#,Pc P 00 0b0  0 0$ D0QZ T (,Z (D S D,| -AML ML6 DDf@Pp, 0&)]pq ?0@8Szꔶص$<D5 WPp0S HP4 R>:P42Ptp4 8$ 0@bT<4 Q T Z\ P`+ P  PP 0SP(0  P7P<4 08$ <4 jP<$0R08$R0S <P 8DDPP B.K B B(vP@ E4Pzpy0S KBK@@;+P 8$RP@0DP@Tj_0T,2 R  08 $dP8P1 RbBKHH}P\ yP4 ,P0 + 0  P P`t 04D000$ 04| 04T  00TP` ;0P` P P |P P`x0 lNK (|c$}4}uDxxp<}@}H}3\}l}x}|}}}q}}\z y -PLMP P` @ pK6 80S@@{ 00S00ǼL 0-P@ 0LSP  0S0S0 H -LM Mß'}KpG` pG , P@ }Pq #T@U h`P 0S FPP @KA <0A؉  3) 0QqA9  {9@X L][2 ,0S ,{9@T,p@R P. A?KAA p{P9C42 R uOK9P|P 8 J |aMK@D0 @D!&@2zw0Sp {0Sw0S * @{8{uK8P-]KZ P]K  P@U0 RwIKA 0{PA`<0StPP@) 0ITI  y D$!~~~h(~4~D~l~t~~xxq -L4M⠘在T `D0, z 0DSpH  TTX' R  08S08pW $z @TP 0S T 7p DW7' 0z0WS PBO0gWpW' 7` zzP h7Qp`' 47W0 kz  p 7 W$'`z @ 6pW'Uz  p6W&Jz0S   R |6pWt0&:z0S$ $  R <6pW4`0\&*z0S( (  R 5pW 0 &z0S, , R 5pW0% z0S0 0 R |5pWt0%y0S4 4 R <5pW4`0l%y0S8 8 R 4pW 00%y0S $pWH0%yL yP yT y4Wy ,0S ,弿0SR p44W($(H-P0 pW 4p PTKPK%p3PTxWC@*"0($(Py P)0BOSl "l Rp^ X3pWßL0#Poy0Stt3P p3W#0^yp| P_0BOSl Xl RUp^ 2pWß0 #P@y0St t 2R P2pWH0"/yx0 2pW "$yx0 1pW"yx0 1pW\"yx0 1pW4"yx0= pl1lW"T4pJ PBOl0 $1pW!xl0 0pW!xl0 p0W!|% P 0BOS 0 p0Wt@!t0x40H@KLKL0 #000Kx  px ~Hܟ~/d D~|}~~~~~~~~~  (8DP\dp`K|00`Xx x -LM` K&PUp@  PP T P UjO 0 0-x0L0PS0@Q  P 0S(0 R00 R0D P-L` 0S+nS 0@ ,C P@┸l0PP@p` ,1 Pp@0oS` FzD -PLM`p 0SPᠸ @ @@\PP 0 p#F$ -LM@p`PC Tp KʜwP  0S -SH0=1@ !@! P 0@0@L, -L M$$@$$$ $0@ㄲ0Xt؀ p-LM@ PP%P'vPP  Pp Px P` ` PL P @ 0Fpp$Fp|}x}(| p-GML`1 M Xa T!P0@4 8!Vp ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 ExP# $04 04 =K 0C/PsPx Pl s0$L*-P@ 4Eٱ pcHc,|(8 y -L0. ñ\ -LM`PP( @(K,pK 0  (0@StE -L M0@p00 0Sf vPP 0S nSW = P0`0@Q P QIQG  0V0P . 0' Y0  0000V 0`0 ,K, ?R0S@p @s0"Sl 0*Y000 LPH00D 0oSP *L\yty|yyy -Lr -ML M .0~`P,0 -sUp B0@3S`lP$Pl8T|XX= <>L! P  P*< P  ,< = =XLP d x=,L P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C pp   InK`F`F2P@ $`DY0S 4: S < 3DMKHHș@ ( m Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80lS( X00R00S7 P 0@ P 10135:3P  X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A Д0AP,  6X@JP dV000TU 3 5#:,P( {0uV00X@6h1h ? g6``U 0#5 %* % U UU 4S X0 4  \ P  @Fؔ  YRJ^   ;$X T \% P ؔ PY0 <U U%1 ATE Uc cc!Xe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx ' <%!q0`J  0  5 SP L S3 p0# U Ugg Ug gg X 0H,଄  <Ja ` 0] %P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 B4R 00UV `Pr4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,囸 ch'L' (ȄԄ`,@HL`p aap,Ѕ4 DpȆ<`d DT 8LTX\dhltxgfffT\d|p؃<T`NK@QNK4@@4  宲P  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $$2p ܤ P%0W^  Pd \0#03\030"S3  `QIP,<"(PK0d1P ^ U * X  PQ ܤ Ap 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5& !0S66TQ$0 N0o00  e T ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$]$ 0> 40Q3?V>d8U U Uʠ 5# V:%V#G?U8'L40S@.ccT5l P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 PBNK@D@D*5 P  p$ e E-Pa4: S ܤEnK`F `F @P0 o  %]#`\d4S: 8j\d4S0 T([44 嬄 D D ~gF -LM@(KP`5  "Ppp0W0* R00S 0rS`Fv (P@ P@Z`F (00T P P (0vj?(0 ->(0 T0"딇l} -PL`p@aPDP @T:T @2 " -LPgM/, `NsPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  "00Y00S ,0S 0S 0S $0S5MK  pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,a0 {$, u (l oX dP@ <4n0 ̇edAA@a4D -LMp#nQ5Q/nQ& n,Q0S h>4 0nn`8|@|PPmhm<Q@mLmDm<m4m|Ј@؈܈ Q-0L $ Q*  ! -LM`@puj $KPnj0S0S 0 !$0 UR#U, p-LM`PU@ T<PP UTUpT8- 0\ \8 0000ӑS^ 0 ^0 Br0 BS 0r0 -ALM3 0: 058 00 0+ 0& 0t! 0d 0T 0D 04  0$ 0 0 0 0 0 0 0 0 0 0 0t0l ߧLԉ$8H\p̊0DXp -LM00`Kq@ 00 p7PPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K PP@ 40 R0 0(@; ;P0 0( dP 0L;< 0pPPxȓ P-L    < 0-LMt@ 0Pd3lQ i@i 80h&l0(0 !l 0SꤋT -LM0:(0 CP0( 0S(0 0 (K  kPP) 0S& =/P`u 00,pK N0cSb iSI lS> oS& A0S 0S 0S(0S*P0AS, [0 0S0 rNP,00 0oS P ]N,0(0P,0 0 0P,00 0iSP0 T=N,0$0XP,00 00.(0p긌Ĕ̔ -LM `P0p-S000P(K 0(P P@  0S 0 Q (|:ww:r LP D0h0S $ "-,0 0$  -LM@{00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 ^0 0`t -LM@<yh0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@ 2h0 0 -LM0@S  h: 0 << 0 -LM@00$08  0 0(0-K 00 $ 0g@+$ejh -Lghs -LM K00"PZ9tp - LPL9nt | - LP>9ot  -A0 LR`P puPJ RDA R phP3 RA R p[P R@ R pNP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p 鼌0ԏ8 -LMl \, P`p 0LSD ( iLg@4gT 1 iW%X  @zW $8W8zW $8qWh8hW H8_W $(8VW00 NW $7EW@ $7<W  73W  7*/W00SW $ T7W 47W 7 W 6W  6W $ 6@W  6W $l6W@ $L6W ,6W  $ 6W 5W  $5W 5W 5W00 lWP5W $05W $5wW 4n@YW00cW4ZW $4QW@ $l4HW L4?W  ,46W$ 4-W 3$@W 3< S S 3$ W  |3W $\3W  <3W  $3W $2W $ 2W: b0S Q KdeW " @ ^ 0K0 P"  XK 0SXL1 ,0S ,嵭KeKddKda0S @K00!d 0Sn}i S  Selhd`oI 7 @rg4mg( ig ؙȗؗ$4\Șؘ0Ȗؖ0Ptx$@`pЙ,̕ܕ,DTh4<DPhx 0-0P@0LS 0@0700 0-|PL0@S d0df00 0HS@f4f$f0000, -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 3 -LTM\ X3XSp`| , xp p <R|0d |0@0T #|Epa@ P p0| `Kx| t Pxt KPJ4K|x P}W   |0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,@x Pf x%Pl75[PP|0 |(1  0P x@cc0l0  P|0|035.t  f~pA|@Px :p7 P4H lpt@ht@T gtؚ̚c, -0L 㶠В  -rLtM@P`!EpF@; -P4`1`1`00P @a 0T Q $T 1@KᬆP`  _40: SP  0`S9D T 0$ (p0h ,, -GML M1嘁\$ `@pL x1x!t1Q0T*IKAP4: S 81 R 8fP1P e$0 S $a0SPP BNK@D0 P$ P`1:a?00 teIKAPP0 R4: Sva000 (1L ,,$ -0L 0㠟В -l6LkM `P`ȑ ̑ , H&Cp ?0@8S񟗏`t$,HX`@%0000S 5 0S$00 0S 0S$00 4$$$0S \401 ~\$DDT0AP 0 R 001 l$3$$ c$0S #0#SaPa  0R000 U ڌ3 R l3l 0 R @hshßQ 0@P fz00#0CS<dU^ P  ᢞUQ P 1 UF P@ l2\ tM 1Tj0ES+1 U00R00S  H@PP P  g2!i P1 R|q/KP?0ESU4!R,, @e/  P KP} }Ke/ U   *1S> 0S::0*0S'0`2 ܸGcEGGooE|GEpoGEdEK,md -LM`@P`YP@ Qe/; 0S \ 0/S, p 0pP0S \ 0/S p 0p0V$000 0  h2Lp +$p + pEkܟEG -3LiM@3T,  ` C11113 ,0S ,w 3H00 l3 R \Q0 0S  [00RS (0s&0S! CMbXpDE00CS0X0ӤX0 PpP B00CS00Ӥ0 PpyUYUp20Sh 0SS x2 R@0S 0 S! L q/KP8  Q'q/K@ A P  T20P |0S1Q A B20P j_+ 00TK` 0PaH  LP^0S }^0S H  nQMKe/ 4!41Pe/ ~WpT_l0 R#  Px㏜E G4tWEVoEd GoEmdLkET\fdHgd -LM@)^00CSD&d&d&d&d&d&d&d&d&d&d&d&d&T&d&\&d&d&d&t&0h0$  bꬺ,d p-L M 0@Q`Q,㈂ P*@@0@ 0@@d 2 09R @ ^ 0S0  R@ @ ^ 0S#  R@ @ ^ 0S  R@d0V@    PR@p4)0ppP4Uػ -h2LM Rp P2pQ 0S  [00RS P?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / ܗP80BUa ,P 0lP 0S 0ڕX څ!,L, D 00Sv Sj ,$$"4Q 80!R,00CS0, 0  ,0, o .,0 8Q  ,008P,,00* C R +, 000 08@$ @,`0 08P,,00* C R , 000R,-0R,- ,x5 L,T80a ,<$gtġ Dо -LMZ0, #00 00pӑ Y33`   Rx3x!t0d 0P Y ( <, 00 $8 4 <  m+. P@זPtB Z 0 Y  0 Y&. P@ÖP[B Z 0x $hY (XP2LL"8@To0, 8@T$$$|P xT t 0W@ \0 BS@TZ@TP@\ x^PU@ +T0 DP 4K0( -X0 00CS00  ä0P ,L 00 X00 X0o $0@ThԿ00DTh -LM@0p8(0 pP P@| 0 0!0'|PD P@\ o_Ke/H P AP`D e/\ PP3 DA@[X`D00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnU\(0 S (剡2/T\pX4\T +\<%\ |pKd , 0-LM$PK@x,@ p1P h (K`1pH (00  P@W 0#S[(0,0 |y,0S0 (,PKٛ  [p , 0BS W0S W0 S4[0$Y|l~, -LM@_X0S@4 -LM@@W000S 00HX0S4 -lL M@p` \ |0 0  Rp P00 0 `` -AML ; MBK@$ I:I8 , 00 8$孼P  7P00 PP :P`` R 00L`P1V4k ,p(;P` KK0C 0C00 {)P4V4 P 0S44X0PH`~0S440044 PV 0So0S440 g0S  440@40@4 A)VP+VpPh 0Se BNK@D@D 0*04S\  4 44!\0PpPL W00R00SB)B~KpG pG z<P 8V`P )*PPBNK@D@D0 044 S;;S(  04(@40@4 PBNK@D@D0 044 S,  0(@@ PBNK@D@D0 044 S8  0\(@$ @$ LP BNK@D@D0 044 S0P BNK@D@D0 {044 S4P BNK@D@D0 i044 S<|P BNK@D@D0 &W044 Sptv8iP BNK@D@D0%D044 Spt~VP BNK@D@D0p%1044 SptCP BNK@D@D0$%044 Spt=`0P BNK@D@D0 044 SPFP a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S P #@T:q30  00S044 i04S44S '044 0< 0<$ @T6 TV* tP `D4<$P V ePD4` u<$4 <4V TL"D4f<$Pa']'V ?PD4` O<4P~ V 0D4 B<$4 <4P m D454 <$0aC1 0 +'@@ ]$'@$ @$ k,0 @qS t,۝ d'@40@4 /8'@40@4 ')$ BNK@D@D0 044 STI440CSpבxʑ&@ @ ( 8<TX Dda ,<a@L\h|ġ8T -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (PaPY (PR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 N&PUF&A&<&< 4& /&8+&'&x#&l&`&T&w&<t(P,@`t -0LM pR` 0(MWP @0a SPU@W0X0 S000 S S @@  %p 00  %Y kE -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 (  0S Z  -d1L(M\@@K @ Dq0d4Q@K`@@ 0< 0C 02 0 H 02 00.     c  5 0pB 0`XX   ,DLP(h d82P *0P ": -MLM N~KpG ) e/9 , "Q   P {PX rP 4) KA  BA .K B B)   GP@j(K0PS44S R(K0S0( K0@4@44 @@ @\4p*S:\4 X4(KS:X4 0mKS(K008 Re/뎎KH:  ; *rP 00CS00  ä0e)(K00qP@ P 0@pSAe/:Z  4 1 0) {Z  &  #   .v7 3]UH0| @P3 RLZ )9D e/P< tCtt#tPP  R0000ӑ yS0 R000ӑnSU P#00ӑyP p2 ,0S ,t  P@ "e/P PU fP@  0+0S $$DPP0S e/nPZ  POKe/e/{e/w Z n |81 RPZ  )9 e/=P   aPM -"Ke/He/D ,m#* `$ d$ AH DrdAPxpзl%ox8$KLdx(L -ML M R, p0 @ S a`BV00?V p ,0 S ,劘0S 0S8V08ǡ8סPV08ǡ00000  SV4 00 0 ; 0  P@` :0Sg  @1^:0^0n005:0 S0S  0 P<0S9 P@ a"R440 P @0  P1 R 0S 00b01@ Q  Pm j P 00b PV P 0SO` 0V0R00S`V@ P@; a`B0S 0S|V>p dVp0( KBNKa@D\0 (K@D . 0< x%%$LXx p-RLM0@`+ a@ R\0"(\` phv ^0S  0 SS S0d0T!\ phK (<<dP0, 0 ph5xT 4` -SLMp 8Ka`N‡PV(VT` P, 0S0Sy  PK 0 SSZ, [RW R08 0R 0G @T0 4 0 S?0S< 0S PN408   P`1 R 0SS 0J(U` hz  0S0S* U" X1 Q *D1 Q :0S S R0000V@@@@@ PA 0h/ ((PU2UP 0S S R000(U 88/P0( x%%( ` -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`႐0S@0%% -RLM0`pl a@QgJ(T` iR 唀R 0O  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P iN*0 `0T< 0Sh. 80i$T (@@AP0x \h%`8 p-LMKP@ [PTPT`0 R*0R*0@  [Pȏp%%0 P0:00 -a0L0p@TP  N P P0 S R @000?S T S 0?S h`+ LX0 ` BR X0  äX0 :4!  Dld -AML M4 8 , - MK 3(K 8 BnK`Fs< `F N 㝰 RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D JBK0A0A~P@J0"S 04 Rf<4SZ0  MK ^8+\ 8-Q `@  00* <\' ZP@/48`V%0 U/ 5P V  @0aS@ lZ  M ,0 S ,ޓ  P@<l0 {J000@D0z~ MK4h <0gbSe4@D( b<$ 00]??A xx3 dY@0@D0L~( O -K0P kS gS844(< @DmS/4$(4( Q 0a#5<4 44800(K RK J( K0?S X0  BR X0`  äX0h 8 -LAM MhB>K0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\֍1 ,0S , y 0g g0C B#b"Baa  X8 < LLL!LLH 00 0Y ᨍBKJJX@8<$L;K  ,CP 0(K;K, S QQa B RR24  ~4 mL00CS0X0  äX0 6 0d -$LkM0Ke/ ,0 4dL0!PP 六P@ P' @T`t\nLX 0O@@eL T8@ 4T00CS00  ä0 4T`@ QPP  eP,#3P P@t x3x t,@0\#\3P Py@t 3  t0@8 # 3P Pc@t 2 t8@4"2P PM@t p2pk t4@<@T44T" L2@ 1p@S pb <PRR0SS T * R 0 dR0b00S@<@P!1P P@t T1T$ tDh!h1P P@t 0 tTDn0 ,0S ,兑0 _ e/0 a00H h0hN@ H0F o(4Td/a8\,%<`a` -8@TLPp60S S 0 (S"H\T& ᮋP`$ 8@T0S S 0R8#H\T@<0 P @o`$( -LXM|`K@X pEPP 0rSPG |0@Sb00C8SHHJa嘁@J T@ p1GT0\0CS0<0  0DD PP 0嬫P* @ᦫP" @TJ 0w@J T@ 0 T00CS0 `@00T VPx0K @1Spd/T -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`m((0 m%%(D` -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 ᢊP!H0@ 0R!705@20  0 %4%%0@-@000<0\00  [00RS?00 Q 0  <0R 8\ *0 SSP(0\1R:0\ $0@I<0S00%E%A-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!Q%% -0LD0C6S[@ȇȇȇȇȇȇȇȇHȇȇȇȇȇȇȇȇȇȇPȇȇȇȇȇȇȇȇX`hpxȇȇȇȇȇȇȇ4ȇȇȇ|HhmF@<840,($  IFGFEFCFAF?F=F;F9F7F5F3F1F/F-F+F)F'F%F#F!FF(p`,\Dht| @l,h,Pp  -L`pPAT 1SPUTA@@sP  Q`$ p-LM`P@PQ@TpP Q P pQ -LIM MJ~KpGpGP @ , 1JnKS`F1A@TP,0 S ,9 P0rSJ /LP@ PrU B>K0C0C4 000 !\P2@0@@ F0 PP 4S JnKⴀ`F10 "\a0@|$Tʄ1S2BKAA  0 ܟp$ -2LMp`@0P0 $ \0 ~ 0 ~ x 0p ^\ :` 0X ^< :z, v8%\%` -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S PJP V 0 SS Px0`000< 0S40H. 8 00%` -2LMpP0 0|0`` `d@t P0P tT @(JD  `` -2LMPQ  0  @ )@t 0& t 0T:`EpW; 0 K\l< X0 @ ,0 0`L` -2LM`px \p0@PP@ @| <0< |V O ` -2LMP 0 Rp`0 0` `@t 0 t' 0 @ 0xpx!t<P` @1P @T<!F 0 0T @H\`T Q-Lp`( P% P# P! P !@R PP @T! 0 /\ PȭP 飆P A4 $0xP``$P0S  0 S  -LpMpK`PT0sep n@T X 0S@ 0@0PatrdAedA`$ -LP\p@` 0B0C3SOꘖ  T <0( ,0P<0( ,048  1hW <0( ,0P( 0V ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4P$ o` `0 P 0Z<0 0Q&2 -L8M0U@p- 55 u  % 5P(T$4@  $Pp 4Q 0SDP Ppd5P(D0: S  S  S0 00p{ 00 R000Sg R0?;#003 <0S c#?;0P@ ?1LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2q@0S0||\ Ks1Ps1 V@I 00 ~@!0!t@: 00 o@0!f@g0*~@0d!\@T P!P00p 0Q  c@0!A@0 0T PM@0 +@0P 0<0  H0 tpp oolppphpo,xpopm8@$8Lh -LMc0Ss0S 3 R S0S3 Rt3 R hCP@P,K 8C0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP@2`DBHHP(@ 0S 0+Y0 a000+)P !1aA0 @@AP| H@ 0X$1 v@e0AKPR0: SN8 @TI0C@D0 R㬀 00CS00  ä00 }x( 808 $0 p p$ootpppqrpr,olp4 -?MLMt0t` R   0S P JDp0S?KK@D0P@D?+cP d  p- LMP|Ut`0   p@0T Pࠡ> > p -\0L RL H0 @R0,0, 0[>0X>pxpq 0-QLP) 0S-d0  cP@ڸ0 T ;;S0@0T@|0 t>0f>\ 0T C>00  bP@0 0 xpop( -b0LP@@xr PP PX"000SQإppp Uڅ;;SNU8U0011 U00R@@T U 1 Q P==!0|!=l1 h=\=,=0S =0S =0ES U0P0 0 R0Q/PU=0 S =0S =0S =0S00PXb=00 000 oL -1LM R*ʔa0S& !00CSYxx0Sp1  0SK<<<Щ0S0 0  0S==[0ȌlȠ@$ K$ @ P@0 HP U0S \p0 =@0T@_0 b0@TP 0,Q00000ooo@p mo -P@LM0 U 5ࠟP.0 R  0p`W 80 S80S*0S@0Q<@ <000P o -L M䁟P@P!0SԫԫԫUTj<0000U$ha 0 RQ R 0Q<!u< 1 R < T:P0U$`0 [0 njlȠ( $`0P@( Kd$@ (P]<$0H ;<<T 4Xxpm -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 PAb0 0PV?KK(@D@D?+`P`G?+`P;@@ HP+X@ P000 P ,0 S ,+;0 ;;; ;; ;p  ;` ; ?+P`P}  m<d -LMdNK@D0 @Dp (0 Pw P38  P F $04 4!N0 y P Vt $04 4`!f0 h L1^  a P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#Rp (,H8$0 |0 p -H$L|M0 ,0 < P $00CS 4   4圐K R 0  & P3=6K 0 P7#00CS(0ddd((a=0p`P@00S@b-P ``06 u P03 ($3 0 P3 0 P 2 ](2 ,0S ,q2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 'sq0b= 0P@60 0C PL [b=0P@06\  03 P 0pq (,$qQ-H0 4S Q 0 S  q,p -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0y,p (,$08H P& -%L0M0 (0 H P4H@ AR4  0ASpdppHPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 A&S(0 S (o0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K# 0<dp (,$ -0` LK$KP P0`P| Ps%d 0QpL0L {P0, C% p(, 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0"%\ 00h$40 |000 0 qp 8(, p-LKtM @`KPP   \L0  Fp$p$0 00$$T- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^a$Ppt -LtMpPK@P1 R* 0R5 0: S,  )PP $ 0Q` P X 0x @O$Xe$0L C$P 0R $pp -MLP4M H4p , t * $00C S Xt|3źP3 RIKII 4S+P) $#0@P \ `3 RT3T P00##3 ,0S ,:m3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02LSP P0SBB0S1 R  IKAAP!0S$\1  #4t!`#11  ZBnKP`F`FU!B4: S>vp@ PpT# 00#00 ,  %x "B  X  qrpp(,qp8r <0h p-LtM`KPP 0@T0: S 'Pp#L 0"pPVp" pp -LtM0@/SP @//X`@pKT/ `0Sh0S ĵx0\0S0S! *x q -@LpMS` Pp0S 0 R K|P0Sl00d0 Rd00HPy"00 W"r" 0P"`$ -LtMp@W0 P`0S 0 R K?P0Sp00d0 Rh00HP>"00 "7" 0"p$ -LM@c0Sl`0弸P "0S "04 !$0 RPrqDp -LM@ 0Sl`0司P !0S !04 !$0 RPrqDp -LM@0Sl`0fP !0S !04 !$0 RPrqDp -LM!@8P! 0h~!h -*0LM"*@7P! 0hh!h -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0cB! 0  !pW eP  0p\ x/0Q`! 0 nq q p-RLM`0 Pp@0T<  P  0ph  ꀤ 0-0@SLP 4 0R0a 0h2p8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  PEP p R0 RPa- 0S0S 0 Q 0 ,0S ,iK(A4A {P a=(K0Q p0| 0vQX0Pt 4 0@ Q l  0$ ` $,P$ -0 0R00000L R0000 R0@00x0 Rldh0P PP0 RP$p0pqp 4ppl p-PLM@` 0SpcPP u@P0/S00H 0 S8 @`0 0 PPPPp d0 R00T0T QH0  \80 R,0 P0+ꐤpp&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  Q:TP 0 0:S l R1 0 LP0?0C0 h\@pcDppd| p-LM0@P/T#|P00l030SP`ph8<(0Sph00phqrrr -LTMptp % p 00@JS񟗈$233333333333333333423223383333D333P3X3333h33333333333332333343343(4443@4L4d43H5P5h5t55553<6p(4qDTA0S`0@0w,0S 3wC勱Pv  4 u}4Po\j43S Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: \2p2pH2p 2|2 pt2@p}l2pzd2|w2|qP1@ 0S `Pa0CS"4 5 5 54 5 5 5 5 5 5 55 585@51` 0S{1P1P1P1P1  &t1p1{1[PzqT1z-L1y*D1y'xP0a,AH0pK @p <1P@x  0PP@ PaUH@ 0A5 0'pc|pp(qpdpppppLpplpppppqpdpppI|dsppn9d(0pp 0 BXL0@0t0 X X0 t0SI0S| |0 0S7777T8 0S@0cP0 0S0w 0S @0yP 0$!0S0<1 _P1 RH!d1 p6QM Q ! R 1R B Q @A1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PDDLM@, 0 4 8 0(Bp 00@JS񟗾; ;<<(;0;<8;@;<<<<<<<<<|9H;<<<<\;h;<<;<<;;<<<<<<<;<;<<<<<<<:<<< <<;<<<<\<<d<p<<<<<<<<<<<vfP040 606666|6T6t&h640Y8  6 86   w4 8\P8  fV6 0 f5b5%5 \0X5 | 0-S 0 , 0S,  5000 Bx5x%=l55P6W44 0$0,0%000( 55 %, 5R Q@b $4 00CSTY  0S`=`=`?`?YpP. Yi 80I`0< 80 VL hԮP\D;P< Pp$îP(4 RYPW Ø3 , RPC0S 0S P 0S,30 ᑱtTP@\ L凮P R2P 2PptP `P x2`0P<0 20H CQ0"Q0v <2PlYPN YY 8 I`0 @0 8 V; @Q P1@P B CP wPt0P1 RY0  8`~P@x )P` P P0 OBPP;P `P`P@  ,P).P# \0S lpcpL $0<hpqHppEpp0pqpppspd( Hpt|( -LpM`@pK@ 00RPP;P0: SU/00 0D 00S|P  $!, -4L$LM4$䄟P4 $4p $bp 60@DSpDEEEEEEEEEEDEEE(ETFEETFEELFEETFEEECEEEEEEFEEEEEEDCFFEFEEFECFFEFFEFCFGGEEEG3x3x#000d3+ X3 yH3@c@}P@ P 3 R ) #b尒ŸH0pK  p 2P@l  2L` @ pp`]VH@ L2P=H2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QSHGHGGGG R|PP R0S,1 $\P 0 R _ R 0 PPK qpplpppppcHp|I dpEpppppdpsp0 (p p-0LM` |@PᢡId0 P0R4BDL S00CS00  0p phqDh٫ P00Ḥ -L0L R0 R  e긤p P-L 0S8P1 0PS$ p,{Pp`=uP@ XP  ppP0VPPS0  U  0S( X H p-LM KPg qd R0\4P0 0b0CS#LHLHLHLHLHLHLHLHLLHLLHLHLHLHLHLHLHLHLHLL`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKP\{P @"#  0 S R XPP   B0 0 C 0 0 Hp -L 0SfRm -L0,FYR@ -p@LM@ 0\84 0L3E 0<.B 0,)0$= $7RDL -MLML0P`(0  0S ,(0 S (#] @Rpx 0\S@ S  R wR WPP`  PI000S  \R 0R 0S WP 00@0@0S PS" GS0000S 00P 00PPPW0 0gS pS00BNK@D@D ;fD 0hWz(v $ -@TpL 0S W`PUP P蜬@@0`S 0 p`PPP PXp 0-\0P@LT 0 @T0U$ KPꌦ{ -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00V 0 p}Pp  R/00` @0/S`0 0@4R R/00p錦pp p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 RpxPT @`H0@PpUP00pp p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQp@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00 0Ӫ Ͼ<0C<`0S.000SlS 0/S 000겪 ᯾00C0ꬦ p  -ML M\\1 `P$ ^KPE840,0S/0Sz0 S0 K0S( .S @ Wp | P;0W$0 S x$6Zd0 K@TTfHb qDx tv  H T |  p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 01  -LcMZK MpKK K(@DKK( @DN*K", 8KWLK KPH0`K: bK(J,J 0 P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,ZYT *0S 0TP*0S0T0* K\ 0 1(K R K(00(K RK*K:K(bZKX:KZK(80S  KP KZK(8TxKQ :K(0nꔦ  T\      -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV @\S R0P -LMp㻯1PU|aPP 0S`QḨP@ 0 S/R< S4aP2 T,/00 1  bPP 0Sbabb0b00 R,0 ᶸh@T0 0S/S @ ,p! !ppppp(!T!|!X0X P -88L(0 RMpp!!p p-L,M(@KLP GP BP =Pt <8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 壼PV ᝼PF ᗼP6 ᑼP& ዼP0  40 僼P }PpxX!Wp@0S kP@0S aP@0S WP@0S MP@P DP 0K  1 0K  *w 0K  #k 0K  _!Pppb! -x0LM @R`0 R P0 RP PaP꼦 p-PLM@3 R0 (a0S= 0#S4 \S. PP$ K0"C12d1@cP 0S PQP P0! 0pxu  `o 0#S@ xP,弳P  꼦/>3","=L"X0X P#3!"c1 0c!R 0S R(/>3 p-PLM@3 R0 (a0S= 0#S4 \S. PP$ 0"C12d1@cP 0S P+QP P0! 0px  ` 0#S@ zxP,EP  />3""="X0X P#3!"c1 0c!R 0S R,/>3 -PpL`@ 0Sd /PPp0 S 00C S0u 0SPP@j U 0SE000S1W 0S !0 0P!10@ @@P000 RH 0h P, a P\ P 00000 0S MS CS000 0S 07 cS mS00dv,QW0p0@ .QT@}  ( ##<#X####$@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R 괦H -LMPဥ0pS@ q 20  00S| 0SЁT`q @cP_0 1 !.B=R pGV0G SRo0po0po0p\o0p8p0po 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R Ѕp010!.CDR Pk?C@.PT @} 0-LPL@DT  0鄱0S0 ! Ħ $$ -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00N0hN0Ħ$qv -dpL0S ` AT@0`V01P@PNNUĦ p-LMP@T0 p钰0Sx`t 0 h0h咴X0P0j 00 H 0 ȦGpp$p$$ -ML0M (R04 ,0  2 ,0S ,S4! /!8 0AT ~KpGR0pG8 @TMP@, Q0 0Q  P  D! TN4a=  8,1008 A   0`PS 0S0.0S  PT 4a=0 S0ń 8  $ Ȧ $G$$%@%X% 0-LPL@DT  00S0 ^ ̦p% -8L@T`M !0pAT *PP! @T XMP@ tP tP 0! 0A|MzMh T  P lM tP  ̦%%% -@L0`SpP` 10AT ֟P @T ᳟P:0G0̦ 0-LPL@DT  0)0S0  Ц=& -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q LP@ 0`0 10 AЦ/>3D& -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S \LP 00 0 0   )&0, PhPP 0p p00  ` WPP 0X0@ #LP 00  Цd&& 0-LPL@DT  0C0S0  Ԧ=& p-LML`0S P0AT  0r@TPOUpԦ -LM䀟pPP, / 0"c12f1`cAT 0S @TKP@ sP pP ,000! 0AK(o0ST Ԧ/>3' 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00KK0Ԧ/>3 0-TPL@ T0 04 @00^K0S0070ئLpD' -LMP0@SȠp  0S P@r0BS` x0 (00 徐 L 000oK`V$ 0`00ئLpܦt' -`L0S$ PPUJp0"S@0S w 0RH Q z(KPUZ$K000ئܦp p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@ᱲp  -P 0S\ \P00S0 BS 00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CRĄ؄\00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  Y0S 3@T0   0dp -LMP@ 応Pp府P \ 00CSP0 @ ($ 0''`p''( -LMP, P, 4#, 岴,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  qq -3LCM |3 B, Rꤊ܊܊83 R  3 ,0S ,9NBP0SPdU <"K⥳ d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP RP@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A 卩PdC000 (3>K yPVXCX_K#^?K@|A ʠPHx!1RS@$0YP0;CS040@4Q0S|  `dܚlٚA Ӛ!r 10C1 =At0\ T0 02@P@kT00< KcK0 ! `VKe/K:1  < K eK R x0S:@ A (; 0S 5  1 刡 垫 00Ì bK 0嬽Pʱ 0<~D$&;r464\&=K@巨PpOd&Y?KP0C P婨P Y?KP0C P囨PwȐ㣳F]?K 冨0(PK0@00  O? K ^ 300 0p1  000+]?K` W ]?KV 7 ]?KL ~ P@ 00 ݥOOK,㵒@@H 0-L%P:ƙ0^  x0\*NP0\@ PL0@ D’@P@4㧙   sXrsr -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 垧1  Q P1@ԡ`0 810 @@嗞0P0?P P$JKx!(@D@D0h!`P) /0P ,0 Q  ,D 帏`8#8P#$0$ @JK(@D @D3K<:(<2: !<(K0<:(<2:(LL!<  0 sTrhr$srssrt...Tr -L4MD 0K`D 0P@K0 Z L7  f  ,D h0S '0S0 0R0; 6"  Ԧ R000 0p 6F 0 B0p0 \Ɵ0 ` }DX@0S #S $0 0c@BHX@000CS00  ä0 S7 S@PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0ZPHpWp!pW T0W6 'W00,P|0 ă ā Ă< 4 <( "4\,<pW0 PH 'U00CS00  ä0 pߣD 0T ᶟPhß0m0p@gU0#DHLa$H 0 \ZDPV0S.W)4S4#0pW@ *0 @S0pW:90pW@ *0Sp ,0W:'$P@K0/钐PKP@0/0 \ 8Kn48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7   pr.Trr$shrr.d.../q/q/,/4/T/\////$ /MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004=K(IITK(JJT$0 t~ * \0# u* S#0S`V* XvVP@vX0 { - |P@vV0 }8#0 C *! *Q 2 R   :,0 S ,A2@2@P0 EŸp`0 >6@PK0L X0/0.)K@ B0/㓐0/P@@0/P@@僐0/0/P@ @sK0LP@0/@)K0 BP@0/@aKP@P!<0 @¦ *㠄 F{i B{W >{P@M  嫦f  ᦦ *㄄3K (JJ0 㘦 *v 0RK(II l*iY@A ds/r/r/`K$sw$  0T0x0r00 -L0 K M00, 000K 0 ၎ p/? 0@ @ _` Q @0 RQ   -LM@CT (0P0P5r -LM@QsLLLL\d `hQ$HPX`h0S #!Q 4<Dped`X]PLHDhR840#$(,"(hE0S S0Swusqo0("#00001<1\1t1111112,2P2t22222223(3P3t333334$4D4\4444445 5 p-L M0@0a=P0 !P)) 0 Ӣ΢tVP`F `00CS00  0p phI(V`FD55555d5 -0L M0 K0 P@ 嘢0888 ۤ(卢0 Ҥr@q5, -LM@0 01R4 R(  0 $hg56 -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @K 0S l <@I0S D 08: S0 % g7777P -L@!x1hFSP/ 0Q0 0 : SFH` d0S T0S 10g1hhP  PP 0hd07P777788 -LMa0P, 0 (@垌tt1L pKR `0 T! 00C SG4$$ $$$, A?K K0 0Q0 00nS 0 S G<0nIK00 K pKA/00, ⍜       yD$8 p-LM(`P,@2P ,zP p  L0S$ `0! 00C S@ @(@0@8@H0 0p0000000yD -LCM MD$E~KpGpG 0,           `$ \$ ` 3* R@ R  ȣd$ 0SP' 0Sj3 3(K |3P\4 4 XT 8@T40 @TL S0@: S< ,(P,0 S ,u;2 2@PP 2 P2R( K"\$ XD @An04"T2 R0S <yBNK@D@DG P@1 qd4 S00C0 zy !1@01j 000lLy \0S n@6<Fx090S eP^ 0 pPV 0 UP@ x0SJ %GP @0S? =<3I 0S t 7P,888d0D8p88848@H8tv8 9 9`KH9`9h9t9 -T0L8M<0 0  8 @ 4 0K0 , ( $   Y@K2H -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P,e:E.K B B0h$ !1`$ (@K  d 8 X \ @&? hBNK@D@D 0 P h F0D_0 ~p` "o 9y -L Mr`4PPy i&݆ P(0S\ P, (0, ( ,0OƗ@0 /c0,00 0 0S3&+,0 0S(& 0 00,0 0S0 00  0 R 0 @@P0, P( ,P6  c Ɨ@0 S/0,0C0=0 (0bu.y8999`$ -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  啙0001V' @ 00CS00 0S 1P01rXQ0P 000,0 QPyPH@ -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,7 0@85P @" Q 70$ :  0bPPd 0hƑ(0CC1/|x0Pw00S  n Q<;P9 yX:`:::` -MLM0tC\d#, 4 <(  P@\43~4 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 ᆇ p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S ,6 4 0 |00S00YX   D0TPDHJPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:08+|0ߛ @P0088  <  + 0y:`:::`: -0LM PU@p$`` #T*U0 R S 0喃" lL`▂#0U<0 R 0< 0喃" \y:: ;$; -0P0 P00LMS0 P(܀ R0 P.:p$60PP5`@2:(P`@ᣘ,F0B$囘|P0 R0`@00)$Fዘ00$u@0 p@;0sy0 -!LM0\00 \pG\(:`(P``Y,F0BC$Q0 ƚ \?Pt0t0l h d@d0 =0(0000ty|,s`;hlxpx - 6 8`0(@ 0L 0SĠP`묀ppP3@00 00`PS P@0Ss0S/P,Uy|0stxlph; -LM@P00/p -LM@&B ?ᇅ Pa(/PUp* 0А囗0 T00P00@ 000p@0 (($`Yd0 dS D 0 Q00/P yxDxxx; -P0LM@\<0 P 0S P Dx; p-LM``0S TPT 01@CT*u/s/000pm/0T*xxx 0  0 -LM`P@aUpᰀ 0SP 0S 00C0$d Ք\0 iD80  \0   >;HH;7P 0-(0@ LRP 0 ,委, 00 0-(0P@LT ,匁P  T00T0S 0 T @0 0-LM@0T0 T00S0 T0P 7@HỶ0S|tp0 Rd T0K0 Vb 8 (;<g< <<$<* -0LM@ 0h B\ 00CS  00 00  <<HH< -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`P( 00@$KUr$ @0 0 /&`$ 000H0G  W00 RHyD 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 ᔓ$0$  00C00HH -LM@Pr0 `0"wpM b0@SB||||||||$`|t||||||||1 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ P 0 R T@DX  0;T@DlzX T0 R '<`<cpol<(4<pxLL< p-L@M P`K=R0S 0S  { p< -LM`t`ğ QS, @ DdZ 0S 0S~ p P0S 3 ,0S ,K2 0ṢģL0S@ P먓0S 0S~ 0\CS 0S ?0S 0S , @C ,>4>H>\>|>>>>??,?L -0L t&В8? -,L4M6`V j ,6 &,0 R:(6@TԢpP2,& 00 0# (6@T,&B2 S:x 020,&0 R:H 020L0Sg d0d Vb0SQ zVV1W V!bT SQRV V@ ?>1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V /&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎyP -L M0 \0Z0 Z00S70E 0S 1St5  d50S`P<5&0O @0 V"U 5 RD G 0 0|P 0  VTa D0S Y U`4&B ?EPPp` Y YP Y  Y! U@1(@Q0 T PEU@ #6#aWPP@T1X@QcTP #0001 01S@  YD3  , \3)&T3 0@L#09$ 64$0 R  "0S  J0@$00 Pq p2l2    1)P x2 d` P~ 2 RA @I>1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/i (K0 o]@0 ,J0S N0Sq P 00M(< )P0S "XZ P D 86C ttHTyt?;H?@D4s8s??x??@@4@L@\@p@{ D -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*)P (@ R00  0R 0S R0R0S P 0 R P` _X0 S00Dō<<8PD8s4@@?@@@R4s@{ D -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  y@K0C4  L44 $0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:X$3 ,0S <,,- 0S 0 S s S # P"   00C0 "{ P  000 00C0  MR0S-@<2Vw@U P  T2(KWKK@$ (@'0\4  X$ kEQ& B0O0  0lp 6`X!0SV Eo0 }5@"%$1 R0 P P& Pd P <0:90|o H`AxAxx @AAAtvAAyDA77{ D@A8?(ADA -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KKQy0((K0Q 0@^^>KMK az P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dT X (,0 S <,+00 00CS񟗳HH$0S&&L0S6 `03  00C SK888 8(808@ 0S 00C S'00&\ P%00C00000000      y0S $\NK @D@D0, S^K PE0 0%5 R $\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00l PS L0S|3(K4!  `0A?( K A?(K KK x$\0 0 Q0hNK0ᴀ$00$03  0`0C0 6@@Q @T; Q 0S+ 0 SP $00$0P "00C0"m>KMK  PH"]D000.S "Q =iP00L Rm `0j 0Sg 5\@P^>KMK @dఊ$00$0@1  0`0C0 崀=@}?PwP( s50.SR 00Ph L0S# `0 0S 0<0P$0  AyAHBB B,BD8B@HBpB|BBBBBtvABB,CDCpCCCC ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000xxHDd@ 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.t 0QP 0S P0  00$dHK HKmHK4 00  BTH@x8CDC -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00#TP@ -LuM؆0,0 n# p! i#1PW1 1 1  6 \ᄦP  (` ,6&2Pv !,6"! 0&&& 2&. rK* f?K^4 Z(@1^*P P ?> P  RN+ 0`F<0^:6^  ^<ş 0P<,5% \?>1/1L.QAN 0 40\1嬤 01 0S  1, 0 S  0\` =K_K<$1ႍ,6 1R rK P0S#1n& _Ph0SR1#_&PP86 P90S 0S % T1 0S 8rKH Pß,0 S ,'C1! 0 000S  ReK& P !&+001&P hT eK P &  !00! &Pu 1{ vi,6KQ01,&K `,6|AQ000P0SH1 SDH0S%1 S!.0\!5 2! 5:? >PN0ׇ? >0N0CSt!d!x&x&x&d!101 ,6 0q ,6!j tX@0 H; yP DHDpDDDDEE(E0E10@ខ3PL ━x3PTChG T3P= ⁁P03$- 6SR ,@!0@T00 "2 _B00Y0"S P yx2ulPP\Hd,(PPO@=YT J/ [^q1  LPP>, '^&R0S%"0!S$9 㭮puG{PL(~Fg , >g 뚙?A x<F?x8FXdxDFLlFtFFFFFG4G\GpGy\GGPGHGD@HDxxxx!@\1 00CPp010  p\P -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH ^kT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f fS~n`` K~/00f V:TPU L0L X0 0 TP  U \K$!HH_Htv -L  - L0  hr M -L5 rhr -LM0@S 0MMMM00S lh0 R \P0008^,K4 MKx!W{x0Sx U@I?K2lK1ppK01@T` Kep`x U`tPP@1@SPTUpPl r 200000S 0:SP Pl -PPU t@T0, CR 0 R00Sp0K1@S\TU@ T 0 CR 0R0048!R0S<1S0P [ 00CS00  ä0 X00S"0 ,0Sp, i i8iiiid]]]]]]\]^^ D$^0^ ->MLDM10 ,  T >KK(@DD@D `v\ ^L dP`9>{KL@K(pG $pG>[v v 8P 4p d^ dP@ <0Sl <0TP, 0 0CS00ä0<0@T|PY\Z0 ,0S8,鸄 Yi i|D^X^`^dd^l^ 0-x0LP! @ T @2| 0 CR 0R00V@x0 tw$owR d0SB0S 0B 0 CR 0R00'505P d 0 CR 0R00x070 0h0]d]]^^^^^_ 0-0L0MP0@@K( 0 u ]|0| cP0SXZ0 P0 H00<$ ~ 0S(@0頄 6i((_d8_L_ 0-t0tP0Lh@h  \0\00 00Y]@08 cP$ 0頄dЄl5i `_ p-LM@`00X`PD 8}@P$NP^Pp頄dp___ -Lqd0d0`pT}0@#nPp@@Np0 } 0頄d_` -LM@KD004 (} 00頄4```dЄ -LM@-D004 (b} 00頄``dl -L M0p$0  @pp`0h\=}$KP`@Au$0@@S -}頄d`a8a40S 0S0SRe-L0S 00  S\0SRe 0-@PL0 Np0 |0Re 0-@PL0 9p0 |0̩e -Lp0PP`@ld0p0`@0 @|8g@T(  YeLU p-LM0@S`P 00  S)Pp@0Sp -QLMPp W@cX0$  A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xtf Hb H00p@0S% 4iUgff Dܟ̩UL$f0f -LBM MLCNK@DP0 @D/㋏KKoK,0 PPs n[1 aPp2(K 0Sb 0( K @<PP@`mP,P[(0K 0(K 0QpRKG K <P@PHmPP,8[ 0D ,0S4,  Ki D@fHflf -LM줟0@(0 4$4Q4QT00CS00  ä0 LT 0S 0S ftXp@K Dd's Z0K( `0 aP`0SP@K( s Z aP0P彖 Pp 3 ,p `Px|pj @4 @0R0 0  CR 0R000( CR 0R00՗ 40) CR 0R00—`R00CS00  ä0 880< L H20@S& 4Ÿ0S @0 0R 2!0S 2^ 80 00 0S1@1S^0\0CS00  ä0 8vp10S P00@T`10S V8`& 0  A00@T PUX0@T  @0S 0 0$0S_ (0S(  *f4gL@gdLgi Xg6i(lgqgggVV/ Dܟhg`^Rt -LMX0Tr$0 0S)0+S ({$B$ Y4PK ao] DY D_P 1` 01S  qA0 x! _P 01S Dq\4 0hY)o<% 14 8#"0! 40K@  D_P 01S q| ;YP n00CS00  ä0 d{ $0ST$  }g%i g"i ggg#i hhd h -(0L00S 0 騄0S 00S "48<#80  -DLM08@,0 0SW0+S 婔`p㓏Kpp <jP,X30: SOK.p XO_K0d ^P01SD!@ p,3 (K @OOK <jP,XCSOK.p xXOK0 ^P01S hMKTP .p VXO_K0  ^Pp01S <1<1<1<1<1Y 10SB .cp4 X0L S^P01S) (&81S<1S I@8P PdP Pdt 0 ,0S,  } D,h"i 8hLh%i ThhhIi xhhhhhhhĩQi hh,hiip -0LMaQ00p00P$0S@T 0 jA{0S K  Ld 00  x i p-L MK,` 0 APp0S |xV0000 P00P0S 00p0P@0P0P0 `20p ,i p-LMR@!X` 0S  | @Y l<0 CR 0R00|0S7 0CU3* V ,0 CR 0R00d` \0 CR 0 R \ 00N \0 S0 S0SD>0 CR 0R00pph1p 0CW31 V ,0 CR 0R00  ` R"R000ӑ0 CR 0P R  U 00 R0 S0 S0Sdx p-L$M08@K`  Qn4 <0K 0 P Z^ 0w<0S  lvi0S 00S Q0S 1#$0$ <}"pi -LMK,p0 Q`n 0@S vW0000T00TQP  cn _nT@D0T0T0 d20,i@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  KLi -L(M@q0D@K$ ,a 0 n$ U [p40S3 00S/ 4P%9eP0   [pr0@`TUUPPE Vt`S hP@00U00SV  0S, E i$n n8ngn - @LM0 um鼀i 0R@@@ S P [=x mx ?0 R0 0p Q0 R FD `\0 ]㿌 x@PXn0s,  O0 I|Don p-LM@`0S Pq00  00S|0 R?0X CR 00`0Sp0R P壉d -0L BВLo -LMp W@P< ! O0PdS pğp0<0 0dd` Gp1@T <PL,dddddddddddddddddd8dDdddddddddddddddddddddddddd$ddPdXddddddp`< 00$3``#`22 Pb0A QU 0ŸS2  0S "0S}  DAd2Pp PPhd"S000 8 KP8<"H0SXT PCP:G< R P 1 R ,0S L0S RR P 1/2a@#b! 8KfPڲ3[ Դ0S д8A,08!z(!uJP@ 0S0 d@ P P (|%/RP  ] D00Sb0@Z \H꠫ppoppHMbpppq8q`q -LpP`H mPP=X<P@0 X P)c `ʇiP0`  (``(0S<0 0P,` P0,,0@| 0S0@FDLL <,0 00  Hohqqq p-LMT`@T PP T0S0U@0pH00P 0 RPH p-LM`hPP@0  0P0\0dh  z00TTPPPPPPP pJrpooqr -LM,K2嘢@ 4pKT ' @,0@PQ h2 R,0S`((7P0 P, 0,0@40Q9 @T40Q& , Q ៵00 0cP l  1 Rʄxx!=9 B = 0 0R 0S(,! 0R`VV `0 0,00 R = Q $08 0bS$0$00,0^00STd 0,000,0,@ m 0RdHol` g0STR `Q0SK R pGz;< 0 otuu4u`uuuu v,vPv0 L -L(Mlq0@PKda @ 0 徂H LPD3[1 ,,!0vP"P  0 S } 00 0 x 0x 3KKP s;8T 0k;8 0 i o\vxvvvvvi vv -LPM∡0H@Kp|P `(0 HP DP @P 01 0 R 000 ^0 0-@0P0LS0S 0' ; 㼀0PP 0x 00P 00v98H 0l9$ XpED4wLt -!LWM0,0  pကPUaKJ/ [d aCT IP=WoK0PS @W 0]KS  @P U00R00Sdj0 ,0S , \\ K.0 Y0 S \ ꖬ8D0D @ꍬ8 0$ 7 wJi(wdpw0xLt -LdM☑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )000 PPPP0  0S 0 0 .0\ KXl`K@ WV0 0p P ,0S X,o >V@80 tpLxDdxt -RML 7 M(% 4%  ǟ7 ȟx,  ,  0 8 < @  t' 匎p. H0@/SDT,,,,x,,,,,,H,,,,,,,,,\$,0p,,\l,x,,4@0:;;@00S lVA0C2SE0 0000000$000000800000000000000 0000000$00000080<00S|090;0:0;0:080gş80:( 8 07[bFKL L4EG.Kx t :  B0p l P 0 T5 09I@ -b0:;8  TNKA B@ 0S 0 R 4%RQ #NKA D4P|ß0 R 4 R Xh 0@0mP00<0Qʪ,0, "NKA 2\3 R 4 R0 S  "NKAl2`P0S2 4 R.". P"+@(0 -y/ -+T 2P00(|10 \[mP 6T RmPp!NKA hP L0 R 4 Rk (`rLX@@ a080 00 V00NKA >1Pڠ0 R 4 R Pø;d0 0:;7/0<0:;:?.A hPycyyyzd(zHz`z'tz'z+zzz{p4{}H{d{{{{ĭ\{ {x|0|H|d||l|||||||}'u$}D}P}\}t}}},}`} ~p ~X̭,H~d~ 1 bZ bZW0% 1PGFKL@ L@@@@@@laG~K@pGx t : 0p l pP0 R11 P0Q5  S1}@P50 ,%R0 KL@ L@@@@@N>K@0C, @:0C D 3P$0S \0 0 )>UP "0  NNKL2@D@DP)` 0T `'UPD2) 0`UPlkk|4 0S Q0S22x 0 .0% >5 P$  #0 5@T @@T XDTH$0 00000000@kT@TP@0D @E@0 4 R1 @\ O>K)0C* Tps $KNK@D0$% R44:0  4 4: 0 TPPX0 8EP00 0 s0% 0% 05S8%R 454 00) 0l0   ,0S  < 4 (%R <5P(%`6 0s 400) 0   0Q4 ZQʘ&0) %R @0SX&\KPEd&@0@&TP6&0@TP&ONK@DP) 0 P TP6) 0PTP(@ @9- 3' 50C5 倨| @ q}EzE (0@ ,x00MKBKK DhDKL@AI L@ A 0IH D L @TcPU\0SV(0 NH@0 5 @YP> Hx804 =KL0Cˠ 4 $5 4 HD5 D 4 VP L%$Ed  R 0S9LPڔ0   峪i0S k.S`0S t P@,D:0=KEK0CL0C 0 0xSL: Rig` =K0Cɠ@ 0Ch* @&S y05 zPP:`@ +0V@0 )0 SPL%XPhO.K B0 BdPd4DP4  `J@TO^KPEPE 0 P@540SDP$zk T4DP~ LnET~`<Phd p04 -|<@O>K0C)0C D RP [KNK@D OU<)O>K0C Rp F-N>K0C 0C( wR8 <-00 tT x$"`=` IPp % 1 PP J.DP 0 D,%0Z]-PxP0  P$ 000P | -LM8P |0 R 0 l00 1)L n*\'P 00 @4 @ @ @ C K 8R@@ <00    0 ᨭp -3L$M R 0SS@@@@@@@@@pp3  Q\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p Q0P0?@ P`2 X0¨0P 8 y,u@K7<@@<4 Ġ̌(<"4!Č ̌$1 1LQⰀ\(0pW `Ѝ@-A\.b 2l20@\@=B\2a20\0 -0LM`pP@000s 0s!,K mP,00CS x3p33333@@TT(00T (00 -LM@ KPP"p7p` 0 p?C0s 0H g@0P* 4D$l덞LWq -T0LML @K0*0$D000 470s mLW -LM@ 8|0 HGp l8d -L8 -PLdM:6Px|l:PPXhKPd0K@ h@ d Gp  7`@@jmDo?@{Gz?~@ąЅ8dl5<ĬVP°lIJ? O ( O X T \h0h8P XT`0嫛P@p`j -0L $В -LM`0X"XB00P0H0PPE 0S00(2(. rP0006Ab22 .0S :,8,6,4,P u@.0SPE $,U 0+S-S0S.P-P .U@PE P_U`@PE0SlPfP wPr P ~00S 00SQ1 ')j<;HPBPcj_\ṫВsx`؇pPD p-LM@0P `.p -LM=@T00.0$0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000S@/;e8` -L0MԂԢ 0Pp(0 PTPK 2bI@0S @@җPH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T KXip (0S4(X \ct p-LMP`0,@KHP 0 , "G 0Sp  -LM@P  00R0R  00Sh!鬲 -LM@P h00Shu!鬲 0-LP@P $00S0hy! 0鬲 -L M K2P@![A[R0 ʐP x0td P00TT0@LP }400 PP00ht@tn -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 :pP@ur*`0A>@t 0 001 0*l (pP|Q*?T A.0O0P000B>0,10S 4PU/0K000 p*<040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0鴲dd`p,| -pLM@ 00s)0@`|@-`@? 0"00\ 0S0S000\贲 -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$鴲| -x0LM@ 4 BN@Ap@0t hz 00Np鴲| 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0鴲(00S00B>0@-(0A> 0$Đ6I 贲 -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 鴲 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc괲5=?0/9P6 0S000d p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 07pqph(p鴲 -LM4Px 404@0  0000 0 00 0 0 00  0?\00괲 -LMX@ 0S 00 0p @0S0 04h괲 -LM@0 G7pq @ -LM̀p`P@TC@!E4A>B.A 0 0$D4 dD P  40 40 4sto0 0-tP@0L 4@ 4@K 40 04T0@0h0鴲000 ᴲpD0 00000Sp00000S p0 000  -p000L00 0S0  Pt t><P@ qL0 0000 0S8 0(0$ &< ؑ(0 $ 00 0 дȴ̴ -L 00 0Ĵ p-LMP%&$`$@000&000pĴ& -`Lp00S 0P@&x 0 0S %&0 0 00(`S@0S0Sȴ 0-L@LP 0LR0 0CS00 00 00Ĵ̴ȴ -鐠p0 刀0b? |`PUL@0S 2_&0 P0b?U0S( 0f0@mĴ̴ȴ -錀p0 儠0b? x`@TLP U u3&0 @0b?TU,0@ 00c0m^Ĵ̴ȴ -PL0`0pS @& 0 R & 0 0CR00S 000$%000ȴ p-LM|` x0RR@%`0`P0 0R00C0%00`00S c0SpȴĴ 0-p@LP%`0P0%D P:00@P*0P0ȴ 0-t@tP0LS 0S 0S0800 P0S00ȴԴ - 0L00S Wȴ 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0ȴ -LML@00 S00 S S 00 SSȴ -H0LM0@S ,0@$ 0@]00̴ȴԴ 00tԴ 0-L@dPrrqqrq$ssrrrs,s,s,s,s,s,ss,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s,s$s0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&p`؋І<($8,Ѝ$ dTЈ$xd8H 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S   -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S \,UVP i; R R F20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S6 00S 00S-pWZ00S0   ,0S 00p 000 00SYk 0 o~ X`$l| -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7  -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0 -LMp`pP@uV iE 0S<00S,00S 0 0S00CT'Ip P000P\ -P0Q0L00 00 000\ - L00 00C0鄶 p-LMP`(+@0  000p P0-L@P@ 0T唾0h鑾000PP\0PP\ -LM@0S00ᄶ p-DPLM@`T Pp@Tp\ 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+ip@ VP@< P00 P8p0t T >  P 0`V00S;00 P``V%0P@` P@@P%@Fx00S00 S 0 P@ P pDP@,|@ -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P l @0Q P 0Px00Sl00 @,@ @0PU`XW,x  ,|@ p-pLM`Pv dP<p P P@0P`40`/@0P`p P P0`p<D -L0SH hp0 s 0 0  Bhꈌ -LMp`pP@u P |00Sh0 tW V P@(0 f K!8Ȍ -L M@Kq O p-LM`pP@uxFpP@uPph UT0 ph p-LM`P@P  P ptP@$00S/ ph8 -L M`P, , SP,0@cT A dxvP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@ 8 -hL7` 0S 0 0S<0040   0+0 D[ -p嬀0L`APPጠ 9@T0 10P0MI  c%  b%P@`鐶L0 0DS@0 80 40 00 ,0 00 0 xhlpt| -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 $1P a,1UP0!c0@P$P 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8( h<DlDoxX p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 lxhh@P 4,@PH$0 000@P $0 000 p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pphh -@LM80 00 B0 @00`0hl -T0LM0@SJ@000S P @TZh -0L| P錵 -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000|Hlh -0LM00@0T0p` Pcڴ10U 010`@+ P`  TJ1U RZT010Pe0 DPPE0 0U00lxh -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c 逵\lh P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P 0 @@0@0@0TP 0 PX 000P 0 yP  000\hphHll 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000逵lHh|P00S 00<0< 80Q0(000000td`K0 0 t p-pLM@0`t mPPDp@ p/-@0t T T000CUP800@'P@0 V000p鐶 -@0LMTpP.P $@0ꌀ0P0PE) P@ p U `ZP @0<0Pf(0PE0@W0000鐶@-p@T* R  :P0b0D 6@0@@0@0 贵< @-P 0S 00Q 萵 -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 鐵 -L^ 0 h  -LMH@0S dR 00 000P00 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   |  -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp5P(0`ZGYE $1p0 00px  0@0P`Z,Y)p P ` V U x0p0 00px  0@0P` V U0 鐵| -LM P@p` P@t0u00X00S T00XtuP@tTU@0 -L M0-S fGEC_,   ,`FP LPp% 0S" 0SJPP` :@7@@IP 0`OɲU0S&PὲW,  S,Y L a40 , op`K*<x 400S Aa0@S<0 -A @L2$0R20 -'PLM! $P .P ^P@0 00 aP|@000C 0`@`000T@P@ 0s0s(0P -LP 0-LM@ PKT 000000 -L M@K0,sώ0s 00@30 -L M^@K |0^0s 0s\0000 H00 0400 S P P0 -LZP ,0, 0S 0@-, (02 S@04R 0-PLMP0K K@XP# 0S00R0S$ 00  0؍$ P-L0 h$$! 0-PLM@Y P 0P[0=0C:SG <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<(<<<<<<<<<<<<0lPhPdP`P\PXP@8P040K 0(10 e0ptx(,PPP0 PPP= -@LMTd ThL0 !@<840,h8ȼ(hԎ -LMЁ0P@$0 * TTbA`@ 00B S10 0C00B S0hQQ@`-0,SVVE1C B(1`$1 <qK 0S#T`VPK K@0@1` 0`V@K0@ `PK@P0@`0P KHP  $0S4$ L3 ,0 -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 epq8\ -l0LM@QT T@ hN$0  h$h80 R00L -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHHHHHHH$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[`X$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4l  W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHh$,| -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSW<4444UF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS0010$K0$0 U 0  0  鬏ď(Q PP -LMK@0 `L -LP0 0S00 -LP  0   0Ph -LM0K0 =P -0L0hh -`LPp@`0PSE 0$S T; 2P80 0C$S'`llllllllllllllllllllll`lll`llllllll`00@f < 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X`l -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ R0x<0\0S R 0 R000000ӑS$0S0A0@Sa @0R0-P00 p-LM@P` zX0@0P SP000000STh0Spd -LMK -LMph`@@@- 0P`7 -L  M0KA 1@ _P1$a0d CP@00KT0d  U0K 420 - -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ 0 K00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS  00CS 8@HTP@T U7`KPP0DS  0@p|l p-LMD`DP0@S 00Pt;P0  Pphl8 0-@ L08PS@00( 0R+0@00hhk -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hAp`0Z-00hH  ,0 S , H -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@h p`0Z-00hH  ,0 S , P p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0Scp gfff\ 0-LM@P0$@K 0 On 0S J0 d 0-L M@P0@K 0 }7V 0S 20 p -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@g T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShLD000@000T(0 hd8`l 0-L@Psj 0 0逼h p-LM`0PS@ t00SX 0@S  @00ScI(0 0S0 >p8`pT00C p p000C 000C?0010@-H 0\8001000\0 0100@-<00 CR,0010 BR0 0000@-8 0R (0P@0100 R0 p-L MP` 0@R$K0S ]é0 000$0s 0s 0 01$ Kpl0@-P 0S0S0X@0^! 00S 0SN00^0蜼 0AP<00 r0s  P᜼@-p@0\`0 0r0s 00000\0  0P PPB@ -LM\X@TLD@0 840 ,(0,p`h p-LM@k@`P8 0S BPl   b80  p88 -0LMK0K00K 0-L M8P0@K 0 . 0S 0  0-L M8P0@K 0 N 0S 0  0-LM8P0(@K 0 n 0S 0 H_ -LM@u q0r00T00S 800T@qr  -LMB@6P񟗓     <PXt1 p1RDT10SD1@18B01$1@0S, vpq' P0mp@q bQP@@ U0 SPO@@Gp q  (0\P8p0(| p-LMB@6PTTTTTTTTTTTLTTT$TTTTTTTTTTTTT@`lTHTTTTTdTTTTTTT,pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@t0 u SR?P@09 fp0 s2  0 _0 S*P(Rph=Pp0 s ph| |0S0S S00CS00S S p@,0RP phph-p08p3 0:S S@.S ?S  \SR R 0-0LP0CP@ Sfxxxxx0B0C2S=h`pX0 00 0 PE000 -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:g8p D0꠼ -D0L<080`00 ,0b A0 (p|(0$0 0b0c0A} -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00x\00SH00S800SSS00SP\H0S r0000000S0S000  $00S00SXļ -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVp< -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CV<D -LU0S, ,h0S000hV< -PlpL† @40SX qL0S>@0Se0PļX -LM@P>0 ļ p-LMP `@ (0K l0 0"T\YPP (0 00 pXļ 0-DPLP @T000  00鬼H@@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q<D,<@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@x@ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0R`@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\鬼00S0 0 TTP -LM@K=0s0s n0 c -Lr 0 0S0 h,< -LM@P  pP@unP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u T -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@TH|, -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P 霙X̙,<TP -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0@Hp@-`^@P  \\ 0S 0\ 0SP@Up^p 000| 000| 000| -@LMTP oDl< gdah]//0/ -81LMXH @@ K}C@ \:oU0  @`Pp&0S0S 0 0?00`0  X 0S L0DS$0   i|/d  -LM0$ KK 0 0 I P$ - L P00* -LML0K Ap@T0[S00KT[ -FML M7GNK, t7t@D @D0`PXX D'=p 20@FS339999999999999999x29999499x2999x29`4944999999999994(5<5H59999T599`599l59977799P886 R5 5 R0%<0uKA $P00Q0S Q0(8luKA $P00Q0S 4; 5p$5 k5 gtKA q$?Q0S 08:$000N000;0@008`4 R$ = KJ p pGJ HL$ 0 Ps /P* P P $0004SP0;000@P P3 R3 aP3  080@0 P8  Pd3    P43    P3 R0"< P P070$H P P060$T 060$P 070$L 0 70T H L 008rKA $P00Q0S  n0$000qKA $P00Q0S U0,0|qKA $P00Q0S l?0 0$qKA }$P00Q0S )0001 `bVQ$B~KpGpG`]P  2P $06P AY0-S Xx +w '@xЛc0ԽؽHн`ܽ|Ĝp y|}x, -L4M0 4 00[ ,0 ZP@K0@P@P 0L0޻P 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ B8#8L0 T3 M 00CS0|S0 00u P@7b`^@000<x0SC0S #0P X000 +זL< C444 00 0hBD@0px*d2 R  4@ 0SZ ,K00D 肢PPJ o7D080 ` 1B< @K0 00!P@$ P 1 x*q@ R xd*`1 RH@4@0Sp $ 1 @bTQ04  0QInK`F`F04 XPDDT0 sT pP, MK@D@D 0E0 )NK @t娄pY ,0 S ,x0  p 3MK@DZ@D(,+ P XZ W\ p; hcxضpT ,$L -LMp0R@ 0 P`# wVTP t"^K@0  0 S ,   WV1 ̹tȺԺ -OMLM|B tUdr  , u > ?K@KA S%0 B% 0UK 0 P& VOKH H Q *X1(K R qP0`S @a0 @PXa 0PS@TPP01PQ? % 5P P P 00P@00P0S P U 0, BQp0  ,q|UK@ ?K24UXD $Hd(H_<Hh -GML M!0p,0  $KJ`J*K@_ ?K0 K@_0ypX  0SS?A pV`P$ZW0 ,0S ,  P-L@ p0 Sp p `P P P4  0@Sp0!R -LlMȀ0@K pd$0 `0S" 0`C=UP|fT0@` @'P.UPd ' $0S $娝t   4ܻD -LtMpp, `PKY 0<< 0 @@WW |W!d㙹P; 0W0@ 0[?S. Y  KP )0@ S @RT00T0ST00T0S\0 ,0S X,MLCW@?W@F     $<D p-@LM&WX`D00CS0X0ӤX0 PpP x@00CS00Ӥ0 Pppu YUyUp  d\ D0!400   00!$!Ƞ ! -AML M , @t4D 4$ 0D@4 MBnKP4`F(K t0@Y.@P?/@@B@DRPN`,0 @`VP$@Z -@L MX &>opn003X$`pZ p-LM&> @`@UT ~NP PwU$@p$ -LĠ[D 0Pp`0 W ,u P00 -LĠ[D 0Pp` W, f$0 S sd -GMLM 0`p,0 PMK@D@D 0Pe0 )K LU -`q00 L 0p0S2 @ۮ PP#Uw 11>p `O11>.QQ$ DMO<L p?O8@X 0-LM P R|@|K  0S@ pX L@0TD  <=Mُ m0xp8, p-MLM`@0 0 Pᡴp* AK@@+0WP! T*AKAA 0r00000S  r\00000S 0S@\:0 S˔p 0-Q* rh000000S  r@00000S0S QQ: p-PLMU`x x0d X 0@0VPP0P?0pL p-LM 0@Px0`0X0S 00 0 0m@P @ p,L -0 SL0S S h0 hr -0LS S h h -LM0@S S a  h̎ -0L В -QLM,  10S 1 0 RA000i,  00S Sp1I0S; `10S7T1,@<T@@@@ ! 0Pp`S@1 0p^UPP$X U`00Q` e Xp, hP PP `phP`0`@H0 , ,0 0!0 0 000| D6z p-LM`~P@P 0 SP UT0  ]KP00@  Xp, -9L M 000`fS eS gS )))000P@00GS񟗳zzzzzzzzzz~~~~~~~zzP{~{{{|}~~$|~~~8|~T|@|~t||~~~~~~~~~~}||~||~|}~~ }~D}L}~`}T|h}~~p}x}}}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~}~~}T u$6 0 00 R6 5 5R95 ! 0 B 5E ,K0, R( P00R0S p AWp5 pEPX%00T%6 ,Kα0, R P00R0Sp54u44  44 4 G$4 4=$$000k0 0 0( l4]hh 0T4SP4QDN:30000E3 4<3   83 33/3)3 3$3"3 3338CPD3pP XP DC<3 c,3P0@S@# 3 *pp5X2P2U0`c TPV20S= "0S``F@1x0@S$"000T23<2 82  "0T13 0 d1R0S000  007P X1 P !<xp!X!0@0T410SPHV00S0  VHP0P p `Fvp 6`FvpWВl hcpDtx00x@pHL|,d -LM@PpK" (p P0Sʄ0   T p`p  00 0 $ -LM@h@- 0@R:T 0 S* 0R S R  :0 0b0000T 00 0X\ -@L0P00  q T00 0D S0<PP4 0 0PS0hX\`h8 4R00C0 R0 X`\ -LM@T- -LP p-0LM0Q 0R0SP  ,P`3S S S 08u P-P@p -PLM`bPP20St:J /P X20SR<<"0@S@00K 0` <@ @@ 00K@  0@@pK0 K"\ , * 1@ <0R0 0S B S@ < lP@t1 Z00R00S H000 810S,10S 10SJq0S 00S0I IP0SX\F@X00 R00SQFX 0S0S0SL 0Y0 R00S <00SDH ,DhdL\ -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 0>P10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR E0 0R00\h0 : -00C0t|@xDhdlp -@L`<P1T T0q4T0S` 0U  R00000ӑ00Q000 Q0 Q0a !00S  R<000ӑ0!0a00Qx -LM@Ppt ttt00S$S 0,p 0 0`^S0p0C0$3t0 S 3 0S00 B B0 0 S eP0@ [P00C0044   0RI r@200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, P0Q010S$10S p, R X00b0CS0X40h0j`C f0Q0Q a01 p00S  Rh000ӑ0!0a0 Q4St|x -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y7Kp20O00O4S  0 0 Sr400000S00S_S   P0S r4400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr200000S>00S_S:   P0S r200000S(0_S% 0S! 0R rH200000S0_S0 Sr 200000Sl00S_Sh  Us 0b00S10PcUj~pZ0O00O4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU, -LP q -LZPx s0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0-\0Q 0\ a p-1LM0`S@P,P10S U t0 CR 0R0 S 0@00,EP$10S U 0 CR 0R0 S 0@00DPU 0 CR 0R0 S 0@0TeL@0 00CS0 phV0  0pd3 -LM@PzA`p!$pF@K 0PDܙ$$$$$$$$$$$$$$$$$$$$$$$$$$ԙ$$$$$$$$$$$$$$$$$,` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$cp|}\z p-LMKzP @P`J011QhTZ P@Tj_EZpD]P TP`$! -LKM MCNK@D0@D,0 p$EKKPPPM.KAA3eP@4: S  S \H,0 S <,͉mK`F`F P@ PP  P@h 2 R_2 R BZPO lP4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K KKNN( 0<K @MP`! 904 1D MNK !0P 0 0Ax D{p HC@yP p @`PD@0 0Pd :fP $$  pLP:0P 0 2P T]] (P@T Ph5mK`F`F P8 |}h, -LMp(K>PP3 @T `W@ W Tjo(T"PZ ( D "(00(PZ ( D (00ThCl} 0-x0L0PS0@Q  eP 0S(0 R00 R0 P-L` 0SLnS 0@ ,P@l0PP@p` ,Pp@0oS` [z p-PLM@ PPpAP .iP 005P @Q T`,P. TP 00 P 0Sp -L 0KM#+ -L 0| $P -OML Mh3PJK@@| ,  fK 0CP=P P| =L0$\-PPL ,0<1 | cxp$(8< y -LM@%P T  Q q0@0  R\ RD -LM@AP T  Q q0@0  R\ /\ 0-LM0P00CSK @ 0$ ϓ0 R  00@jpc -L0H { -LM`PuP( @(K,pK 0  (0@SD -L M0@p00 0Sf P@PP 0S nSW =P0`0@Q YP QIQG  0V0P . 0' Y0  0000V 0`0 ,K, ?R0S@p @<0"Sl 0Y000 LPH00D 0oSP L\yty|yyy -L$M<@K`P(PD | P40KPsC圃 -0,0K * K#,pr ?0L:SlTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TTTTTT TTTT(THTT 0000S  @@K"p| @ <@6՞2000,K +K+0Se D 00y!0`VQF `Fv  PHPp   0z`Fv P@ p{P vP qP fP@D0S  Dp\0l 0 ^?#40K`X |cxpux<}} 4E\z -LM0@S\ 'PH "P8PP ux<} -ML M$ß0`@( ,0 @2P`d088 B~KpGpGP"04 0X 048"qP0 T  QPP KA >KA B0Ch048P480   ,2X("@  0h>08@Tk p@^ P+ U X@ 1 ,0S ,SKAA D>P<8C4P   Xs L>0O8QNK@D0@D(!`n4=:0S Y >0S:0S  yY  >>>>U ~48t=08@TBeTn  (|L|T D4~l~ 0-`0L@PT  P @T(0 R00 R0 t 0-D0L@PT  }P @T 00 D p-LM:`PP 0h 0@T  ^P @T0 ph  JpQX -`LPp@0   0@ -PLM  0Sl+nS `0 @KT4=0S@ @ 0oS0  ztL D  0-PLM@0P L\ y TU0}Kp% $E -L M0 40 (KP`* <2pP@0H U0S -Sl01=P APA!P@0P0$`P00`40L, -0L wВp 0 00 --L ^w p-PLM@P`l0l R ZT D0 Rp80<  0  <w*ВtE --L  --L  -LM@'9 h5 --L Xw p-LtM/P@@TK ]P0: S p0`rSf c 0-/L@@PU+D0 00k/00(+T+P00E -LUMpPKPi]P@lK8b]0S-0: S  SU iP U@P P@0 R000K@>]P h1: S@ ;c$^&9$!EEE P-L S|P  E -QLM@ |P T  t|E -L⍣P  F -LM0 $40  8  Pp  P@=  PP a`.W X X0SV  0o f88 0SV  04 P8 W h J;W X0 8ßR030#00 00`QX0 ,K Opz Ÿ@T 0S @T^ T ,  B4pp PX^^K R0000 0W 9 00,80 080  0PP 00  B 0S00C0V 0R0R`V` 0S 0S4P  0S 4P {{{  0,<Pp  0 :, 8 R" 0PU 0S  0U  0PPU8784P00`XKc9LL %Pdx D/`K$D -LP@P : q00  R.@P*o`p@T  P0 R @Tj@0 0 000< @0@000eP`* 0-T0LPU @: @T , :@T { PU0g -LPp @`T DP @T@74 100 00 @@m  p-LM @`P 0PP ,0 R ;p 000p -`LMP@4\010Pp`!0s ?S mS 0KPp, Jz0 PbQ VU UW *V  het 0 pR0`0PEs- DВcp -LM0@0cSZ bSZ4 `K 6 0pR R  ( 0 P `V | $40"WĂ,(0 ("4S @ P  (Dd, p-LM@PP`pP$0S`9, -PLM808 4 $@,  sВ P-L 0,0, ($9 0sdВx -Pp@LP'`8" pd@" Pt1`11111a Q@b-1 |1 RP xt10sL P . @*P8 00tp)s00n,)p} -43L$M `R@P#TTP0-S & @P񟗩 2 @@KDKp  0@ < 8@ 4@ 0p ,@ @@PPDPn@0S_V V@ *0SR 20S@T:yx1LP0S   RR 1 R001 pP%|1 R\!0S0  D70S0C00 z74 -8k740 R \7wP` 0  @@PD0lW ^ \L X@ $<Txq -LMA%QU ttttt,tttttttttttttttttttttt8tDPt\th@0  Q 0S  0R 0000Ll@d@\@T@@L@D@<@ 0D@LHP\`TX -<6L M P,R@`,P 0 4P {0gS 52@DT%U0-S 50 , K P5 RP xxx%}600@DT`5`%0Q4  S4  040 5 s 54 PppRp@300 @PP 303S 30S4 R0S ,Q  0S ,0@ 0gS 204` R4<4P8$ 000#60SU V V86U7V  6U00T00S 3 R350@S $3 R 0k\5X83 b0 0, K4 [0@,SA4l<lDlxl ,@HTl\dll0 0@2 z|@T , K?4 0 @T  2@T t!00000@T  @T 00 $0 0w@T {$1 1w @T  w{@T Ndyyph0$ @T {|$p D$<0q< 0P -PLM@0P@ 0-S +@P 0he000 -P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S  0-LM@0 S  0S 0S0S0SP 00 S 0 S |zz00 K 0 (0 $0 0 PDPU <P , 000i ) -L$M şPpP5 d E0@00R0D\dltTH4P @ gPU U ğ 000U000DS񟗽x,HKLK`d 0D@ H @ <` 8` 4` 0` ,` q|P5L R-0S  *L' R R H0S U 00S0S 1#$0$0 0 00Sh jP 0H` 3|P Z00U @ ᭓P @P Z0 1`V@ 0 P P 0 ( "# x<P P41 R 8  $00dT U J0Sw0S s0 w000l\`\@TL` i@<Pd| -LMPS@00S p SpBT  0ϒ005Q^` ^ T0 U   ?V090 ?/0  $00Q S l0 \0T YdH 4hLX -LM`@j/pQP,p  o&QP LP   R RP Rp0S0C00 UZ00U 4/Z B0P 0)/PW 0Y  /X x/tRt/h" ,P L/H,$04 L 0/$08 L /$0<  L z/@0A}?#$ !@ L o/D0$ }? L !e/$0, L ^/$0( L lW/0Q#$0\ L N/L1 R 0 0D/,! 00CS00  ä0 oo< 000`00$/u RM RJ0SG0SC R, @4 doK XH#`tdH8Mb@H@Th p-LMHPH`@D.$ S0.  M L@phd Q-L`Pp00CS00  ä0h P@. $0p0CS00  ä0@@<. 0B00RPP (d@ Q-Lp@P`8 \5 0LW3D 0V C,<R 3000` \ 0 CR 000 \\PV 0> CR 000Rh0 R \0R \ 0 S0 S 0-,@LP0S P@0D 0-LBMQ0 0C @S O -x 0S ds0 L x 4F/K<  d -0`PL@ pL 00B S0B a0BSWBA0BS7BR@P,,` `Q:0e0b``` -L@LM "00P 0;0[h$ -LP$M@KDK`@  0@ < 8P 4` 0@ ,P PPPp-DP mPP$ 0  ppPD0ph*U U@ *VL0 0S 0@T:n} E4D -QL$M@DT6 T- T$ T0 T0  @ 0@ -0 R0 R000 R"x0 R"ddd@ `D0\@, D @0,\dltx|@-@T<0 1  0B0R \ -L@Mq0P 0 L@ 0`S os \ K\@TT9 0S0N 0XS0@  $H ,(AQ   ,$0  B LR 000KJn,00CS00  ä0 0S cr d0R PDP0 R0080 R0"0 x$,d8@(HP0@ S)H|||||||||||||d||||||lt|||||<0S88,,0(0$000\nh 0-L\P@ "10Q0S aT0 R 0h+0 0h+0h+Q R R  00S "48<#800000Sng p-L,M` 0@@KR0 P !KT*00 R ^:00+ 0S qp  p-L$MPŸPb0 S @0x Rp 0S$PX(XXXXXXXXXXXXXXXXXXXr0 S \qp"R 0tt!d` ゾT 8PK0  0 80 40 00 ,0 (0 $0 0 S08 K70K o0 [R R/0[0S Q"[-K"48<#8 0 .K/0[0St,`EdP0}P 00|..P ,1r| (` 0-PLM @ @T T ,|t0d0 RK %9PP .P@  P@` -T0 ML\@4 <@P , L p-<4(LM<Q"4 L0`,$,!$#\@!P0T0Q00SA1T`U +!P`V ,孽pU(UU $Ġ$ $< P$Ƞ$$< @|| P@ P$Ƞ $<X HP$<< (PZP`` -p2LKM@PHK ,@ `Upp 0@CT@#V@PK^I \`D PP@PK00PW @0S <0S80S40Sx V$l1ROK RH[  <$P0,(!p1 ,0S ,o 0 S- ʀS S `V0 00S SpppS SpS Spppp `L -LM0@0CS$$$$$$$$$$$$$$$$$$$LThh0 h!h#0@-d Q00XB.P@0L#"\ 00  P0S:00A0H -L(M 0K"[["48<0#Q02K4 2[S2[S X Z4 0,,,!X,@K GP qZA <4(<"4(< p@>*4@8 <#8  3 $Pp p+[*[)@[(P['`[,0[p P@ P`00S W*00SW:$82(0j4@tH -0LS00S4  0S h]JhY0 dS, p-PLMP@a@A 8勱00!S 0 僱0!S0 儱P0 s 0 p@0S P 0S0Sx0 Z R 0S lZ`VP 4养 @0 <0 p%(ܟtP**x -pP0@P@TL`% 00000S 0T 0S0S\hNTH 0S 8, P@`(* 00V0 00Nx 00F - 0 Lհ0 %* - 0 LŰ0 %|<* - 0 L嵰0 %`* -PL0M $ 0 0p0 0pS`! K$K3P 0S@! K$K3P 0S$0 1兰$0P05P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0Z $0$0QR  0F$0T h%*$ -CML M% P` , \ EK@A@%73P`4 55 T`4 |5 t5 pd d`50S y R<5 t 050Sp `4<4Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S 2 040S 4$4Q T30Sc0 0S30S S0@03P0@00` 2P@~d43@\4XT30SD30S `43P 20S`4 `4 20S d 2@`4"2Q\20S@Xb0 F0Svh20Sr TR0@P0L{3P0@00eENK@D, `4 0PX4S`4_MHTUH 0SE 10S< `4P3P6 p10S { T10S  <14!41Q ^@10S@p0 0S00S `0@03P0@00P 0SEK@1\4XLd'@0  ,0 Sh,k %*$$*x$l$0 ,- 0 @ 0^ 0T,p -AML0CMP00 , 04 4 0P004@@S`BK@ A@"1P 04SBK@ A@"y1P 04S44 2\443PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44 44D10S 44 44V 44BKAAOFV P44%"/K0 P 443p 4SP44  RQ  0|@_h0 Xe0 ,0S@,j 0%**x$XTdl -L7@00CS00  ä0 20S t00S h@h0hP`0Xp01P@`p`p0$0偾%$l$ -ML M" P4 , 0 ʂK@ A@"s0P 48 2Y2 48K t2@ l2@@@&PPW H墾8 @7p R 2 k 20Sg KAA2P1 *[48f1PU 10S  BK@R@ r100000S0 R0t1000ӑ0 RBKA00AD10S l ,10S  Q10 S`0 ppo0S00S @Pp1P0P0004 0P@8"80@ ,0 Sd,i t%*$*x$lpd$$0 Sп -LMHCD\ <<3|8#0 ,冬 勬30S@$0S 2 sx1$2r20 \0\2 UŸŸ"2L2x2`l2P`2@ L06<242@ 0 *2 #21@{ 010S !110S !11`X1@T10 |p1pqHh \1AT1T \|00<ث0S(۫0@T Q ɫ0@TP0 % D$8($PXp||P*l * *Dd)$%$$ ,T,* p-PLM@P`0S00P x{P00 \sP L0 DapV 0 Upп%`x -0L 0* - 0L0 0 *$ -0L 0t* 0-PLM@ !0S000)P0 P P0 K ȇP00S0 |0  |0 0T0 HPH@IX 0S40 8ߪ0 %п$* -0L D 0 * -0L 8 00* -0L , 0H* -0L 0Xl* 0-PLM@P\1 T咪 NP@!0S000!P 匂P  凂P0 T]0P @,㪴0@0 @0S 00S 0Sh0_00`0@0 P\04@C0 00 0%l(п@$PX* -0L 0* -0L 0* 0-PLM1@ "P0    P K ÆP00S 0 0 00 0S000hPt 0@S000008,0 D0ө0( S0000%п$*@ -PL M   KK,P 0S0 0嬩0 0P|@0}S t00S\0h0\P H0R@0 P,0  \p%*&$ -MLMp0P 0 00P0P 0 f`.P0 cP! ANK @D@D"P X0 \FP! 80 Va 0S( >f %*X -PLMd   KK2,P 0@S 8080 (0 0 %* -PL M0 , ,K0K0! ,P 00  11 00 1 0 E4 ڹ$ R0  0S 00-0S 0S0@0S 0P0-P0P000 ,P0`@4@t%*$ $l, -PLM   KKʨ+P 0| SKKʟ+P 0\S T0T0 偨D0 00S$0 4@H%P*p -P0LM0P01@0P1 W孲p 0\``P ,P0 PᕲP 00|S ,P p,Pp0  X0,0P_U h_(%x*p -PL$M0 , ,K0K!+P ,0S ,K0K! +P00 1, 001 4  4@ <P 400|S 4K,P 4\,PP1 00@ <1 41 &< $廸1p0S. ,00CW*Ww0a050K00`!50K4<0pS0@0S 0P000+P0P00h00S ,00CW<4@0 P,0 N_t%(*$$l -ML Mq0$0 ɸ`ŸPP@P@@T㷸㴸|PP 0S`Q/"P@Lq@BnK-0 K@`F4!0z 吱P+0 K0 10S A4 #X00 t o0  YBK@-Pfc`Pt00P@ $0S<$c ,x%,* -L`M|q Px t `tKxK\!)t0x 0CSD1 <ͦ81@0P+t0Sx0t00t0 x0Pt0SP带p@K O̳`@x0 @t00t0 x0 `P \0|坦 Vt0Sx0T  P0 0S< c  %*DLX` lt 0-L@0LDP0uP 0000}S$0iiP0*% 0-LMMlPANK@D0@D0 P DD @0@ 0S$0 =c0 %* -PLM   KK4)P 0S |0|0 l0 0PH00}S <0<0S 0 0$ %*@ -PLM   KK(P 0S |0|0 ݥl0 0PH00}S <0<0S 0ҥ0$H%*P| -PLMX   KK (P<800 娥(0  '%* D -PLMX   KK ʠ(P<800 冥(0  %* -LMM0BNK@D0@D`+,0 姯V+ቲpPP00U00S BNKB.K@D BQ@D BQ 00Q+a 煯iPP00U00SBKA0A@-0K=PP ,0S,.b , -PLM   KK'(P 0d SKK(P 0DS <0<0 ,0 0($%* 0-0@0P 0 0RLP0 0-0@0P 0 0RLP0,8 0-0@0P 0 0RLP0HP -LM4@0S q0SV 0-T@L0LPSH P40,0P 002X$H P- L<80 {,0  ]h{`%*xl -L-800S% (0( 0S00[$H* -PL M0 , ,K0K!X'P00 1>=00!p4 tAt<.d14  40SDAL 4  0S$A0(Pu`4  0S 0PU @_0 PP@ d ,040@ L0 P0R  ;q%*=4H* -0L A 0** -0L 5 0 ** -`VLt Pl@lph000季000H000ڭV ,00hЭ *%)@-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00@) 0-PLM  1A00J P KKK&P 0S 0 0. 0 00 P0 X0@0S 0 S  @L@00D0HD 60 S , ,/0%$(0*$% p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(ԡpp%@%L -$0L \0020ph* -0L % 0x* -0L  0* -TL P D00}S8080S00( P 0  *%$ 0-0LMS0 lKP@tPu @0 \ ,0c0V000%TW X -L MTr0$ S( D P8"$K(KL$P $0S (0 2/ 2 10S1-(0a \0S1 0 11@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0@t0 S@  1 0U UP 00PUP00CS00@Ӥ0~@ T tt 00CS0o P0 R0@0庠`%*l,  0-PLM   KKʨ#P 0S t0t0 加d0 00c%pP@0<u   Pu0@0x4%@*T -PLM   KKs#P 0Sp0p0 U 0t%0sK0  ׉2R( 0   B 0 x4%@`* 0R= hp -LM00 @P  0 0hpx% -PLM0 ,  !,K0K!#P ,0S00 00 8 $P0 彽P  0S 4K♶p `0 p吀@ 00 h04dP_d4W00080SWx4@%*xsT,d -MML M<ğ P,   % OKAOKA$@"P4  S0X C4 hP@ 0X30X 4 3兟3 NKI I tt#庩1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 ft4@iQ4 Z% P 4("  fb4 E`000SP0S0q000p`11`CP 0S 10SX1P1 1h10S ,A0 D010S 1U! 0wV BNK@D@D0!幺x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 PD4`$0RD4 D4HSD0`$0Sr` ,0 S,0U #@D%В D@$ DHpl*Q\ P-L`7 $OP@  0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00gLp000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@ -LMl @o0SX  o0S<  o0S$ )0P 0t -$LYM0@,0 4p@` [Kܹ عp4Kl  0h d `A VpP4"0L@K嘡P ᓡP $LK 0ቡP#LK P0vL0[S LK 0VPU u  = S3 p1Q,,d\EpAP#P3T N p10S S_K <;P,+2 7P`آ* ᐼPP 0S U 0S S_K <P`,T~v Pr <P`@TV n1 p mcQ 0pt1 @ m]/KpA PUJ0S x ^?K KPEᷤxA00pᱤ0dQS PP H10S 08 0gPP㴣P | _?K,P00S p0\0 0 ,0S,CS $-tx3*D%} H},p+P},p2- -LMd@ 0 0CS00ä0((0 0 S %LP+ --p1pq0LS00`& TATH 㲑P8 4 㪑Pە /00CS00  ä0 V徲P@T0  ! @.崕妲0 |P0PSTL%  (24*@wX$X -LAM M8B>K0C0C0 +,  %@$ Φ p< 8 4 BK J4`J Um0@S񟗾HzHzlzlzcDP 0ZtDPp 0PB=u04S440S (D(9+$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 X30 CR 0R0 S 0P0Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0o4$RB>K 0C c R+#$姞8Q 00 S Y44044 1V 0  <岥 0 YR$ 00S <$`0RR0F<,0 S x,@Q<㕥 0  l@w*2\%dH*k,.$L -LM00 (@(0  L%, -JML M0͟@,͟KK`$͟VSp=͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$ѓTU< ʓ<@T $e t< p<R`<` D D D D 4 媤P`# <<0S $$<0SLP004S4S 4S;04 04 םPL; 4 R`T0|S Τ$0@D4  4S$ ! 㽤 *0S:`4 2kn 4S  㦤㣤d:IK4 4AAP4: S 0:$p/㌤㉤{HE>K0C 0C)00P zw4S r4 S9T 9Pz PpI 0SG UP PP=D9`0S 0CS0Hn` 4@90㔯pq `v  4S8P@80<HP 4TSd8P- 84 $R P&   4DS7@$P 4TS7P 4S 4  4S  ݣd7 0S k0CSh-ppS7/4 Pp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00K.K 6 B B Ɵ0O4Sʸ4S 4S5BNK4@D@D+i*P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R00v4 00CS00ä0k4ҮV W0 S |4 VOh4#0 CR 0R00E(4嬮K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00 <3P@ 0 CR 0R0 S 0`02P@ hp` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R002 00CS00ä0140@ 40@ 0 S1 ,4$St1 4RwYV4S2  P.LI4DS0@ A10S$1 "@P9004S"G4 S0  4S4T 0S0S ,0 S,M$ %$xp,$H40( ,LX*T ,,4 -LM00 (@(0 傐tyL%@- -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` 壚PH H0S > 0RS ,0S X,00-S \>, T.Q@>D '8>0S H0S ,  .0 80 R@0  D0 H0 S  L P! =0S =0SNP`00@0S@T<0S<O,= p ,=p.LED0@0 @< X, 2PS ,00|SO ,㥺P@/,< @0S 0 S , @<= T00,0T|  T,p ~T/0p0WP<0S X0 S,P<0S K0 S ;0S ,p , ,0S HQ;0S I ; ;RAO@;PL `PH0S \ 0S H fP 0S  ( ] YP@ 4 40S pW%,嗙P:00 l:p) ,00|S 㑠D ,0 00S,|  *0S:d: ,3j0 00SD:, O80 00KP0S;0 Z0 SiPFFP0@0 @.0: S )0S009 H9@T 0DS0 0S 000ルQppY90  p@w0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00|7XK |ǟ0OT0ST0S X0ST7k4077 &P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00`6 00CS00ä046#V0 S5 W W,`TV 0S 0 jPPU 0p P@0S@0 jP,80pS,5p05 080 VP00P0  V[5#0 CR 0R00`4Ǫ4XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04  P`L0S 000@20 0 CR 0R00V v V 00 CR 0R0 S 0`0<3P@ 4wp`P0S CP \|bd30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00P2 00CS00ä0$2400@ 0 Sp1 000@ ,/80 S1p 1p080@]<ZD0SD U4Gl@ RH0S R0S10S 8 d1Rp 㰈00 0,K0 p{KTv> 0$, D0S`0d0D l00S70 @ <$xd%$ *-$|0(X$!xT ,dpLDHqH*P4 0@P@н@80S 00S08040S4l 0S0SJ@㰝<㭝 -LM0 S 01 `0, 1 a 0 S00SS o |0S$ `͟lP sHP < >|00= =0 >K ʫP 0S S0 L<0S$ L0S la < X嫕P(:$:a?B1cSQ8 PUQ  U@ 'jKiKKgK qK mKo/K=KnOK@ PW1S_1S\1SY 8 垭!1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpL0DS  p[ EP1S00 0Sd >K壩P@0S S >K  呩P >K ) 儩PL}C _P030 >K mPxgXC0r/K1 P@S[PTQ ZOK3(`K0S S 220S3 20S/H3(KKoK\0P1 \ S_K <@@P寥P 0hP R `2 0S82  <2DX QA Q^ ^ 8 0@X@A)0@0 0  $         $ ( , 04<8@@D  ! 1S0s`0a 0 \^$1  0S >K  孨P X@F0P00  ,0 S,Ep+ (p-H}T$l*gfff%tl(tP}~-H}0T,P}x -0L,MP؀0p0U$0 D @KD K `i@TE00?[\H0K @H 3P<-៖ $0S $kEp p+H -LM4 0S@0SA@ -L 000L -|@0Lp0呙T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,SBΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10    0+11b0b+ ++ 0S00 L$L-p+,2x$*)$% -LM`@00CS00  ä0 j, 0$0000f%,+L -DL$M0D ,0 H 00 @ 娑P4@ 3#3Q040 3@T 30S 30S@@S0S:P 32t30S \3d'T3 0S44P(PP7fc0@H ,0 P@ ,Yz00000 4D P`B000]Y,;82`D H0P҆.4"0@0!P 20S @P10S {Q0S 0@T4D PK Q0S1Pb0S0@T 4TD P T0S. +0A0S1PC0S 00<K0  <0 K)P/00S0  ?00S" 0,0S@0  dx *% D*\l+Pd$$,', 0-h0LM0 0PK!K0  ߫@T0(0 T0,* -/L`PPU1 1UװU/0p0W 0@+-.0PW0PdZ 9X0l000Pp 0X0U.S100E 00EPEW $!X%|\ -LBMAq0 S P 10S1  RAnK `F`F0X!P0 0fP0X, 哅厢10U B>K 0C0$  0 K(4 0BK @@ 2Pʰ800S0  HU 0K0 +PP@00S 0S8 ZB2 ,*\,' -BMLM07,',70 $'$7$ H , 'P  0 S606+ 6PP6@P6vP6fP6І@6@@PP6 6@6@̢P@ 0S WPP tPP \IPP HCPPP4$0609P5  堢&P 0S50U0S 50@T@剢PP@ 0S P P  PP|Et5P 5  `5X tP U P e40NBS񟗕`ht$̾Ծ4  4K#00#0H3=0 0 0 =l343 5,3 <3033 ၎P#h3% '2 2\3 2L30 rH300000S 3vZ 3 ݮ3  l2 0"H]p]2202 2l0 2H H ۳P AZP BNK@D@D+T2@ D(04SBH42P 10H P4嬔P@ 5  H@1 0@$ D4 < 8 4D 0CKdAA A0QS R  1h1 哃0S 1 (xP@@T ؔ Ք@ t*x$lp($*$xfxВ$ DЈ(08 $% c(<t\p$ *$#t -L -# p-LMP0` 0S @0S e00@Pl00000S T@0S I00$0 $ 00`p2HH* p-PLM 200CS00  ä0 b10S AЂŸAQ [P P^ @0 SP00U1P`1t层0X!0CS00Ӥ0Q PB p?0a0S Q00Np@ P 0S 00S0冂0  00S 0S d00 CR 0R00 \0R T㶓L ph鲓%$ $*Pp@-& @`QP 0R0S  0R 0S 0`S`PQ^ppp p-d d0LM\` X0X PPP0@T000p$*2p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p2zp -PLMp(M1@ 1QQ! ac0p2V*Q 0S 0S H0`2V:6 iYP@U@p`0` l P \<40< ,PEU$%@Y <Xt -,0ML  0 3В -MLM , % 5 ĞP@ " 0S  P:? |,B^KPEPE0d%0T[P5P0S4<RNK@D@DLWP,KR5( K·.P褟 P P  QC Pd XP TXP .݊P@ XP  `XP00c0S .ȊP@ XP@i  XP0S0@S񟗻P %PV_5"ÊP P t床P L3YK0AAP5?P %0S2_52YK0AAP5?P{ 0Sw_r20S} P Pl4pp00 P  RqXr0So Lb11@P@U pP ` 2000 pX 0 P0 1pO PpK 0S1 0 0D!!00!!00 00da11 @`QT $1p+ 0 S0TS 00@T1TGP PP6@P00<00 ,0St,< (\, D`\$,h` %P p-LM a00` xp 0@ PS,P ppP"P@@\P0b _p "P\P0V Sp P P P,P00Ppp8@0S 光P 0S p\` -LM 6@TP 00006P 0-0 L0C@R P6P 0 Q000 P0-L@ 0S Q 0PU*060PU:60h60 -L MS( 0$ S 33 P$K(K"$ 0BS (0 2~2 B0S22R(00S(0 2P 0Spo+P 0S (0PP@20S 202 ~@ @廈2 @嵈2 @寈1 @婈1 㢈1P0S1@1P(0 z1d0S0`0WPV  |P@pl uP@ 0T.S@DpP0@4!1~Tp,, yP 10S11  V  `0 ~ R00 V   yP0~ `%Ht*(*$|3$%(*P*0xX.. $* 4@ -LM,Qp" ,   /K?KKP2  2S 2S&20S" *NK"__K3,/륭P O_Px202 T2X"L2WB 2  @22 2S&P`3CP`V   0~}1z}|@KP!O|PKVᗊP@|0[S@TB qP@2SG |eP@ 2SX: PX@TXQ $NP W00S&p0P  l0 0h` 0@P0 PqP@P 0T,0 St,: * !\t% DXxl$$*,\ -`LMpP 0@T0|0 | 00@dP UP @T0P S00@@0 800P00% $* -AML83M4ß@0T,0 p0 3 0S 3@ SP @0S 0S 00@T@0S@P@ 0SBᗉ00SP/S  0 S R?|DiBnK`F`F+ᙆ00S/S/00P+e&P Pꫭ1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@D!W00;0SX000{ |P UP@>@ P0@0x0 ,0Sh,8 ! !(8$p,*Q.\% -MLMpp0 S( P`L Tq0SHHA0 @{塘BK@@$!TP9 1$K R01000ӑa0CS'0t0w{ 0 \0g{m{(0 S4(d8l % x( 0-0L0M0@PKS@,  Ý0 0S\@0Srᓵ 00ZP7  0 -LMp0 SԀ0@0P`P ?P (K](0`P R rp000000S`P T 0S8@,z C0.% -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p ~vP \1\z000 00200`KdKhK\0KX K T@KlK D, l0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 lhpP X0S 0h nz00P X 0SH@8jz u0*8.@%D -MLMBNK0@D+p$0 ~Ċ`ᒄP ^KPEoP@t0 K0/S I@ uP0S/S$0 S$7  0-LMH@0Ps0 K|p 0SPP0wt@ -LM@P00s@ -LMH H0q,0 FT6&6KJ60S |&Qp6\Ɵ  d@ ( A@ _P$ @T@dTd@K0 %50PCUڔ5 raఆ@ ᭆş@ş`g0%țp `P`Pp%5VF%T5UWPT  ᇆ@ ᄆ5@` \ B0%@P蟛0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 jP@@j/ /q0 o%KHP;%.Kn3/C0ur '@ $@`0#E @ @`t#:%KmT3OK0ua2g 2crB0@ #? 2cc#aw0S0S%NK/ )PڄŸ0 S 0S* ݅@ څ@" <2S ҅@ υ@d"`N !Pข1P@賂%K p0 p%K yom1Po0uv ᨅ@ ᥅@`0!ƚ ᜅ@ ᙅ@`x!Ớd1OK0uf2g2crE0@8!?` 2cc,! G塚OKwQ 0᤿H~㥉HP 00CS00  ä0 ſ-(,0 S,15.A TL*Q Dpų(%8 -x3LMp 0@@,0 KH3H0b0P a  B=9 = 0 iP@i/ o0 nK KP@/ (P @K o#QP0吠KS0SLŸ HŸH2@K00 ǁY~/ ~/ n"ŸP@Y00 d!p\P 0SL0SI@K]/ (PBڜ R>1 P@@PR50S1:PP@ ᇁK o0 @K{o Mngl 1@o0ef2f2c BDzP w0Ϡ#PE0l 2lADd`0 @叙@Ke0 S00<@,0 Sh,74.A>P?  DdxTų% -LM0`V *0.0`YV@: H1 ᦖPUP@᎖`VA0S,0 :p0AT0v 0S :000CS00  ä0# e  P@| 0 @0 C\0\00K T,0p0S,0 `VL*% -L M_D00 K4@p( P0 1[SP00N@%ht@L* -0L M@K 0 K  s -$4L !4H88<#8hH\0%0@@H0804 m^AL d Al A p-LMH0@PH 0S 0SDH0a 0S6 0 *H00,H0gH0QbPH0  S00H0 0XbH0 0@000<H Q0 0H0 H 0S 0S R0 0H 00H 00 0H00S UPSf|H0QT{H 00H0P & 0D00 ph A  t < 0  4   -L M00PH$c(0 04 SSpb  6#0WH 0040S<0S 0,Q Z5PH0 , < H@0S 0 0RpGH0dH0QPD:H0Q,H 00u80S 6"0 {H0 8ᣋ80080H`! 680QڣOjH0 8哋@@8@H0S d1 80 0S0`0808K uH0SS 1 0R0040 070K080KC<3K0S0``0S3 W08#8#$0$$43[4#DHLNj$H 0H0%@~H 40880  (0S8(( Ad L l < T t  p-L MX`0P#DHLᑋ$H 0,PH$0%0@@GpA A -L~KM pGMpG`P@+@KH!@H0Kt6 xF 6U 08i S 0 v>  0#iR 0 v>  0`iTii2Ap(<HTh H p- LM0Qq`P$0  v$ 0 0 v$0000  K@ $K $ Ru(K0 (0 (  0pA -p`0LH@d0&PR6= 0Sx6 pG6 6T0S  &00 << U $(  hALt Dt -ML M P, ß  < 0BS8@<K˅<0@pK@0 @G 00T`K0T0 S" D 1 S@KHK0hPK0h0 S Xi ( R $ R pzl` Pg '@H &PR 40S0@P 18SKl/x///8@4DH0 &0@冡< 40!1ZsNK@D0 @DT4 H08 6 64 1d1Z`P1\!sNK@D @D89'H04 &0!/0 04 R8@Z ZK'P  0  '7` 0V' P7 {NK@D @D0h   T,0 S@,$ Ax43 -LM( 0R@40 ,0 00  t, $P t0 X t4 , K 04 (pK0!=0 ( $0  `40`V0 Z0c0  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0A4A -LMb0 @ 0$0 @ tp$`KP 0 0 $0 $4Qc 0( S_ (K(AA,D -LMb0p 0H0 &f@ p $@ GPP=(p  (KP00P@@TP @,(@ $K Ԓ #([AA `lx -1L M0H`s6p0@S 6  hbP610=S 6p1S&P N0AW2PlP@@FFFV6 1 Vs@ s0@s@@61S @0@$S `Sss0T` : ls@ is0@es6@@ 0 傈A 0-T0P0LH@60S 6&016P1S060A-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@ٽpTT 0s 帽嵽>00pA -LM⁁@P4 8 0 4 8`@U=<=<<<<<<<<<<==<<===========<===========<<<=<<==<=====<======= = = = = = = = = = = = = = = == = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = ==^@Th0R0pW 0<G 084pj0>00$Hl -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @ 0-LM@P@ .R r0\00000S0S0 S0 S K:PP 0 -PLMpQi@0T1* Rr000000S  0RQ 0 UP`F0'S"S $S `S \S`F\000`F0@0T:V002~@f p-L M`PKp P ,?0@≅壻堻坻&$ PK0  ` 1Knp@m0<ST 0 pA  -1L M0t!H0 F6 <00 0< D1< ,00(1   00 1  1K/ P 0`P p̌0\|0 00 00`0`0h0o>P@ ,PK 0s > p@0PA  $ B -LMp@ d@>P@ K r 40R ,Lbp, -LMc0PH0 pK F]  @@IP񟗫EpFpFpFpFpFpFpFpFpFpFpFpFpFHFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFpFDpFEEEEE(Fx"[<00@0 R$,0P0< 4 P0<0  c<4 00 P<0 0 `0R<00 000<0 4 x0 <0000<0U  -LM@+0} s0S 0 0 B 0S 1S 0 l 10@  ,h -L M`V Q0, `*V 0X  Xxp000 0 STAT1 D1D<1 0R,0$ 000o08,0Q4ZsP@0  w4@0p0sP@x0 40 tw0 ow00 000 44@00`V S:0,  00X -L M, pj|Y0  Cw`, 匁00S" P0 0a00 SU0`  U@@`@, `0  4 wPU`4\ V00Ƿ0` 0 -L4Mlǟp, XP T Xp @gY@8Z,\   , \ !00 S T0S 0 X 0LKX 0 0A0C3Sgj|kkkkkkklkkklkkkkkkktkkkkkjkkkkkkkkk|kkkk|kkkkkklkkkkkkktkLkX 0 BT0 X 02 QP0 0R r50000S  Q QT  x0: p 0\ T 0T0 t0 0 K0K p pp0  !0 0Sx W4  0T|00 W00S4 gTP xT TQڗ Q@4 aLtT R ZT Xp WL K0B0C6SXooooooonoonoooooooooooooooooooooXoooooooooonoooooootmooodoPP"00 0PET1* Rr200000SP 0RQ 0"z`PE0'S"S $S `S \SPE\000PE0P@ 0T:Q"00PE00P 8 #" @x ybPb  0!yzpPTP`@/ 08C8 08#8l!dzpPP`@<0D!0K0C 0C1 BS 1S5@T0 ,0S,j P0-H0@0 80840400,0 B3 B32A73BA -0 0CS00LӤ0d ^00# P 0 000t0 00p PPQ8 00C 000032B3A733 p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00p33BA23 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 0003B33AAA3 -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(0003AB33BA3 -LM@p P p-LM@`Pppe UP\PP "P H0D0@T80T0Q@D0   0p33 -pL`P@xP000PP px0000D0SwX0 L0@T<0T4@D0  0333 -pLPBo@P -P_P p0 00000S>0 pt0 000D\0Q`T0@TH0T@@D0  , 0h33 3 p-LM @R`pRx90000ӑa0CSTHzzh{{| }x}}(~88d~~~h8ĀT88@[-PpT-PpM-PpF-Pp?-Pp8-P|p@t0-P p\)-PLpH"-P8p4-P$p@-P p -Pp-Pp,PpP,Pp,PNp -P 0S|pt,PFp` ,P 0S@p @8,Pp ,Pp@,Pp,PCp,PMp@,Pp,Pp,Pqp@,Plph,PXpT,P[Dp@<y,P p$r,Ppk,PERp@c,Pp\,P6pU,P/pPM,Pp c,P@?,Pxpt8,POp@X0,PHpD),P4p0",P p,P p@,PAp ,Pp@,Pp+Pp@+Pp+Pp|+PKpd+PTpP+P@p<+P,p(+Pp+Pp@+PQp+Pp+PEp+Pp+PGp+Pxpt+Pdp`+PPpL+P<p8}+Pp v+PPp@n+Ppg+Pp`+P:IpP u+P@Q+PpJ+PJpC+PSph<+PXpT5+PDp<.+P0pp'+Pppx$OlF86=@?LM\7l9t"*IC:#!_5 KH\%$'D8@AP1@\l,;pB|#̙N&G{#+.23>sJ /),4E@ h!-L4Xl 5 --LM @0| Nxp 10S \_T ϙH ˙<10S ,,rR$dob=9,`K --Ll i0T T[NLD 1D080S l_$ 㛙 㗙=9,`K --Ll C0T T5NLD 1D080S F_$ u q=9,`K --Ll 0T TNLD s1D080S _$ O K=9,`K -L`@P pR %R0mSQ0L !tp` PD"@`PT@D ń R00, --L@ 0C<0 ]/P@XGVP@`<?TY#0@@0 J/P@4C P@-TG#0D0 8P@"T<#0H0 -:P@'P@T,#0L0 :P@ hP@ L;TT#`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @t//l///0<0T00p0 0-LPfP@4 0S0 P00 p-RLMP@` 0S(0 i000p0 p-LM`@ 0 ctPPh u 0 0bU *H{ƿ0#S ¿0S uo ph000 -Lp`P EP@HY tT<U;t 0S 0#S hH1$1@1 -MLM$0KA ,0 `hQR Q Q d8 S)KAA ld8 S:qXlPP qePP0 l(KA Al K+B 0d(0Rp8:spP@ OeP@ p(@>>K0C0C`#8 md8! SD5;<#iKA Act(d8!M@S:rtP eP t( JKA Exd(0@R:q|xP dPT x( ,KA A&|(d8@S:r|Pp dPpz |(PゎKd8H@ HS( l;KA A01(81(Rd8@ST:rVd0P1(M (PUڈ< 8 M  P(1S>K0CPU!d8PS* 0 ( hX d8 [P@t KA kKA A e{4 0 ,0S , P140l11 1 P-L@' 1a 0Qc 1 #'PVP Qxh!0 PTP [R@ 0O  q0 Q@L00;P 0@0CS0@0 0,R 00CS0p@0 0R< 0RB(B0B,B1`$1 -LMPPpC 0@ S 0 S`ev 0S쀟쐟0 cPP Qi `0$0O` v&P@00Q(Q C 1(B,B0B11`$ 0-DP@L,000 @@0 0 0 0 ECd0 S- L 0S S 0SP S  B1 p-xQxALM00P06T1 P!Q0S l3 d3P`4X3>0D#S4,#>ubB0 zX0S2 2PR0 gX0S 2 x2Ptl2p> E0P`00@iL2 0R Sy 84"P0`00[ B_>Q[[0ST !L>O,0 S1  00 Q,0S< h1 xX00 Q 01 R.c+p009P 00P 00 !Q 00 SH0 RjOKrP0: S  0Z 00嘲00 <=(EE4cp4D55tCC E5$E5 Dd{X4xCP3 dp4\ -p@ `P0L0 %P00 00 ,S;S;S 0S0S0 0S 00p EC|CCC -LMtD`ğ0 q00  R 0  R3 P 0EUS  T  T ||||||||||  0<000 q00  R 0  R10q10  00S u1  00S^U-U`F`u pP ^U-U```\kP 0  P`P 0.U001``P  pP`P  0 ;U0 0 0  `0S Vl0 RP /UP` 0U00 EC,51CCC -`OLMp0 q00  R 0  R?0P E0pR`<<0t8p<,͟ 0nS` lS0 P 0 R0= R =y P W`0pS`0= = P@=  P<= R8ʚPp̟0 0nS` #lS0 P 0 R0W0L ]< R ߯Lگ `0pS`0X ˟ 0nS` lS0 P 0 R0;T R;;V{ `0pS`0; Ro0q:0  00S` PpʟX 0nS` KlS0E P 0 R09: P1e*P+P&\!\\: R \t P Md:)9@ {  -E k`0pS`0 ] Y9 R ɟ, 0nS` lS0 P 0 R0 (00cS0 (0S : .`0pS`0"8 R0ȟ* 0nS` lS0 P 0 R0 (0S070S700L`0pS`0 XIPTǟ1 0nS` $lS0 P 0 R0d7 R 7`'A PPaT`0pS`0(W PdƟ7 0nS` *lS0$ P 0 R0t6 R 6p& P T&00SPALy`0pS`05 R 5 R5 RH0q(50  00S9 Pp3 0!Sğ* 0nS` lS0 P 0 R0 0S E C*`0pS`0p4 Rß 0nS` lS0 P 0 R0 D`0pS`0s0STß+ 0nS` lS0 P 0 R0 d3 R @Pgl`0pS`083PtŸ/ 0nS` "lS0 P 0 R02 R 2"P. P+M|`0pS`0r0 PR0& 0nS` lS0 P 0 R0T^ PS`0pS`0@G1P* 0nS` lS0 P 0 R0 1  P``0pS`0CCps d{Ec@5T53h5,5 15C5CC,ptC55CC56q E|C0?PR$dPPI\0 RA pW0 RX W, 0nS` lS0 P 0 R0 41 R PBd(`0pS`0|1P( 0nS` lS0 P 0 R0 1$" ; P@_`0pS`0H2Pp( 0nS` lS0 P 0 R0 2"  P ,`0pS`0,3 R4$ 0nS lS00P 0 R0 3 R 3 RqU ``pS0q40  00S[ 4 RD4D$Pp8L 0nS` ?lS09 P 0 R0-4 R' D0S!\  oA\0S 5\PH 05 P C 05 @<^@`0pS`0U 0gS S 00C S pP 4 6 p W 0 Rd6 R d6   0 S 0 S W0006P  PP &U P6 P7 00CS0W0vqW8f '0S00000Y00#000# 00 0nSK ClS ; X L7pPt. 0nS` !lS0 P 0 R0(0S 08(8 P`0pS`00 00pS0 000ܨ p P 0L9q00CS08I00p |  9  W- ` ppS rS0p00p0p9PJYPA9 R9 pW0: Rd ^ 0nS` lS0 P 0 R0 : R JP ;`0pS`0 /; R# 0nS` lS0 P 0 R0Pt  `0pS`0 +pWE;UP=GUgU>P3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  ?\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  CCC5,5 -`0` LRTLL0<SS,0 0Qڄ0C|CC1C -LMܠPp@* W* 0 0S@@T0TbW`CPP l0 R   0 P 0#T 0EE@ EC6C -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00KP 0@0CS0@0 $0<;00CS0@0 0`00P @@0@sCp4`$ 6C -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 0P5 P %Q00!Q`uTş0 R`l00P 0 0CS`0e0 |80:"00CS0D0e!0 0 Pdt Q`l000fP 0$0C`$S0d0 =|00S? h@}?3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000$P 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000P 0@"0Cp8"S08r0 09l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000P 0!0C@!S0A0 x40900CS0u`匐0 QP\00tP 0T0CSP0PP0z Lw046CECC`$5<3 -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0002@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00 ExCCCtC  -43L M0 00,  R W,T P@` <PpX آ 0S2"N0@` T QڐR2 Q@L000P] 0P"0C@H"S07?D p-L M@ĠdP0@D`P K`=P 2[![SC$0BR0`pht@ -`0LM @R 0D!S 670S/$^ 7Ptv46 -L P> P4 000 S/ S- @PP pP `0S <P@` @@ {tP|0p p0YR`@4T~,@P0$ Cd'`$t63 -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| I `1 @ RD1 0o(0 Q`l00*P 0`0CS0`0 0400CS0@000 SH@P@(CC`$66 ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 fp00 PP 0P0 P C,50E -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000;P 0,"0C@$"S0B0 0*300CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000P 0 B0R@ q@0k ho02lY00CS0@8h0SL(@00Pi0FC(E8E0E`$C xCh5 -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0|CC E6,E -LM " P2 P@" " q ğ0S   ?KZPW"R 20R2 84bPU$0S4 JG"0S \ 2 1    ?K+P 3 `d 0Q,V,K 0S 2Pß0SH# G030 G\ 0 0%rŸ0 QP\00P 0"0CP"S0R0 W0o1P00CS00B0 B0 0o࡟0 Up|00BP 0!0Cp!S0Uq0O L011X00CS0$b"P U" 0S  F0 K9P0x 0uꬠ0 Up|000P 0d 0Cp\ S0Xp0 0" 0MC4E,E`K6`$ -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000P 0t#0C@d#S0\C0 n*00(00CS0C0W0Ȃ T`l000^P 0"0C`"S0xb0 30K0<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000P 0\!0CL!S0D0 0000CS0x0 `@0 dQ T2, 0@TP(꘠ Q000P 0` 0CP S0H0 e0 0E8E,E4E`$ -LMؐԀdP`01 ^, p@PP@ @q0@0 A0@0,A0 00/(R@@`$ -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0SP23 4 400 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0G EC tCC6 -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@LT EC  -LM@`*먃0#sP 1 0#|pP H0@*SH6L7L7L76L7L7L76L77L7L7L7L7L7L7L7L7L7L7L7L7L7L7L7L7L7L7L77L7L7$7L7L7L7L7L7L7@7L7T7  0 1 "P00Pp2B00X2PH2D2 @bTaz("0S "0S n ! 0 g!0S ZY \1 y1@DyQq+ 0 PP*30S0E= 0 0!K(pp-0S?T%w  r!0S 0S  BK 1: S 0S 0S BKM\v0: S.  0 0 `gPd HaP <k DPELEXE6 dE`Ep6TE\E,7p7, -LM/@ߠP 0SP :0/S P:0/S @P:0/S@P:0/S  -0L|M\$ +P  00 .PP 30CS;(;:(;(;:(;(;:00 K% ck_k00S3 3S0S$   |` c/P$ $ X 0 pi/S @ 0T/S/0000a`0 S -k [`K;p 3S @0 Sm 0: S 0: S  0: S9 ( S  S QP00{D2 R QPq Q1 R Q S  S S-mQR1 R1 R 0S 0: SA 900PW6 1 R,0  !0S UTPH4TpK7XP  0R1 !ᯬP <p PTT+p|&TT1 1x@君0Sa  (D,$ PEXE$8 P,pIII F FFIMb(F 0-@LP:P!  PD|'00CS00Ӥ0* Pp@ 0@ 0CS00Ӥ0* PpyT0$8  -pLQ  lP@ XP0@S H'P`PD1SQHF -Lp@`PU 0 '0f0@L#'0Sr00a000 'Pr0000D0@FDF -L$MB0, S`20SŔŭː0, P i t&\2P, 0 , S 0 S0 00000 冓 0< 00  P0K &n/ r0 z&P& @0 ?@v&0 00 k,P@0K0<0 pI0( 0@<0@ 0@00S(R&SŤ1˰0000P7&T P@/&0 '0P@ D0pY@EILFdlFCFFhEpExEFF M-LM01, 0p`S  o00S P% P@ %0 ,0 txp `0pS  0S P@P@0 ,0oY@IGIGI5P@@ 1,PP10PP4PPPPPPDP 0p000wS  @0P` H0090`0wS  0  P  0 @X@H@L@P@T@G -PLM@Pp`(0S 00wS` rS`U |0 0 0l000d0000  VVVL`SLT@H@P@L@ -LM 0K# 5bP p-LMD0@S PH`U P)P0 D0 ` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 09H@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ "'0000 T  <K0 0 pS  L@G -LMD0PSp NRL @T @H@)"P0D0@ P`.  gsp0P m 00P d 00$ 000 P@D`  L`VD0S0S$@  g<0 cP@L@ȠR0@-,ȠP @ 0"\LL ^NNQ0RPBu 0PEu |2\x2LL7&c2c0T2RCV]EH0PE0 0  0  0  0   0   0   0  P @l1'7c2Tb"U cbUI U30 0  0  0  0   0   0  0  PE U @PEu 0PEu 00'7cb2" cb0q[ -`PL p@$.0(Ã$H7c"( 2'H@`c\@^B^BN00QA>AAQAAq 0S 000  b0 QŒ00 , P080!Q,000S$9E  -0L0S E p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#p EQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`ph0%0 0X00L0 0T00P09A -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4bJ4(0,0000004PcUP!f ;4`V 4f 44(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K 2+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K 1+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  1/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K 1+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  s1/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4# /4p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK.x0 00.P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K '.U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K - G0B @T0D```Vx010 f@@B$CG 0`dC -L -L4M@P&v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&SfpH0@ 0S񟗇Đ   А   ܐ                            ```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS600,K 0q@.0S0 t,0 R0 X@ 4@ PL EiPP `IjP@ 30C Sꔒܓ  ,,H RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L0P D`0S @0SD cVP Z 0S0SPQ TX 2P ZTX >@0<n7 k l`)U0S <`U0SP 0!R0ꌂ0Ss T4K8 K0KT1P0 #80@ 080 Y`V+ `000CSo,K@ vP@f0S ,0 R D@ @ = P v9@ TS"00V7P< @@ +0S :@P` _X 2T .P@ 'pT IX 0S0S0L04]@39V DВIIIIHpH,nIp$I -LM0@Sp LdP`^0   K1 R W08\I -L M0@S ;@^ 0 K0 R 08lI -t0LPd0 R X0XP PP00L @0( 4P000(IIВ(|IIIXWI p-LM` `P0@0@\  0S 0S 0S pP -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` *0S0 0 (P  !0S0 R0 0  0@ f* 000'P0S d0 ,0S \,E0S 0QO |P0PK0CB4  0D0 04 01@DpPÏPoD \ 0 ?00S00X W 0t/1E $$pWR`P1 ,0S ,1 0 P  `0S@j{P1)O  0g Ppz@0 `( B0B!OC{0pt00 S 0l X 08  [D@ 0(@_R:0S:P h0S |PX:`:::P -MLM0lC\\#, 4 @(  P@[,4(0 B04(  3<  400T` t00\F" $p`"0t/AV#1%Y X @0 0  \2R_ Qz;xP<g< <DP<$<* -0LM@ 0h J\ 00CS <L\XX 00 00 <<PH< -X2L MP0 p <0 R $ŸP0P*  0S PU:0U 䑟@}"0 0 ` 0! i@!T 3S @0R"h1T\000@O000D" 0 0 X0C 0: 7 X  0000@@`RP(0@00,K00d0o,000 0 40O 404h0  T0 RH H60 Xy0 0HPPxP|PU OlP0PO 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 `$0$  00C00OPlP -LM@Pur0㘂嘒嘢,0 `00"Xpl N0@+S_8@H!000  0b`u1  x 0 tc`hh1`!` P0m\>0 @@80#c!00acQDß0SdS0S|X3 #@P@@@p0Si43 R b0S  P,0Tp0 0@"d0 #: P,0Uh"0rSX00R@`b @ @@P! 0S( 0S1 R8tP (uK4P!0S spt( =K8 @ < /P bt`1 P00w@T v@T oGthv@T Pv@T `Ga4vZP`$v42t/t ,t)t|0vnPttDP (P<<OOO>,=|PlP4PdPgfffPxPPOPPO@PPPPP=$!l=(|===>,>4>H>\>|>>>?=?,?7 -80LM, ,0  @!P|PIP -L8M聟 `,0V!0 00!V0@@T Q?>1 D@!T  `,0V04 @@T Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , pC뜠0 0P,0`U0@T UP@XKP 0 T `,0V00o|PP4PlPIl -LM0 0,0 0p:40  6 6< 00`<0 @0R)0S&6 RtF p 0d 0PP 46 ,0S <,庻0 ,   u4 0S R1 < 8 0 B ? `PP@404 S S` Q V@1(@Q0 T `FV@ 0%0tPP`@T1X@QzTP $0000 00SW4 Q4  A 4 4" 4  R 0s 0 p00t 00pPd4d$00i4 00$4040$0h Rf   #0S nr 0p$0h0fPR <0 00x3t3   ㊵P 3 l hP3 R! Ht2 R4 3 R <0 R 0SR;Sh0S)|0<(œ R:0S:\4h0S1<  0@#? S`& @CT`0t0@DT `4"80d a( Ÿ.NP^1 R  p (h0<0 0<  0 0Pxt,1 R 0tntlP  0p4< <0/410r($0 P X P0S 0S  hP P0  } D K G |PP(PPt?;PO?DPlPPO DR.000 0. $0`F0V$0@\ P0 S00*\P ,@ R0 0  0R 0S R0R0S ;P  0 R pPd ]\0 S00Hō<<( P4PDIPO@?@DP@@RI@, D -80LM, ,0  @P|PIQ -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S S OI|PlIP -LM`VPڴp崀.@PT 0S  0T @T R 0S `FVP 0  0P 00IPD -LM$$ @0 @PII,Q -LM88 00 @0ShIIHQ -MLMTTE0,0   BR$Tl !P % P80  4EKI I4Z0ğğ q`$aA4( Kpp$p4pğV`$ 0d *MKJ J0P000Ss`V:ğ $`0V0 *D0P00\'`V:ß0 q`S00*PP V:MP,0 S |,!0S 0 P00S 0 S s S $#P # 2  00C0 "~P  000 00C0  SV;;S PT"9(K00MKA@AKK@ $@ 0 \4  X$ iBNK @D@D01 R" 0̠ ~ A0S0?0?00 R&P0 @`n0̠ L8d 8I   0I PP; PP 0:0 ) g P`AxAOQII \PAAAtvADOhQ8DP77QA, D@A8?(ADA -ML08M (8Rp, (`  Q 8 Q753 575$\C0S ZP W0 41 R77 (K(K  (K0AO0KKl,(0S`7(K (K ( K(K0 00RP^^x>KMK -[P$ $\0S#  R0.S $0&$00\ &"F 00CS񟗍 $0SX ,0 S ,,噶00  & Y5 R E0 S %G 00P%00C0 @0S$ $\NK @D@D0@S^K PE0$0%+5 R mP $\00$0S0 R$ 4 R4 R$ hP 0: S0   4$00^$\OR$ 0.SH00P[S0 41 R33 (K(K  (K0AO0KK,0S<3(K (K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 4@@\+0SP $00$0P l"00C0x"f>KMK P8"V4_00@P \ P !?G0l!00S 0S ,0D0 P>KMK Pe$00$0 1  0`0C0 崀t$v@P_ l0S 0x0 P\0 R\ 0SY <00M0 1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00}TPO4P -LM$$ @0 @PIIQ -MLM0,0 K0 HK0?(@DD@K8K @K ,? _R@X\$UU?(K1 U5U3HKKQ, P0@@?|\ ``N A$e @?AV@0p`/110Sr(K($ULqO QKPTPK XP58K1\@@?NA`@ 0|0l(K0?K!d $5dKS@B@h@$5A@l@0` | ?KAd@KK\ d0Tb 8KKP,=aHK0(K( B@B8KA \<K(@0@ SHKAX4 ZK(@ @K!HK1  0 K $08 00C bpX L?>1 H!X ,;+;HK ,0PK4KKT K!(K0 0(K 18K@T;@0 0 0! d HK @`˟0 S 3 S (K EHK@K0 $K00HKP 0,0@0CP(KTK_ (K 8K1e$5S8HKApKK  $  (0,KS0@0^ TKHK(0 , A0000@K  0RP04080<0@0D0H0L0KKT08K !L5KsHKɟAÄpX3D Ϡ0.0CSpK000KHKA 0 I0CQ(K!HK 0A\00> 00c@# XpK\ K(0SK.!0\0@0> 00c# K 0X0C 0KUB8p WG?>1 AR!?> p W ^# ^"KG$0KQ0$0HKA`0.!008 > b0Q0cP8K! 08HK@ Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101v(0Kf(KHKA쥟8K$P @(0K 8K1HKA (K(K0(K0(0K HKKAP3P B ? P5 R9 K8K SDEK,0QK^$PPL5Ks8K0@P5  P|,0 S ,հ(K P K0PP0K(K8K  PHKATğ0 S(K!KT0K0$SHK@TT08K  P HKAh P3 R KXK8K1 SQKHK\0A00RKHK\0@00?0p00S @@THKAK XHK@X(RRKK`000QpKK`000?000S @@@THKAK X@BQKK\0 2RKHK\0@8K Z P' HKA4# P K0S(K K\00SHKA\08K RKK0?\04000S4(K08K0 RKK0?\0000S4g(K08K0 \K8K1 `K8K1  O R9R1 @  KK 0h2RK`00 ?> 00c# 8dW"{K0K"0#>PK1(KTHK 0AO K0@ P54C0SPXP 0S 8KpP0@@?|`N A@W?$%ARP `AJ?AP=L0@Po4D P  RTJ$5SDD0S Pf0S`P Kt4 $ X\60  0 x0x0| --L ♊L p-PLM@P`l0l R T D0 Rp805h 8 0  ,h%*xВtE --L  --L  -LM@d- h5 --L  p-LtM/Pcl@TK DP0: S p0`rS  0-/L@DlPU+D0 00 /00(++00IE -LUMpPKPP@lK80S-0: S  SU P U@P P@0 R000K@܈P h1: S@ |gc$^d|$!EEE P-L P n6E -QLM@ CP T ]6E -L+P O6F -^MLM= =@, @= _K A=A`PP^5: S  PP 1PDx-0S< l= R0 X 0S4= &D g40S 0-@,=@(-(@@@ @@}0 0y0S P ,P(0,<00iPIl0Sd<@T 4,0 S h ,ɬ(,-K B BP 8 HPd5Tt5x%0%#,0106Pd5@T˟˟+; fd5T `m; R0  V$+0S 0h$ p , L+0 t'#Po70Cɯ5@"%$pWZ0S[0<cQM0ZQڨ0Qڼ /0@L@0S c0*0S2 P. 0$J QQ\  000S 0 |c)0S P  00H0cQ  000cH0t)0S bc\0S P  40L0cQ  400cL00S ` Hc(0SX P X,5S05S. S ( 0S>0S +c(0SbP 0(<Q  <0(5<(0S c$0SKP{  hH080@_Qn d H0S.0O 0S b'0SV+PR  gL0@0@_QE p L0-0O@'0S b(0S. P* 7 W0S0,%R0S0L%r 0S 6 R @$P `P3S x 0pVPT085"d@00PgS0$PP Ve 00 pWD&00/>10@\6PPF 6E46P(@ 6P6 P5& 0%@U5 @E000%S P 4|5    dd L``P` `$h ' (4Lwa(0S? $0 00L 0P5?T5 V>X5pP0@@?|PN A@C ?$%AR㰠 `A6 ?A=`L 0D#D3 P 0S U0 00,%0S><0(5 H0S.0O "L00O\P p"000D5SL000<5S,2  2 }000a45 SJ]H0S0O L0-0O021  1 *1  1 |000h1@@4P  0<0|P 00t!0S0c[ W4t0Pc` dc` Hc <<` O@PPF?ODPtP8FPP Q|PDFP,P8PlFtFFFHSFG4G\GpG(PPxPhSSHSSAST4T`TT0POTGPGPGOPTQ@QQOOOU`H(UpPTU|U1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P0 0 ! 0!S 3S 0w^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^HP|PPPU O4P -L8M0@K00 ,  -RSL4MP @`t pq\d1  BRP  T 00c0Q3@T TX0X  0S  R1 018ĠM PP"KAA NK@D,X y 4h 0X VX|,`4 0X X`L$.BpDa008 YP6KAA Yp@HV0S' T 880S@*WT 0S 0@T8800 |  SplT(0 SH(b s,4X$YPHYtYYL|F YYC Z p-L$M P`*4@K P 0` ,` 4P  *10AS1 0K(0 $@ ` (KhXd\ {9p H<0! YP8K Yp@ U0S  gpIT80[S [@VT80SS S 0 0R0<0 <K`A40LLL Dp4L$Zx,0ZLZhZC ZPT Zls DM 0-LMP0@S P _UP 0@0PPU 00TQ[[ -l0LM@ 0K $0  K$ K 0P -U0 TQ8[ -X0L M00 0@0 K P Ux TQH[ -\0LM K"@ 0$ KK@  P (K0$(0TQ 0-L@R⶘<PP@ P@0W -LM@ט0S Әј0S ͘ ˘hȘ - 0LP`p 0S 0S,{@, k0ll ppX& PPV0(0 0$`$`@(@ܟLQ p-LMP`P 偘 0_p& {P@m@p0S Pd偿P@Pp^P@ ,P@ppX[x[[ p-LM`@PT 0S[(0@VT00P <pbP@0PS pLQC R -LM@ r`RK !P0 -V 0 U[[[ -LM@ 0`p`(Kpj pPP V $s(K _xP( kh0[ 1S00 0V% (\! pPS0S S0S S0S$ 9'$C) $2'$<:YW0`S|:N0S pG0 ,K,0 vU0  (\L\\ p-LM`0S+ SP@'  , 0P00 $0( S ( ( R$0$0phoUp, ,0 pXphpLQtS P@ P&`R R R R R R R R R R R R R R hR R R |R R R R R R R R R R R R tR (0$00000PtS tW HU T p-LM`00P 0@T PU 0sp00 0(@T8@0S Vph0S 0pPLQtS -LM`@pT? 00 0(@T8@pT`/ JP `(@T$T" 0 0R 0 0Np 0 0S 00 0 P < 00 0tS PPL80@T 0  _S (@T LQ\X[R (0 R 00 0( RLQR 0 PQ -1LM@pT 000 03S(@T5!N p4 p`0 P#(@K P $` ` (P  ,[$K  !1`S 0q,K JU,0C40 Sp@0RpQ0S P0 0  .Up0SQ0 SQ0 S @T@4LQ$ D4x,\WPQ\C 0-L40 R 00 0( R (@0RpQ0S P0 0 Tp60SQ0 SQ0 S @T A0LQ$ DWPQ\C 82P *0P ": -LM`P᛼P( @(K,pK 0  (0@Sj# -L M0@p00 0Sf vTPP 0S nSW =P0`0@Q P QIQG  0V0P . 0' Y0  0000V 0`0 ,K, ?R0S@p @P0"Sl 0Y000 LPH00D 0oSP L\yty|yyy -AML0l0SKt00S0ژ0SKt,0S0ڸ 0SKt(0S0+0sZKtP40+0SjKt`4S000Հ[0S0S0 :K0  0K l \bP PM  ,~M  oRGjKPt Ktp *KP|:A}K(pGpGP`)   P `V:JP @`x0Sr0@00S P  T Y0`Vj?0ZDM  LK| jK0C^(!t@P(`K1( K,@0) 9 0 ɠ$ (PKp , В S`R ]T]pp]0W(S]]]R<S]~$!^<^h^^^^^_H_l___0SܟT _}_}_SR_8W@_0` SR$`D<`SX`,`L`P` S`(`S a4 aH8aRx\o.<8\a a`SaSa(|$Sa$bcR,bDbdbtb^KPEPE!0 BNKK@D@DP0!81KNX!X1*KNx   P>K0C0C``@11 K00a1PF@1"Ta2P(xa׮82PDaͮX2Pd"000xa彮2Pb崮2Pմ(b嫮2PչLb墮2Pհpb噮2Pէb吮3P$՞b凮43P@b~P3P\Ռcul3PcP`0ci3Pՠw0S d3#4J|cCP#000>8P3#5 2c>4P$e(4%d384PDA,d*T4P`8P4h PP td4P՜&d4Pd4PW 0` ] 00- L@PpP`0 `R\ 000DP@< 0-$O(XQedA8W,S4d p-d0LM0`S@P p84 0SOph,Sgdbb -0-LPGP@q$$0 㤶 㚶뢶В 0-PL0@S00    xl0 R 0TST 0S S 0S RВef0f -LMPp`Rp@? P. 84$PK` Mp $0 P i  0$0 $C40S$0 ld U PDLP$ HfTfl~, -LtMK@nPx0  P P P  N\flf -L2LM<2< 1  424p, 1   p `PPR K Z C/K iU@= W3T#1 ,0S ,GȌ 0P|MP(TMP 0, M rP  M P MꈠKZ 5@Kl p0  ` P @ W P 0hLM >P 4M rfff\0ffff(|f -LkMl0`d$0 PP@ 0S@AsK^ P $A1" S P 6^KP@ P1*$0 S $嚒 e P*0 S/R ` d P*\P< ,E ! !~f$!gg$g@gPg\g -LMp0PK 0 It0t `h ,@0X @n H` 0S  C WWWxgg -LM X` , p8 P  ?P (>P >P NK0S p_.0AU4ʨ> P>p#  l> h>Rd.`p (0 ,50(5P , 1> @, M^00 00 Rڨ R= =$ $RӠտڰ$RӐպڌ000 0400 Bd40AP LL0Q 4 R(:R8îR0H0400cL0 H0S.0O L00O PP00Z4\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڠʠ Z`00`0ʀ P80Sp; P%00#1t0 003x0@P+4|0d0 |Z;ʠ Zd00d0JX;\` 4@8@帊@ԛ0P4@8@@00" 8 000P|0@8@@000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ 00)1 @@ ` TBP 0|00  0  X@ @ 0 H 0S S0$5P㸀 0P @@ ?|`N A @?$%ARp0R`A?A@T0 S< R7`P0@@?|pN A@00$/>AQ@0P`?P?T0 0 00S000ʠ $FP 剐X3 0X3@ 0 腟 80080`00`0 80Sڴş4 00RR 80080 `00C`040040 |00|0l0 0 E0 PKOP? UpxP开 0Eo0 50 0ЄH5P0`x@!@@+^Y l 80 Si  Vg  \Tb0$iI<4@ ɐ00 000@80080 `00C`00 PP0@ @?|`N A @?$%ARp0Q` A?A@TLßPp @ PK0?PxP0Eo0 500 0000000 x@83!R@@ऀX ʸP B0HHP帀PP2 @B 0 sP @3 RRR0S H聟 @ @v0 R0hŸ  Hp@ PK0?P,xxP0Eo0 #5P0P10`x@!@@J@Tڴ00i 0p@PK 0?PP0 @?|pN A @%?$%AR㰀G` A?A@Ti0 Se` Raڣ?/0 0 WWAQ@0P`?P0@ @ 0P0i0p圁PK0 P?6xP0Eo0 .50D@ 0|Y0@ `|6P06 T DHR0S T0T p" 0@TG0G0S0p P0@@?|PN A@?$%AR㰀 `A?A=`L0`d 0S2$0@$ |0P| $ Q0°0Pè Ű RD3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X36 Xc0PE`0|pTV V> T5T50X5 ^ @`=LP0OOT0p$$0 $F4 0X3@~,@_P,00,0@`0xQo0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@LP H F0|  F ,00C,0`@@`@P 0|,$ d$0t&10XFP0SPPU p0Sj `00 ,@5L20000# jl 0Zp0ڴʠ Zp00p00V&PA 7P'\50\'@0h'<l7P0X0'\@/0"b7D 0 0 0 0 0000@m0S 0S 8P ,0, Z`(\H;0pKS(d d ,0X0Sy 8 R P  0 Pf(0X 0 8\łI q "(9\5 0Z8( P,0X \00@ d0|  ,0X) HI9 P0 0 ,400 80 0 + 0Q  ,匋 0 T@0d jZ Q  00 Zl A Z00@`T#d0>PcUcP#u  R  LE EYP@ ;9 B6+$0| < .E@$P4k>. 0,0p`P4Z/  0 Ex긓pß0 d|P  B H0lcD80|00$8P@@d D0"D S|0` 2Q@500h0 X3X#B P5PBL%00r/ P5T%  lŸPP0P%PH X3X0 I80Jp|0P > @P60 0` PE(L5` sT5Z20P000s, `A\ L5sX500VL5sP5T%2 0 / 00n0L5sP5T%2 0  80ZZf0 L5sX500V. 00V0?T5 V>X53TTX>l$mS0mdmmmm0 n,n,Lnpn SninnWoD0 0Q 0\\D0d40 S$||C CC0S nWP T?/0 0 W0 0 ,5<0 0@0 004 Ϡ΃` -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@>44 ; :,0Œ8 ʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8p 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0|/`010Ch0 h000h0h0$%10l0 @0`|/l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQW%00PUDh% *l 1 D, '&0000| 166 ƟRT000T000@|0嬠  P`0 0p Pe <@6Pp Ri  00050 80 Y0 (00(0%540( 0l ( 048@Pp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 8@4 R`0 \0$%R L$?>l 1 D, 4$0000| vß3 RT000T000@|0嬠  FP`\0 <0p 8PeNPT3Pp R  D000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU X@@@V X@@@ 0|/`01d0@d]%WWWU 1 D,  00C0 00C0"00C0 000000|2 0000| D2<2 RT000T00C0@|0 4 40 OP`e0 E0p APeWP1 pRU 04N00C0@, 00R> 4@?P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04X@@@ <WWU `oxoWo -LMpQl0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W**0 0 0$@{x`0d C0XKB$PE 0xk ?00 6)  WWU Woo -0LM`pQ  X0X07!h<0@ L 0PP " RRSWp -0LM`\0p l0 P X0XN0PP ,0007 h $ RSRWSP 0S=90S)0S@ "P #Wx90S  WWWWW,n -LpMP@T `KLP 0 R T90S U=0S@: S! p0S : S 0 R !P =P 0S P (0 R WW,WWp -LM쁟0Q@(0 Pp`i 0: S (0 S (I 0S y  Mp` Kp 1 S!3 |PpE 8@ IP U P <w0  |0  ,P 8 P0  P & PK| MKP    pp,Wq -LM@`P  IVp@0V U@0 @ PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S `P$0 S $$剁4K@+[ Q003 Kpj@`Dc00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU ,=W Wq D($q @q p-LMP`P @\@P0/S+ /?P0.S P0S@p0S .S0S`V d 00 Q P0S0P,4   @@P0/S WLq -0L uВlq -LHM0`@/A?d#P000L P< CR 000Ri 0 Rd \ 0R  R R0R (*(YP( p4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( pd  Q Qq00  R( Z l<\ttttt0u@udHuTudun puuuuvHv\v 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ ($0|v6v@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S 0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 t U P T0S5 0S 0 y  nvv -L M@X, 02 ,0 p1 100 ,0 0;P0S4P  \S  RE ZQ@D0S4 0bp00 g R AP\0 00 P \00, 0 S0`B 0V, 0S`:\Q&Q\00 S SP+ 4  0bp@, 0n=dv w,wHw -LMr ` 0 ( P0 (PpŸ  Q Qq00  R( 0gS} 09S,1SUK A A pP@P@(S S (0(8 0 S  5x;SpSF wSP( <  Q Qq00  R( 0NK @D@DS  S ( 0(0S0R0 0PU (  p . 0tydu00U0P0h( twwwwn x -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SP@T 000S0S   0S(0 S H(}w8, x@xLxxxx -ML MD!D0 ,0 낮KJp`J  P@Q ' Q Qq00  R ^ \R 0 R0hQ` 0f Sʉ kp00w@0 ,0S <,w 0S S x 0-LM0@9SP$0S$S /S  0P@  00Dt 000 KӘ \S@x y R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@ @ \20pS S 8p0 0 0 S S00,y p-PLM@P& `0a0CS$ @ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 $ 0 @ 0 0 0 0 0 0 000@Tp 0S0 C0S40 q n@y - P LR` 2P R 01@pT 0S @Tm0@00` 00 pP @lXy p-LM PR` 2P RT0 AT 0S @Tp0 GP0 0p@l -\pL`AT 0S<P pU@`V0 `@lpy - rLMP@`!#p?@H /P< 1`1`^ 0]pj00 0AQ0S 0S|0jpP ,sP n@cynnynpnd(z -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0 0  00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha P@  00&@ 0Q 0#S0nS0@0 P0 @0  | ’d0P@ 0X 00hT+強0 0%nDnlnn@nHnn4z -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  p0 80S 00,K0@ @C,  02!刁000 00CS0 0Ӥ0,pXqHQ$Ԁ0S P R" 0pW ` 0@ ,0 S0 ,o&0S Pu&эPJK(@DP@D *0X2\ 40 0n ndnz(z -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@&0Si % \0R0R P(0\ CR #00VP 0 C0 b\ 00`0\ P)`0RtP&`vdP ]fL$ KnP2[S<00Zd(zz{ {tnht@ -PLM؀`pP@) T 0 S R@D @00U00  0  P P #D <0S1nnnv{ -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@n -LM@P P`p W00   0 0  N P0-L@P 0wS! sS @T0 p <P 0 0$0 d[{Sp "P00q$ٰ 0CBb00 0-PLP @jhT000 0-LP$hP@0 0R0 @@0G 0-SL@p  P`dhP@4 U@@V@G hP @\0000Q00h -L,MS @D ||#lp LP ?PPP4#0SA $bGˆH 忈L Q 0S 0S"0S ϫP0 "PPe632p D +2`b`" \@ W82@ O$2$ ; 00 , G00 080 4 q냉Xd R $@KeaP $0ASA2 A$ R20S`p?1S2 R hBxR` R PdBd`VZXX?V?0D,0  P5?BQc U`, (` ,pKPB0 R,0 P哴PV`U ,@0!@dWpp@R 0%S# $K`P $p` P`AT^ g>`>CP  0p00  00S& @HwPp6 P`7daP`2 <`dt<sD{dܟgfff / ЌDp 0-@0PTL 0Qc@@0$ -XRLMP"@c?P 0A`V PU / 0S 0S =1 LPl 0S0@  $0 S  1SqQ0S 10Sl= @P@b?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00 0@ ;0 Qᎃ~ Kr0P@@ RV  0_ \ @, 0S0=(<$0T\p -PL@p` mbp lP ?PmPp`t 0P0 PP =E0P0 0PPS<0fP p-0LM` P@,b?P 0AT K03\0 S0 1 !0l p$<p<< 4 -LM0@P,0 #ap ?P SPP,0 S ,b3 AT #0 P 00LS!00LS0B \L D<>p<\ p]  Qf` ᫯XIP@PR  Q8 埯P3 0X0C S: 9 9 9 9 9 9 9 9 9 9 9 9 9 9 : 9 9 9 9 9 9 9 : 9 9 : 9 9 : 9 : : PI PQP'SP0-V +V ,Q@ YP \ \ =V1h0lFP 0a0CS; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; < Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<ډ<3 <DD8LP\hpx|{ p-(QLM !@`?P< 0aV< 0 0Ks.P( 0Q0 R 00 0 S   0S  0qXPp1噤 P;P< (;p鈤p<  0-PLM @`?P 0PPKPK@P 0@0 SR R 0< -PL4M0p @P0 TP XP $ a`p, rP' ?P pPLK=PX L?;sP uP`PX  L Kq<PX L <);0T0 0P0 0!R40*X;$Xd?@P` 00XPT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0S^tP0;0 T0S H00c RHK[pP800c R8K[`Y U u P2 P$ R XU P OX2 RP0\U00Su US 0"0  40VG 0S 00{0`71 R,4 ]}P# 0SdT0S Xu XuX <\00 000D7D<d  0-d U0S4V  V 00S`FV 0V0 R fPF\`0  @0 < Y@0p0H0 D 4:<ԉ܉ ܒD, 0-lPLh @_0?S L0M0< 1 00S(0( 0hQW0<@ p-ALM!P^?P4 0P@ P 0SPU @Zpi: _d:rP``V 0-S PprP@P s0S,9p0S`<D p-ALM P^?P`p0AT K[P 0 ! 0 rR @0S XW2@P00`h0 R 00C8S` RV 0  K9<4 p-@AL M8!P\^?P`E 0AT00  K[P: Q40 R 08SS#  R 08SQ 0S 000 0 at 90bPKW L08pQ 0`009p<Ўi p-LM 0S@`)p K@ZP'0S !0P@PB Y0S0eC10C0@0S0$0 R0pp{@ -LM`p ]p fP ?PvPpp 0AT W yP0 [ Q|~@T 8)P< -LM\` PW  u`ONFd`@|ePX OD%BddW_N( FVe $P @eeh D  -LPM@lPK`ᄀdK 0hp 0 0 0 (`K -LM`SK@P blKK0S@ #3````0SS?KS?K0C0C0`G#S?K0C`VK@@KnQKkm 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@lahX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C lx?B`K<   -LML@H D@B4 ] 0BDACTP`0<0 < KMP@ 1 1 P@T10 R` W4,'鮡  વ<0S 0ᝡp -@LPpmn`T@X00V00S剞0S 烞P 0SD@P`d@@Vtx -L2LM@"<2<4"42@,@ 2"2pb p2",K@@00@*C,P1 `!1eNp1!aP@C^ 1!T10n 0cCP@00pQ3 P7`1 R p|@!0@ 4@,01 06S 1 !pp 0`1` P P P0@P L <0cLd=Io$ooo(o oHoLo4oTo ppXo$p,oA oo@o -D0D L0\0 P ) oo@o P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` ⮳00H0 0 c@BTT@@DtP @Dtu@ @Dt00X0 0PPu0UToo o,o4o8oHo -L -L -LZ 00o -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0SXoo@o -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0o o@o p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0T$oP*Pt @DtP@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 00o o P0-L@P T a$|0 0h S`0 ! XT0hO$H0<I$40 B$̕\o~`o{ԕ, -LM∢pQ, S d,@01Q 0H 0@:T$Pj a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  lO#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P GP BC@, < ,Pd00@TTPUX~WT$ "\o~{ܕ`odoo p-LM< 8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPU3P@ D͕P80  p,ĕPoPo\o`oY @-?>,1@LQ 00do\o -LM@Q  Q Q Q Q$ h0 oTo p-LMP` R @0@0R@PcPbrR@ptToo -L0Qh0 XToo - LM0 0 p` P0@@cP0 PPt 00p 0=L0L H0@ @0@p`E T Too$o ooH -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @?PP 0@ 0K @T$0q$0P 0S@@TPph ooo  -h1L M`` 0(K n0n4@K0K,K @P@P? X04 ^00,0KpCeP00T0S`T XU U 04 eP00  0R/S \P(0J*00( d PF ooo -\0\X0X T0L0 L08\000 5 h'4o0oPW񟗩( ` V񟗜p ػ ̽ ̿ `X 00 "" " V  R X V X 08.0004, `@[0T. @0T* @(0V0 0 0  00 , 004 080 PL=@` DA A0@0@0@0T * 00 H  < @`DA A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh갹 ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ \ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ 4 ܹ ܹ D ܹ \ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ ܹ   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ^P 0 UPuX p=40UdP  @0T*  0@8@` DA A0@0@hi0`0  `   $00(   0 S 8  b R8Ka<P00 0S )00 HKPp   000  $00(   0S 8  b R8K-<P00 0S )006 0 | dK@K 0Î000 /^0@S 8  b R8K;0P00S00  00@0 圎 KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-4 x 4 x x x x x x x x x x x x x x x x x x x x x x x X x 00 ?00A `@0  (CXUl4bp Z C0  0A 0  00#0CSO ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` t 00)  000p 40P]]  H R000 0p 40Pǐ"@ 0 ]8]0p00 0 40@U ᧐ e  Xx 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D RD3[SpC0DBF `A F`pN 40 U B GH0`VH0 `Pク ,T ꄔD D@0@D@D@ X@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X l`@-X=X ?X @4R44@T0@@Z0=X[zP 0@S*S0]S =X Z[@00  #0HSt t t t 2e 0,0 0 4 *bZP 0/Z40 0`CA 2020@S@@~^,0\ *000 4  @0@S000MŸ  E10,0 0 4 4,0\* @ 4 b[0 @` DA +A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[ċP 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080Y [l0`P`@aYL0 0`S`Z Z Dh -d1LM`p+DQ``@nNP`@ 0S $K| $xA@:P P   |2M)00@0 R0PU 0S 00S 00`AP@P,0 U -L@P@%Tp? #T U@` :P`T`T TU@ l:P@T0e  m8P@:p`p U:P`DT*P@: H:P@DT* p-LM 0CP`CA)P @0T *00ᖍ TpX0 @`DA A0@@0@`Adph(<  -0LMpH`C  0@ W1, @@p1,,  AE8 00 4 1# R 80 R 80 Rc 80k`]ASSTP >8 1S p880!1P00>8 @1Sx<,8K_K/=z PؔP    X`@ܖ<,ܟ -L,MH, \00 p4 L H  0S 0@S \ |<SV QT,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0U>0 0 R^ D 0` VL@Q D0@ 0J 0!RPU7 ,0S 6 R /P0H, , 00CS h x x x ,4 0044 |6 (/, 0@3,0 R,0 R @ ,0y00 ~040 0,0 0-P4H P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00*P@> @48|$,,#0< <00, 0< S 0DS     44 4 c. 0\.a,0 , 00, 000,,0 P,00 3@  00 0@( y, 0T  F,0  ,0 R  : ,0y.B\ 00 2,  0 p}00 0S B @JJ <$T,0 R X0T.:6QHR$ <pPV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` e0S00p000 PU  , ,0S,P |-넔t<ܖܟ@@8ĔX$d(p,R P P <(ԗ p-LMP`PQP@ 0ST 0S`@0 0@x0 $ 0 0@, 0-L@pF 0FPP$ 0h 1 -0LMp@`T P FP L 0V0R00S@R F 0 0  -LPp`+F  @0;` 000W ,M0  0S;0FV0 0lN p-LM@`P0=S\ *SZ +SZ@E qF 0 ` p -LM`pE2/nPP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U(c.0 00 OP2P 0 PQ000Y @ @ Q0000 F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 ㅡP 00000 @0 PP 0`*O0,K S| ZPJX`A00 R  0S AQ9P ,K 1|b X 'b 0,1!P0  ,K|wb0 h 0 } 80< 2}9K,K {lc,K {T00 !HXLܟ ppPp\xhĞ̞x 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@p  Dpx 0-LMPK@ {80@0S 0@S w{0Xp -L M,K`PD pf{V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  *{ "{000!(@Xp x -LM pK` {@T P0S 0@  00CS0<0@T@T 0 H@T0" zpX< -LM@K 8z00 \000z 0Xpp -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$ppppp}00 000S  0S$4 0S000Dp  -LMP00좟000 SQr`*0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BPY 0SN P 0S? ": 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  | 0  <|`0 `P0h;0l`0P@j 0`00@0000@00Za Q_MꄔԔ pphxl<D4 -LMw0` V 2 0S{ `VpKc뼠K  PPhڸpKW`V 0@T 0S @T`VH |V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H |00 0S0 0SS0000000 p ?Bp p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C^ 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$ph`ppp\h -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@S V W 8X tX lK@ hV 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,7w"0 SVt  V  PU 0S0 S t\h10X"x 0P@LDTM"l0[S (!T100l Kx` @" ;" p05"V 0SlK~ lK@ 2"{0l0Kx @VT0 SS 02f 0lK2a R4P x X" p,ȟПDs -8#0L` %^0?SaXZ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z XZ Z Z Z Z Z XZ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z X[ 2P Z0010S P 31 @T 0S @TSjp1@PT 0 XPX@TX Z 001@T 0PU pXP XPU@TZ 00Q00X3p @T 40S 0S @T@T 0S S @TZ0Dp -p LP00 X R 0S R 0SRlppx -L,,0@ S00  px0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00pp pppp- RR  RRR00Q00Q <R 0S  R 0S p p-LM0@`TP 0S@TpPP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB e|20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S  X X #X  0 0 0.0S 2   hb  P\P Ο0S00 X V V0P.020c RK"p Vha c Lk q q r @r ds ,t u u X<XBVPW U V00W00SZ xn)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`|q0FSGLAb@T *Xl (Q dzX0A0EA0US2 " / AE&2`A2&  I'P@ 0 0S 0S 80S 0$ @ 0, 80ŧ ` |l Dpp<(AE 'P@  P0R }R\ ◧ 300T*X 0S0 0 0FU0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0xWl1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K"Xy2 JZ `00 K}X]2 JZ `0 K0S dr ,`,T- X 1 R$ R 00S  RXij  0S 00S 0S 00 _(1  sX0001( dP  0R@ S ,0@(0c aR(k (@@D0S i   $0S R;T 00S $<0 0 saꄔ0Dؔ -0@L MTP@ T >,P-09,K- 0, 000 < nd0SH0@ , G 0 00pt -!MLM ʟ` ,  PT( X8 \ d @ 0 S\ @0S - !KLLl Yh O \ SL p\P` !P@0 XH XQ ` R$ 0 B 0d(  h8S`` 0S XQ T(8R ,0`S ,,@!P@ 8!mK `F0`F(0 c2`XPXQd( h8S` ((XePh` @Q 7 R!0AVS񟗆갅 , , , , , , , , , , , , , , , , , , , , | , , Ԇ , , , , , , , , , , , , , , ,  , , , ( P h , , , l , , , , ̈ ,  , $ , l , , , ȉ ܉  | B^KPEpPE0K K,0L+ A_`XP@p06B^K PE0PE0&tp6B^K PER$0#0pPE00AS00@SB^KPEPE%0 0 B^K1PEaPE0%tpl$Nl;B^KPEPE`%03lNl;B^KPEPE0%`}e\ P00{RPPU B^KPEPE0$jt~KpGpG+U\}I\PPlMl;B^KPEPE0 d3}8\@p{B^KPEPEv(lMl;B^KPEPE$$B^KPEPE+'\uy*+sB^KPEPEB^KPE0KpPEd8 ,LPB^KPEpPE\0EB^K PE;KpPEd( ,C@lMlL;B^KPEPE`#yB^KPEpPE0,B^KPEPE,(.[P0p0#4B^KPEPE0*UyP rP@ B^KPEPEB^KPEpPE B^KPE pPE 0` K,0A+K0+0BB^KPE` pPE 0H2B^KPElLMl:B^KPEPE"&B^KPEPE w [P  [P B^KPE@PE+[ [Pp)*@)*f^`[P h)*[P B^KPE~0K+KpPE,0A+B )* LP0/S)*B^KPE0PE 0B^KPEPE0 Ws0 S Sh`  p S \S0p)h8 d8S`00`8  <x3\ؑDĔ($! 0X 0T -LM䡟䁟p@`P\P 1 R0P0 PV(Ќ ܌ L $ 8 \ #U` 00``` 00c R!@P000  V[U(K8P/ P(0PS  b R0@00S(x0 P\P L0 R0P0 P0 `묔Dp -1LM  0((0 $ 妟(0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `V00p p- LM0`S0C0Px0U  Q@@T0 AQ 0p$ P@ 080p p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00p@(0  0P 00ppp 0-8 P0@0L @=00 -LM0@=C0 0 ] -LtMHK 0S00cS0P@$ T P0 0@TKPx0: SH K 0S 0X S `0S X ,'P 0@@pppp0p 0-LpMP0@S|0lS`k0 TK  `P|0: S\0 0 00隞ꘞpx -LMp@:``FPP :Y`PP%YP@ 0T\S T 00U0L0 R T?X@[ Dopx P0-L@ P@(T DT0?x p-LtM@PH08`KP0: S`0 0 0px 0-L@D' P(,0P*0h+t{ -LM0S ( " 0QOK0嫝G/p00 K⣝'g@%&;~&X   @ 0@S P@1PSlg@0S P@1PS4g47 0}P& (000-[0@ZXPv&00  36 ! P PP @0 @)0SqpƟp@P0PP T@)H.De&`v'0@/SP< P 60S,6T  'Bo@L&#(H& '0US DUe%5Q004&0@ 0S ?0PP P5P` `PP"0S"P@T $@@)4p0P ?jPKP2: St 0`@S@` 00DSg#02 e0L0  X$P0``P 0SK 0S8@T 0/%& R$P PUY00 0SH3  "p300`%&zP  00 0@TP 0깲 0S iPw @$@  0 00 k1p00 P P0c 0X1o1pSP00S 1SPG@8nTQ&#VP  &0S 0S0Sy H!0SmKPdKP!$2R! 2R,VPu VPptn@\ΛP |PP^a0`~L XĔx{Ȕ<{8X0pb  D\|plxs -TL$  @0 <0R4S0 hSV%0 |\WH_ -L$M< @ D0  00, 8 PH s @ R1@000  000  040 1\P@. ,P,0 00S X00 4 0 0DSꈠ 1D R&0 R  @0S 0 @000 <00PU, ,0H 8 ,@,%,0@ L00S 00 40 -,0LM@(@@h -LM, 0 ,0#  0S 04 80  00S2 < @ <0S2  2#\P@) 0@S񟗙긢 <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,08 R0S, ,  0 000 0<0SR,DP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0  k$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 ^C,Ldy@  0 ` , ꄔؔ0 P0-L@ 0S PP0 R @P 0Sܥ ̥ ̥ ̥ ̥ ̥ L[T 000%0S TT ꄔDD -P`LpG㸙P@pP᠙ P00 Q @ -haLPp0S  0R;" \ @0 R@BT0S80S W\ p0  h鶙`V#0 R!0 P0@CTT WU< ah0 P\ ᡾0P$ $ D< p-LMl`PU \ @0 @R3{ T e0 0PU 00p -(0LM@T @T -,@LM0 01h P0-L@ (P 0R @T0  -LM/@P@rSP0 1E0P0x -LM0P0@cSZ bSZ  `K Z( 0pR R M(  0R `V  $40"WĂ d,(0 ("4S A_PRI \d (D 0-L@᭟PP0Ѽ9I PB- X 00Q0000Q0  QD -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$hDp| -H`0DpL0f@P;h00fFhP@p p-PLM`0P U@@P R0p 0Q0-@PL0 00h30 p-LM0`S0 00@ 0PPf0P00p p-LM<`P@1S@$TpRPpt 0-LM@4P,,P$ 0 0鄔п -PLNMP! p0PH1 `AT P$UHR?K k6UQ?K-KAQH1`PH TP@<`0S 1<SP$U(Ȥt l \u 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 0 t - qLMPP0` 5 PP* P( 0S0P00S R 0V0U00S00 U 0HSx0x 0Q$`:~`@܎T~ڎV 0000`QR ꄔ \ -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  0  koU<PP@ 2 V 21   R<CV<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S 5$0S LP0S D1@S @1S``!T RDD L!T'D1 S 1 SD  0S0#0@0-S /P 0-S 0唐 @6@( PSl@0* PPSLT@0@S 00$T000pqt   0-LM@P K*#0 S  P00 Q0 Sp 0 0-L@PP 0w4 -LDM耟0QP`@$0 P$0 S $6RS0pNSUP!P0dP@UdpK  mPP40op 0e $ -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |OP X pX Y X R0!S@ R0]S@긖 -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  kNP``Fv긖1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  PN 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh MPc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P? 0?I00P000:S00P 0T HD0L0-SX^U0 00 D D<X 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0h4}PzP0D,-A  -LMh4 4  , 00 @4q8 9bPPP@2bTX` U`V`P40c"bp0S0W<0 ^ ~,@\8   00@T pWP8o, 4 0, T < 008 -QLM@ _Pp `PP*PU e*0S z_0S0@e P@cUp:0h0 -L`p \PPZ 0#S0@Pʯ@ -LM @nP 00 mP00 p-@LMTP` TP pU NP0  9P00T0[` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ ^ 0 SP/R/00040 uN @0 bRP ^8 R00 4_N0 cR@P ,^,  P0 S/R/000.S0S/S  8 0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` MP0 Ulp ^T X0T L0hFP 0P@@4x -LM@M|0     00 K 0  P 0P/0000 ` -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /JP`dU VO V> 0/ c 0 0c RPBNK ` P@D]@D` `P0`(K P/R P PP X@,0 S ,˳0S 0.S0.S U0u/S U0.SM`0/S < -LM@p|0`A00 0,0< (p0P SP@20 P00S 0`` S`` og kpqW@,K -PLM`lp@82 T& V`0 0,0$ (` p ` P kꘀ[ڎx0\Ҏ00@0P zkP PP PPPPL -pPLM`l@*$ T P (0S0W< 00$  `  8k\ /kP P PPpPPPl -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@P5kpl.@3 0- 0PSL@FP pPP0 , 0,G 0- 0PSL@ +P p 0P 0 P0 0-0L@P  0S0 0  00 0, 0- L @ 0  0 0S[ :Q0a0 / [0 P0    0h $0 0 ĥ -@L P 0 Sw p   0:0@ #  = S , 咍@0  d0d@0 0 90   0p``V  KPp``V@ 90 00ꖱ0S@ ;0危 0W$ 0  ^000@{$00&@إ -LM @   0S9 / &:0  P U0S0 0S0:00;0A0 00$ 0:p  -$00  -LMP `p* V# @T T@ Z0 `d d0V0 pX f0;p @T  -P Lp7 WpG2 @Tdp) @T!  kZP @0a@T@` jZpW00 V dP  X@U( -LM @T 0S  0C 0 P 0S 5< 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S T p-LM @`A v" + 0`KS" PK  㿃P P0S   ;00 $0p  $0 0\  R 0 B `0p   l P0-L@P LI 0h0 -LMP `pZ XS@T 0PI T@ iY0 0 d0 `dpV&p" VQ@ [@`T`d  @Pp@`TV  >Y 0 0f0 錯0S 0 ;0僯 00$ 0X &"꘦ --LM 2 -p-PQ LP@4MH`KH 0 0  @pĦ --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,Q@T 0DLS X X X X X X X X 0 X ( 8 X D X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X P X X X @TYT A0DS 0@%0DSSk | 0 <0<00 <0 d0D,pK< S/ | | | |  | | | | |  H | | | | ( | | H Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< F08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E C D 0-0@ LP0 SlPl0  R0S RR 010000 묔PqDqTq -L!PP@`p 0S 0|R0P 0 T  0e@aP00|PPqTq -LPP`p 0S0@0 p0T d0T 0P <T2P@XPqTq -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P 1@PqTq p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EPPqTq, -LML0@S 80  Q 0PPqTq -LM$`Kp@H P 0b -(LA@,@ 0 4 00 @` DA /A@,@ 0 4 P  ,0 Ph0Udd)\'PqTq      $a(< 0-xL0 Sh0 P  X0U^ {U}P  @^0F0PPqTq -LM 4Kx@P  -@LM0S0   0Q 0Q X@0000P@0,0PqTq -`LM0SĀ0@0$ 0T@ {T}@#pP0S 0S U0Pp0P 00P @PqTq  -L Mܡ@. @0,0 0 4 Q0Sq00] (P0a0 4,0QC*00 4 R007 |P 4,0`Q`Q *@@ 00 `40 )0S 0 S } `c P0 @`DA A@,@ 0 4 Q0@ @dDA ރA@,@ 4 0 > pPqTq -LP 0@S x0  V=QT 0SdH1@P U0`0?(0 VPp Z 000F@|0@u P0P0 :00 0p0 p@^ 0p P{  0 zDPqT -LMq@?Q@0 0 R|a0$ ( 0P d1PH0S00?  P( 0\*,1  ( $ @`DA /A@ @ ( $ ;0P0 P@@T,($ 0`CQ 0\*@ $ `(   10 0 $ ( %i;P00 ``4PqTq p-LMP`@@P`p -LMl@ll P 0S0S $t0 00 0 0꤆x 0- 1LM!1P@@ \ 3 )\0@S0  - P 0 S P0LSPKKK PK 0t `PE\X K0P <@ 0 0TqȧPqHqԧ@@- 000Hq0Hq -@0LM@ 1  @      -4404 LM,@0HqDq p-0LM0PS@TpaT` eT rT tT p\<P`D<P 0<P <P ꄔԠ iP 0S  08P 0S -LMPR0@SD2Q00@A62p Q`z T1s Tp Te T_ TY 0DSLTEQ;1  0BS51R1Ep`0T0 W P@0T*0p0@1@` DA ⌁A000 000P0 pP bP0`p V P 0B<P`)Q``(Q``P H0`0<PL0Q``,0 RPqTq p-LM@0`S0@ %  R 00P0Q* 00p@t0 @dDA A000 000P00m 0 PqTq -0Q0L0 /(0 0 0PqTq0S  0S R   -PpL᥀@T`01@T 1?A1cX0P`+ @ TmĀQU 0   @ Tᵀ0A0 S R 02SP00C0gfff -pLP` 0@01@PT  0R U0Q@5T:;P0 -LM0Sp@0< 8C80C01P`U  0R' V0aP6U0Sсd0=@ 000 P@ 00 M00C0P:P 00 0000CS 0 0P0 000CS0: p-LM0P0`P@ 0T S0 0 R@0P@fDA 01p -LMaQ @ Q1!0 dT Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< oD d\q dq0$d0 ) D  p-LM♣D`0@TP PpOP 00@ O -LM0!0Pp@ `0P W P <P`V @Z PP9P <PT c+P9 KP PP0DD8 p-0LMR@.`\0 @ P0  0S800 0S`pDؔԔ0 R(4 0S 0 0 R CZDT 0S R 0S 0  R Q CZD p- LM@`T P0@0@ x0 P0S V 0 0SPU @Zp0 0`ؔDԔ< - p WL` 0S XX P< 0@Y XX@0  p 00<h~0  @ 0 &먓x p-p0LMd `0`@` P0` 0S 0SPU @ZpؔԔD 0-8@L P0#0 @ PUZ0bD 0-@ LPP.0U< 0 0R0 00Q00S` 0h7 <0 R 00Q00 0000}x  0-\@P0L  0 S 0P 0 0S  -LM@p PPP0 "  ` 0 R$V` p0ppS 0p(K (p $0 0 O`( K0O(0 S  00 0ꄔ Xq 0- @ PLt 0 0 S  l   0  000 000000 ' X -LMp`XP 8C80C S?X      D X  L h H   H   $ 8 h t | 0SU @0S %o0S0SB @0S $a0S PU0 @ T&@PT 0P0S 0S@Z m0S ! 0$0 '@T 0#"#0#0#t0##P 0 p#\#T# @0S4#1(# @1S R 0S0"""@0S"d"0S0""0 0\"PU @"@0S \)|"0S0 !PU!i! P10!!0!0!yd!0S\  P 0}0DS  < \ d t | T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P ꠩xg$ `0-0L@P^$$@0hS^$? -LP`p@ T! ! ! ! 8" " " " # # ,# 8# W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0h -P LR`p %R k R ;0B:S% # # # # # # # # # # # # # # # # # # % # # # % % % # # # # # # # # # # # # # # % & # # # # # # # # # # # # # # % # & p0  ;R   Z @T @D Tʜ @DT  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G y p 0 S P 00P @0S`y@PP200P @0S`yy@PP00 P0 00000SP p-LM`P@e=y ph8G p-LM@`P0 S( ( ( ( ( d( d( ( ( ) ) ) 0S Td"p@P0SVU@ PEP0TVU Sĩ 0-L0MDPK@ B 0 P) ) ) ) ) X) X) T* * * * ) 0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjx0@S Px`00 R 0S0S1SP01Z  p-PLM`P5 P0P 0@S xPyxP 0@S ox0Shx P phWxp p-LM`@PT P 0S 0S=x0S@p7x5x3x -LMLapPY00,Q, p<P@, TPP TP XWiY`E( 〿Y00{(x t@@ q(T jEPpEP@ i]d*h<d -LM@0SY00 p-LM`Pw0 0Plw0@0S000 L000 D@H@ 0 L 0Pp -pL `L0P0A@TJ0S 0 @TZ 0 (H0whswj  \$ p-LMd`dd n0PSpAW ,P1 S0 0괇qx -LM@pP` 0[S 0S@┐ 00  @P w g  p,K0᝴,  R*  wn -L MB0( K!KP` 00Po![P`r00000  0   !0 0B0\0;00  710 R 1! L0R'3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 1 P 0?00 00<0 0@ PpL0PS !0[pS 000P0<0(p!0[S(弽DqH -LM@0, K%K@p`@00  Q ! 000 TP 0@L@T " P  0 00  0000%0[S 000P0<0,:P\Dq -LMp B a8    0`3 0 @ 0O#ODP0`U0 PE00fEP@ U 0 UBa1#  f0E  f00f 0S-00f C`r0qgfff -LMK @p 4 p-LM@,50 R00SP`@B : 0Q(*tu0 V0   0 00 0p0 00`2 0V0 H 0 0زP  㻼T p喼X| 0-@0pPL  0 000h@80/   ~0q -0L @P`iM    RG  0 l!@Up0 00SB Q/ 8Q8-Qp% #Q, 0 % q0 0  R0Aq00  RWAq00  R7AQ00?$QW@d@T00S$T@` R XRxR00`_0D 0-0LM @K{pPh  0 R  R0P  00 jt0 -L M`@10P  0S082tp   ` P P q00  R@PdU0n@P 0!0!!0eP@ 0S pL10  00S Q8!0000ӑ0Q 0S p00  00S Q 0000ӑ00S q00  R@ 0P  0L @00S  ADxz -LM0p 91` 610P00ls@ fA@=  0 0c0 \AZ os -LMP, 00 AP` 0[S =S `@3 R  % 0U p[0  , RV0 xºV h3Vs,  Q 0X40 @L , 4 @ )80 <   0T0 V0 S   v ,0   k 0 00 008 0 R00S@0    0T0V0S  <0S0  Y%@T4 R} V 0   h0S0 ?S 0S ) R MP 4  00 00400Z  r r NNDn-P i-PIb-P ,0h  o`@P  @QL@00  Q 0 넔|lD - L`p%60W00S PU 0@P^rU 00WD0<0 0h> Kr Gr ! -PLM@ 0T0   R0 0Q [R P@D-0S00 0\00 Q\0[S 0S0 [S ]SQD -LM@P0 0S00 -LM@P  0S 0=S   -1L M q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 q0@` DA {qA@,@ 0 4  L@T   P000L@T0 4,0Q* 004 0X0@` DA OqA@,@ 0 4 s0<0  0 R8C -LM@R $P 0 q -LM@> P h q -LM@@P:I I TJ TJ TJ J @h0 Ru M00 pW-00Ĵp k  0pWurꤊ z p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPv0S00ꔊ -PLMpA0S_ PWa$K@0 (K,K @zPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0+,0 {0S @TYP p300(Q 0ppr z|ptD$}  -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @yPs Ve `FVV80S940q`@M,03,0!0{P00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y0P PU48 v4y540P``pyx0 @ x00qQk D0@@ P[  00r z$} |ptD -L$MK0 K @KK @xP@ pvxy6 0 RPPᄔ -T0LM @R 8 TT^hHuGu@@$Su@ꄔ0P00 ꜊ -L.uh)u -LM,@0(SF^0000ꈊx -LMp@PQ`!dp s1 @bTQl@0S.S p10  00SS ! \0 B2?@1cS@`F0S.S.Q WV$` p $K$P 0P00P p0  00S 00Aq'BQ`U@0Q qd00 @ 00S 0S  Dp pgfff -0L  В -L* -GML M<2 88@Pp`, $"Ydp fPp` iPp` 1 @bTQo*1IKaAA/Pp4: S TcȿiBKHH+ P: L80Y/S/00@Tt p/P`` 0SP :0/S$ V:0/S `FV:0/S`0 SS0@T4 P  .P40`FV:0/S  tp -LjM M(kKH0 H`p,0 DP;2Q $8P2 R2 RVἈP,0 S ,A0S  |6: S" KA ACP L6: S WP $ل6: S V c/MK@D @D>P P@v>1( K ! Q@10 ` P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`XUs7PRL 8  ,,4DThM D($q $8 -0L$M@  H0 < H@PPD@ <_@- Pp JfPbᒕ0Sp h ᯤ@T SP 4@@冄P==@a=D0SFfP=00LᭀP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , =-P|=P @@Ӄ<IP$<ʃ@Ń0-S @彃L0S @嵃H@@ 0 R@姃@壃0;0<`H0P0dPrH D a@刃},MbԬ -LM0 4 'P; ,K 㬂p# ,0.C4 P ,K 㙂p ,0 C4 QQlxDl@ll 00Ӏ\98,$@4,4 00€Ddtl,p 0-,@,PL $W  S NВx -LM@P 0OQ 0-@LPU 0SQ  PP e꬛ -LB5Э 0-XPL0S S 0@ S0 00받 -LOM\0X,0 0P S ,0 S ,,@OKKK`VT RP W?K+ywPW?K \!QH1SD1 L1@"\0P S Tb818S \)<\00S#\! D`K 0  \xC0[SD[0 CR 0R P 00x{Ol~0 pW@X D00CS00  ä0 dOc (@hd, -0L 㻹В| p-0LAM @P` ^p sP` /0 @bTQ!P Pp㏹GOK PP V{.PPM dp -0L niВ -LMnQ@0,T  h{00000 0 000\  -LM0p (0 QP@/UoKK/႟PKU  S?K\ 0SKK,L1 H1 D1 @1 <1 81 41 01 ),KL0# `Ni8(0 S ( خ -LaMb>K0C 0Cp( @@Pv$6: Sg  SPW(0 S (MBnK`F`F|!|1)0S@aDPP$[NK@D@D  .P 82W>C R0 RW W7P~Gz0S @PPW d<~BnK`F`F+M0)0KW _edA8, -LM@X 0s +^(^%^T07at -SL Mp@Py00!1/dP`!  @Vx y0S@ 0Pa( P* )W@y?00 \@a` X0PG( P* W@y?00 D T -LM@ K K 0K @@&P -LM8 < @ P`pm 4KP@h 4 0R SB CP`Z 4 #40@#P0PS ,KL ~PP 0 hP@ U10  iPP 00S0 K1_P 0 R ;;S SPP 8P GPP 0< @0T ;PPV `lt -ML M0$ , p_ P`:x?000!1 ,0S ,.AzP@ hLP 0  5P x0S08x0S !0uBKHH F]"0@CdPP- 0@S" C0S =0S+ 00L  \ 0$ 0:x?000, 0>$ `tvԯ -L`S$Mp0K,  Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq<30  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/x "00Z w 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUw"00 P pL1  0P81@@K1`E% 80 ,,8 lp0@0KX0 4 W^0K J40K5 B"0@Z$$ `JPU *0 K0 GP00KU:@ K00K ,@ {V`})V`$x, -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00SFw"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0% 0d|8^,Q@00 K00cPE: UcU pP/긟xcc\gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PPPڌ@PEUp pT00  0<0S000PC r0 0  Rcdc -LMp`#0P@ r \P B\0 P@ -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 ᬯPx 0 ᭯P0x0Ńƌz(p , 0 KV10U0 y0 P@r0 0 }0 R? -L Mp`@P@g<K4K0H0S񟗦L l X  8 4  \ 4 $ < ` x  L  L l X  8 4  \ 4 $ < ` x  L  8D3#cX Q0@ 0 KD0  DK5P0S wq!000PKp Elq!00CP3L#cX Q0@ 0 KD0  DKP0S Rq!00 DIq!002cX" 00D0 ?0PKQ@  DKP0S -q!00h D$q!00ŸH2D"cX 0QD0 @ 0 KH0S DKP q"00q"0020K00!1cX! 0QD0 @ >0PKA0S DKPpp"00lp"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLp"00Hp"00D00K000 0cX @ 0Q@D0 00K DK\P,p"00(p"00$GdḬ̇  (048LPTh|@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R ]p!00 CTp!000賭00KP0 cX 0QD0 @ O0 KA0S DKP01 R /p!00l C&p!00x1腭00KQ1!cX 0QD0 @ kO0 KA0S DKP1 R p!00 Co!0002W00KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R o!00Z kCo!00Q2)00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R o!00, =Co!00#300KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R wo!00 Cno!002ͬ00KR2"cX 0QD0 @ 0 K0S DKPMo"00Io"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R %o!00 Bo!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R n!00 Bn"00v0N00KP0 cX 0QD0 @ 0 K@0S DKPY0 R n!00QL bBn!00HD0 00Khȱܱ08?G? >Qk"00Bl2h"cX Q 0@ 0 KD0  DKP0S 7k"00@ > >*k"00A1!cX Qi0@ 0 KD0  DKP0S k"00@ >L >k"00`AD1@!cX QB0@ 0 KD0  DKPw0S j"00p@ > }>j"00c0 0cX 0QD0 @ @00K0@0S DK|PLj"00Hj"00DD00 KLP|08G?$P80< cX 0QD0 @ DO0 K`0S DKBP0 R j!00  >zj!0000K000 0cX qQ00KD0 @  O 0@K DKPZj!00p-`P@0!@`Pp -P@E:::LCLM/\p, J\!h1S   00 \ 8AS, 0110 p0 30 D10 46@ d,0 "&`'@0@p 00 #`P@0,!O3\ \0 L03  1S@̳Rp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@Lh \ p`T<  0 p`@A 0-L LP@᪦\4 00A 0-H LP@᪦0S0hᮦp0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&x@(8!8HT*@@*TI2@0@bP8@8#8XU*P@*U@2 ȀP`Vf*V$6 0 0 0sL0 !Ƞ,Ƞpf&\ P$\ D@$8XU*P*UP0Pb@\ L Lb aD@7&41H Xr\P P \'8,Ƞ LXAU\ D@ P *P*UP0Pb  @P 8#8HT*@*T@0pbV#3T< @ @K00KsT*T8"4 0 0 0sL0 D WR:0RpD0 8@T\ DP 0&@-O@d4xB 02d @-M0Ѝ@4=> 0h 76ܴ -L MQ@0K00#  0 0T0P00S00#0 -LM K K!rP -LM K K!fP -L 0KM#N% -@@L0MP0  0 L0  00S00 K( K@P(;b00c -LM`Rp @t%  P`F @pT`P0AS Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á? P              plhd`\XTPLHD@<80Hdе4\| 0- LM@P K0  0=p0J*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J|          `                       \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s  p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  n @` -@TL P`p T0g0 0l 0 e@DT * -ML M<$08,0  ,PP^ P@cBnK`F`F sP 0#S   P<  P  P33p 0PP( BNK@D @D ^44S ?R0Sp  iPP  H44S ?R0SpO/2 ,0S ,qBnK`F`F B`rP 0#S \ 7L 28 -P  $PP' BNK@D @D 44S ?R0Sp  PP  44S ?R0Sp BNK@D@D +Q< PP .A0S  PP0SU|K0S  E0S  ?0Sp 90ST 3P@008  @ 4TLx<}u -40L R4P P00 0-LP$P P$@ P00 0-LPP P$@ P00 -LtM@0SK 0ǂP H K 0S x0L: S< ^O00^0tP0D -LM@0S00 -h0L,M80 \0 00 T0@4 , (0 $@ V V00 8K 0  鬶D`K $P0@-@P  0S ^ 0S^0 @0S SS00@00P0* -QLM@,0 pR qP4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4> @,0PP`@,0PP`]0 0** --L]M qPM?KC/`KK \1 4Q 0Q  =K0K0Ǡ0S cK|1 1  x tp@ 1P|P 0S L  |1S00\ 00ՠ0|1 By* -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ ! Q*v* -LMP -LMt"  2 ,  " !H `W]0P2 8~PP 0SJ?P OP 0S \ $481!`)!w[0`X0 `R0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ  . .OK @D. P-?(K R!  0S .?(K R2S "RK KZT0 4*  MK0iPMKⅽ P+ 1MK{ PZ. b Z0S Z  L* 41`ZLD @. hZ0#S Z  R@\K 0@, "|@@"2@@[P 0S"2P ~@3$Pd Dȶ( -L,Mp`@ KD0K< 8 @ 4 0 , ( $ %PDP@  0`4PP @TDؼDԼ -LMp@P `p08K8 (P , 4` p7K0 8K (0S (H  -MLM Z,   4 `a V $ 0P@Q rX1X1 - y$Pp' B^KPEPE0$!W<@a~`[~V INK@D@DP 4: S  R 0 >0 ,0S ,Pt $R 0R\ 4 L  8` c,8Pd -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $墢  -LEM@pKK, 4! 嗾K081 HP@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``)Pz0+Sd -S D 4zP0+S0 -S HPPUb ?? UP[|,0 S t,0S @S 'P K?Kv*`0S @S K?Kh*0SP @S  4.P`8~ 81S  K?KP* 4t8 0SP @S 8~ 81S  K?K8* 4\8 x -LM8KKPp <, PP `P@ ,0 S ,hP/K%>KH D LB @B KH L @B 0S J"00J@8ŽJ@V:`P@ 8 `<0$=.`800馎a0ASt t t t t t t t t t t t t t t t t t t t x ߞCp+WP -W=WD =W @ D 0X0C S񟗕u dw dw dw dw dw dw dw dw dw dw dw dw dw dw u dw dw dw dw dw dw dw u dw dw u u u u dw x x IPI@ Y 0 Y  X V:H 8 ₡ H UP@Q 808  c 0`@C<0 `@D 0Q0+W00=W SD  V:H080⃡ H0 .P@* 8 0 l8 `@C<X@0 y`@ V:H 8 ₡ H P@ 808  c 0`@C< 0]`8/XD=WQD =W VD :H080⃡ H0 P@ 8 0 l8 `@C<0 6`@Q V:H 8 qH ΍P@ 808  c0`@C<@0X `0S ,S 008Q8钀:I8tI0'@-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!* --LM p-P0LM@`P8 4T  Tn gВ* - 0p@L` GPP0S @TP<@ -L 0Shc 0-0@SPL(( 00 00@ 0-0PS@L傌PP~ PP0P -LM0`Sp (KgPP (QC 0#S@ S> 0 S RA(  #P0e(0 (xP@} ( (0PP,P@ P0 S S0 S S P0P0,K ),0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @ܰP@ PP 000  bG0@NG0@00㚋P0P 0V4@c0c -L>0Sct\*;* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ pQ BnK`F `F nʞ<1$K R@ 0@S 0fS5 B^KPEPEbS  @T0S(0 S (ގapW0 Ƞ0S PᆉU ꁉ*P, ! Plg| -Tp`LP6_P@ 0S 0S0S >c -p`LFPP ᇩP @P P 0S0S c 0-@P@0LS00v$ 0000ᥬ c -LM(@0S0 00 c -LM0St (K Q@`Tg ( 0 S RL0L(  S *(0#` @Rq LPU`@50S0T`ÅậPP `0 S S0 S S ᫭P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\~PP 00PP@Ņ,,׫P $(48@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L** -PLM`p C000@,K0K 0 , ( @@p0 WV0000嵇PP0  0 @@p  TۇC0@ՇC0@* 0-! L0TT!P@CT @@ T 0C0 0 -LMp`P@匀T U=0S0d0 @ȥX00U@ <:((tq"nvC -LM@(`[@T0 @Y -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K S0KP@@K <00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S NB"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I   B00! RA R0000000000000000Z]* Z* ?0-1pQ LR@` 0S 7P @@ Z0@< 0n000S@@ ?0-1pQ LR@` 0S P @@ Z0@< 0 000S@@ 0-LM 0xr.0l@hPTX0 RP 0 PP@ 0D<@ p-LM@hP`\ 0 @4Tp`0@ R<T 0-@LP 00,@r.0 ~ 0hD< -rSLM"0@P` :rAp 0P gA0pbA p-LM@hP`MM \0 @4CTp`0@ Rm<T 0-@LP 00,,@r.0 & 0hD< -rSLM"0@P` :Ap 0P A0p A p-LM\@0PSP`PP ᒨ@0PPPpPPp@\X 0-LP(P0@P @0<T p-LMDP0@S8`p_$0P@@@˄@\X -@LMh< -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KC\d QR dPPCDCPP XK 㫫X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,yUT@PPh@T P@K0h LK@Ph Uh  LpLP Lyh00fs`V tCDK0\HK P@KLK @PULD0LP 0H3LK2 P@K@P` P: h0S@- ԃh@ )R 'P  T 5P@ 00CS0 0Ӥ0 P p 0+S:P P P 㻤P TKB\ d0@RSA00崪h !P㢤P \QP!00 DQ0SG d0S7 ,0d LKP@K@PPP LrLiP0T@KPT BB{BPP d@T XK⃪X 0SpR`@@K` `0H0 eP X`\d@@(]"*h*$* -LMğ !  \ ,    !4@R@ `h4@K K 0  K K,K  K K K K KV0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0pCⅠK  =cPP.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00m>L0@X XKK, PGK _K [K WK SK OK KK GK CK ?V0S 4x!)?l0S3 0CS/,>u@41 ,0S 4,m KOp>0S  u WK@P7KXKL00L0 60[S0X K60K#:=00HBp`= 0 X x4`K* 0h0 -L0Mp0P 0 `@ LKL@KD00D0 Q Q =00 0 S 8 , aQ ؚt,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0d *K**%*o* *R0S 0S0S0  R00* -MLM00  0`5`~P D8L -L M0`S$ p  :S0 $0 0pS PK%t:l:\:P@ (K ڢ(0S p00R0S :P@  â(0S p00R  R W1 $ 0 0 :|:l:d Q T1 R 0S0<00  00  0 R 0 R0 0 0S 0k:g:P@  =(0S p00R0SP XP:P@  &(0S p00R0SP$| DL -4L  0PP 9`Ŷ@T T 0T,S 0S 7P rr  0PU  0PP  0PPP p-LMP0 S0 `@0 P P0Sr0X S0L@0Sp00wr tr qrP -L MpȀ@0`SP(@ &\0  #P 10$ KvP(KygP  (,D0  $9r|PL@-0S@ @ 0 0 0  -LM`Q ^( @`p$ 4 0ϲPB ( K10"P; (P6V00T00S(0V0T00SW P P0 $&@6$ 02P $ 03q$KP --LM -L@`p-`0 XXP׹T  8S8 $0  ƹkВ*{ --L 0-<0@ PL,,孹T R 0hВ* 0-0L@P 0SP0 CR 0P0 00R P5- 0 0 -PL4MPL p` 0 S@P X 0 S @P L0@K៶P\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 u -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h ߮P & P0S1*8  ҮP+ 8000 -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi P0S PP PP  000   PP0S (0PS -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , _P0 R 0SXpx0   0 R PX 00p , 00  RP x p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4  p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00Sid l l l                 ` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S T -LM P p0 0@W` 1R Vg@0S P0 g0S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ gP@ 0^?>1  ^0g0@gP@ 0@0gp@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p值0 00R0fPU@  P g i鄹 0S  Pig(g- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!(000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 \f0S @ 00h 0-0P0@L Hf0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0eP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheeeeeeE -LuMp0 (, 1 8eP`` 3ePPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q wuK $P? 1 peP@ oK 0 ,0S ,jj0 D10See H0 @1e 0( tdX 0 -LbM⸠0JK(0 嫃p @)@KpZ_K` P TjKjK11 P 0S(0 S ( j P -$0L!00  -LMpd*t;*8*P5*2*/*3,*)* P-L h/00 -PL`0\p \=|# 0 0  R3 @ ph P1@rT%0\ \|h3  00SWpG3 /\00\0S@.\ \|3  00S0 0/\@- \ V t0j T ڊ>j1!W pG T (00 0S @S@S@@@0j!T@QQ10  00S V؁P@ h P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ ឲdP`a\ h000X0 WpGk 0002XpGHdxx -LM0  ; -L M@ 0@+R*Z* -QLM  0K  0  3 0-LP@|p Pp U T 0\ pP UO$! -LKC/JK X1 0Q ,Q _?K A xA ZD0 bKd1 t DQ ! 0S +cp `6{*߿* -LM@`p(]PP: 0@0@@@@@@@@@0$` $0 P oP@0 hP' 03`P,YZ#| WP ` 03$0  < P$00$0e]]]  `ٲ0S $ )@TD0 003$  3S03Y`` 0SV,0`@,@ ,@ B00|;0 0 D -LM( Dp$ ` / PP P Pቲ@ (@00 00 0S p-LMP`P 3@S0S0@ ]3S]P(P#\$0 #10#0V@@T\0p\0`P`{$0`\ -@LT` $0* 0QP3 Q# R 0PU@G \3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` ݸP3ա 03šv0 #0$0@eP$0 :.$0Pm\3s7 0$ @Q$0@ 0 S003BP $0 :P3 $0p 3P 4 0@/@$0 @2 u0\  @@_Q $@ 0 0R 3 P0 3L00 P  *PP$0   30P0K0 8P3 03 PU 0  PU:$000# 0B8S 3S  $0H P3ԡ 03ġ0 #0 tv R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h ῷPp OP6K00 -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z NPP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DTZ0{ $40$0:$0?00puP  W $0 P T 0phpTP{Z0S 4 03$0:$0aP 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 0300 <0 @400420#4 0 BH  L ,0S V4 #400tv -LpM$0@0PK@P0J c:P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`|Pp` p L 0 0pkP w00 -0LRP@` V P  0 @T` 0@T000(00~YPpPppLY -LM$0HPPp`YP@ 0 $ 0I00D @0(`¾0 -PLM@ @YT 0-00L@ :0S00?0 00Y0&YPP 0S PX R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0!0UP1S -LpM$`@P R KPp 0 0R, 0R p00V@@.yp  ۴PP -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ Tჿ4 , d/|  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PP{UyUTPP\oU 0U`@L  0%0D UPc`H0S[OUMU`@0\ PPᙪp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  ᓵP   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@Pp'PP$ 0 0( 0 0, 00 000  4  0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$OOOTPPYO$O ^Od@L  0'0DNOP^dH0SV}O{O$yOd@0\ PPŤp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  `P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LMp, 00 Q,(P4 0 8 0 Y0000AϠ0 P0P 4a < 0Y04 `5<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 80 40 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 Y00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< P ,Y 0 80 40 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE1D* -<5L|MHK0 @K0PuAe/@ L L R *0S0L  L 0|S :S 00$@$@@L KPڄL坜PX00 LP`: @PX0L0P K@X0pP0<T K(@(0T0X K@00X0\ K@,0\0@L K40PL d K@p00, d0h K@80yp408 h0l K@<0op6[>lp K@4gp7[0Pt K@4_p7[04x K@4Wp7[0| K@4Op|00 K@P0Gp00 K@T0?p0: K@07p0,K: 0 0K 4K   -Lp= P@ dDP`$ d0:SS ^S \S $ @^ 0:SS00f^@A`4EP`VEPfd(EP `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?$0X8@XXXXXXXHXXXPX`XXXXXXXXXXXXX$0X8@XXXXXXXHXXXPX`00:00 0 0 00T 00S:S00ov -Lp= P@/ dHDPP! 0d:SS 0`e\d@ 0:SS00e\@APDPPU]DDPd P  0-LP# P 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@00 :S0-LP 0:S0@0嬖@0- 0 Sn@Sc -LM K"弜vtO*$* -LM0`=S`pPL,KᮩP@; U@ P:0P00@S=S 0S=Sg! P,@CP 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC QCP@ 0 0S ,0 @0@, 0b$ p-L@`M@PKAP 0! 0S0 pb 0-L M@ɘH0P (0 $ 00K K(0@  0  ,P 啥P 0`KdP* BL*A`G*#D*@-@0S  S 0Sd@(/*()*Q0 c 0c$h*$%* -LM< 08 rSwS@T 00  B, ,0SZ 4K⫝PTpPH P < 0rS <0Z@4冼,0@, P,00,  4H@00@T 0m@T< 0rS 0d4P 80M4T0@4PT 4G0E,B,B(,x -LM☀@`T 0S `@TT $pK pPp0S V0000uBu$( -0-LMP0 S@   R1 00 cQ  R!,0 嗶 0S }G0 b -0-LMP0 S@   R1 00 cQ  R! b 0S HG0  -0-LMP0 S@   R1 00 cQ  R! 0S G0 $ -0L b -BMLMh#0P,0 0L4  0S 00,3 ,0S ,F/PL$H$ K堧2P@@00 cBK J JH MK@DPpP 0Sr`0CK0A S A P2D4 H2@ K0C0C0  A  ᦵD00C=S񟗗xتxxxx0 S  1S!00 c0V pMC0L4 dSPnL$R 060S3/ ,X4@bx,@-@^  0 S SS00N0 --L ="d 0-LM@P0S 0鼕0S 0S  \ 0 @@P -LM@`P峓P pWMW0S `U @YT :0S e@000@0PTP:@T TW@PP   0ZT -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`(T < j!000 ? phВ*{P 0000ӑ p-LM(0`S/    P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ u0 0 -L * -2MLM#0@,0 q0/S  P BKAA ˔+ p Y W3*WY 0P/S00@83 ,0S $,D/ 弑P<P"P@aTnK`F`F ؤ0Z0pd  哨 0 S/R  Rm/0 0 x2(K RW\᭑P LᨑP@ Y 0C/0h@+l!PBKAA߽P@L<: S< S0< ?nK`F`F!PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +. Pp* +8p?00^ 0@C/]0@h>00SZ I, D\+>00S8 B>K0C0C+< ! ptv -PLM Q    0@+ @C5>PAp .0@0K+P@ `00  I @ K4P@  Q00RPPU<0S :   `>Pn 0g`0p00 .000PP_ KPZ/000S| _PUl 0.S`   ⪣KP Z 000S0 S0 @c0Q00TQ8  >0P a 0 0@b 0 :@ Q /00b  00b0 hQ00 0rQ =XC ="00 0S 040. S0SZ 00PP 0 S/00a0 a = {0 0;0 H=P   $! p-LMP `V p 0@ Hd=b=`c -LtM㢙p@  K+P`0: S ޶20 0 ㇱp <PP ;#;S + <Pp  P`  =ᴶ ᰶ p-LM@<^<*pUP@P7 P N0 S S0 S S TP`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4TP@ P^P $0W`4D<4t -L(Mp젟0 S( PPP 0@`8PK P@'P00XΞ    t@@0p!lL0\S@0 !$ 0^A(DG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0:"&!*  1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@ЍDBbt2 -LM`0(K\p@P.  ϐ($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ 娐t -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SX, K00KUPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ |~@a 01S @-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P: p-@L$MaP2 ` 0( LX%X@ ph -LMp0@P 0 0`K 08#HT UPUP#08  0 S  .,  -BMLMr0D`K@P ,0 02S0$S aS@ t,0 S d,.@0$S H KR K0Y@~ P TKB~AK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 }TK O~ rK @TK  T:k  (0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` ϋH0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z -LM@t@ğ0 8`, My gP 00 0S$S 00R5:0PK c 0y *y K y  y 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,'L   0-PL@U !", 1#80!"$ 11PX 0h0 -LDM@@ hK⼇ p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆm*#j*g* -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q' 2@2L2P2x2\2\22d2x2x2x2 20U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 30 SP:00( -LM0@S 0000 -WMLM0@P=KC/NK, h5 @A (K  2@2  0IZS7UU7UUUUUU8 9U49<9U::::::::::UUUUUUUUUU:0PU0PUUUUJUUJUUUUUdLUULNUUUUUUUUUUO;0P0P0PR;RURURJTUU UUpLUUUUV.(K0S 0(K0  00A SPڅ 10 A0 R0PC$^ 2S12 20 2 2"S 0c" 2 i eb\ R \ 202 b K).K?K W+ >(K *Y 00I SP100PC0 I R$Y 0U@@22R SK).K?K .  00A SPڅ 10 A0 R0PC$^ 2S12 2P  0U@@" B\ R \ 2PB K).K?K 202 P100PC0 I R$YR   } 2S"12 2`202 VgTB   00\0S㬀K& Q; ':Q <#r`>(K VR  "202 @"PaUU&0 "2 0RPEK2 " pUʄ6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTp PfUUhE00@ "2 0RPEK2 " pSU0 "2 0R2 " p@ʬ" n` "2 0R2 " p\ʬ" "2PcUUş00 "2 0RPEK2 " p=U! "2 0R2 " +ʰ2"R2 S0K 2 K7P P ?KP 喫02 0@,0 S ,8!KP PK KPKeYU K/ PQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCUoU C00@ "2 0RPEK2 " pU0 "2 0PPK BKPKKP{K"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 p1 0 2Q02  KhP0KcPK )AKZP"K20 "2 0R2 " p!ʴ0 0 20Q2  p K 0C0K@ "2 0K*PKK#PK 4 0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q_KPKPK \AKPKKP~K2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0 KzPBK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " TPK $CKKPK00 " 2R0K8PK3PK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pkڠKPKdPK lDKPKTQ K00$0(0K0 "2 0R2 " ?KPK'PK % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 {p0h0 "o`PV P00 U- >(K Pu`  2"S 12 2`0" 2 ~ 2S12 2  Po " l2 "  2S 12 2 Po  W"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 )   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2SK 12 2`  "  >(K t@ GYgYT@y 2S"1 -K2 2202 -K$P K/ 뤃P- >(K ` -K"Px2KL -K<KK 2 GYgY|\ggYEeeY"fY \  ``y?(K R- >(K {\0l``\`T ` 0`L K #2 S``2 2 KS12 2  @]"*" l\2 0 z Q 2S12 2  2 @ 2 KS P12 2 202   2 KS"P12 2 202 y   2S"12 2 202 c  2S"12 22 /202 NPTl2S 12 2 2  092LS1x2 2  P`" 0" 2 x 2S12 2"0X T "  {P `hV`k`",9D $Y K >(K`2S0 2 KRP 2;&KHPK0S"O 00 -LM⸉p㴐K @4KP  , 0 4pK3pK2pK1pK0pK/pK.pK-pK寀T9K  0Pڸ0@%SP@D @ 0AZS8Z^^8Z^^^^^^X8Z^8ZY^8Z@Z@Z@Z@Z@Z@Z@Z@Z@Z^^^^^^^^^^tZ\^\^^^^[^^[^^^^^[^^[^^^^^^^^^^[xZ\\\4]xZ^^L]^h][^^^^^[^^[^<` 00B S`ԅ100C0 A R$Q 0Z0 W pKK0̠ P0 @ W p ̠pKK*Q 00A Sh00A Sc 00B S`ԅ100C0 A R$Q0Р P0 @ W p РBKK <100C0 A R$Q 2/  0Z 0 W p KKh 9  0Z KK[  0Z KKP 0Z KKE@ 0Z0 W pKK50Z KK,0Z KK#   0Z KK   0Z KK  0Z KK 0Z KK@ 0Z wKK0Z nKK 0Z cKK0Z ZKK hR @y lR t r  0Z BKK 0Z 7KK@ 0Z ,KK  0Z !KK  0Z KK  0Z KKz0Z KKq0Z KKh 0Z KK] QW>P$0Q0S_________________________PP^ 4 K^ 0K00 p,0 S d,PȀ40 :xĐ  X -LM`PQp0 @ 0 x @|@  b-~px l( -LM @`PfT40 p ETeTpG/  P090 ,K0K0RtgTGTp400  fT@ I P0@ 0 R*00SC 00 0:0 g 00S 0@8 a P0h0b -0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR   gfffl 0-L@!0RP0L1 0 000 0pP 10p -`Lp@P8#8S"!"81 ("((^ XU 0V1`P` !@ xp -Lp B/ bR@P`0ڃ0Rʙ V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@;00@ -LMp`PW, `pP 00 R"0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp&EQ @T` P 0`S @c0`\0p0J@`0 1pq -LM0b 0PUp@ڂ Ul R0  R00@ d 040 Q2 :RP 0E0e0Q0: P!0 <01R\3# -L@PP`9 @P``!p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@B 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :CVP -L\M8 4 ] 04ޏxCPLP PP T T0  q0 0  RT  T 0-S +ST T 0 S/ 0Sw T0`/RX0 p9R 10W0C10W0`CT@p /RT@ 9RRHp  @EReR@@ 8L04T  T @04  +RT0  -R 00B S4T #0R 10BST0B0 /RT0 9R T@10 0C/RT@ 9RT@!0aPS^@ ` @ W @@ @lH@@ \W  H D IZD0 SD@00 HLNoIVP@ 0 aNWl aD@@0dPU 0 uNPV MU-'"00p0lP dwhupslqto8QT  P0 SrNx0||@??ER$ U@ L`@P 0 3NU`ʄ5I1 0 'Na&j0jV0Vἐ5XH 0`l l l0h  ! it , K00K^d @@p T@,`l0L! 0P`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQpdp @dd@ VdGd Zh h Uh;h Wp5p hdt 0< 0pcP tpM/O P@P).O MP@<p`Pp`zP/O bMp`*3 Z] Z/O pP3.O LMzKOH<p`\p` x0 bM 0 7Ma&jjZ dhhfpdtb<SK(H0 2MP@<PX46S / FP/ 0P - 7P`K5I /0 M 0 L1#:x":S5h2\ R `@t<\ O0p`qX46S X N0ndYl"0y\0zi/ P . LP@F[O0<0S, 4`!6S \ <@T 0 LJ/ P@PH  0 L>x1#::646SX1#::C (< R%X#46Stpt 4P5?55?5???|XxAMPe ,  wMP@ ERUlU@ p`@P 0 LLU`ʨ 1 K 0 ?L`K O P`` K@K0 L0 +L.O P@P5 P@P Pg@0QtA 0 @ n@ L0 @AL 0 @qt@  L M}/O KP@[/O KBL  40T0 T 0RT T@ T@ TW T 20R) 10BS0BT PX QP U EW !p₠1W`^W 1p⃠W1Ѓ`PT0 T0 00B STP 0RT 0B Q@L@ T0 0ST S}0T@P T@ q -LM, 0 0 S0 J 1P,  4 p tP8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LlM4 \80 p`@W00qdz01#:H":S !. P  002Q0 0000K, K0':ც᪪Zp T K J%00ƂJ0 KZ/ l J. JW/ JP@ ER/ J0 JH P PP QX 0 PP00CP0 X 0j@SP0S@dB C`@ U< U<@ E` ES`@ d0 ` 4 ^ࠃ^4 N4 40P\ PS%tt<D?aCoc?`(?yPD?lh0xS񟗹(ܡܡܡ4ܡܡܡܡ<HXܡ`ܡܡܡhܡpܡxܡܡܡܡܡܡܡܡܡܡܡܡܡܡܡܡܡܡܡܡܡġܡ̡ܡܡܡܡܡԡܡ000@ 0S`VLB0S<2  02 P@0/h2p' 2. 2Ύ 000 0 00S 00 6 0hpPPl1 ,0S ,|/Z 0000T1LQ:0@1 14101,1(10p0p0000000Pp2Pt p~lpK? 7kP@`&yV0@  Pqpi@n L@8D4p|hxld -"L M>@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  mZ&fQ *6 p,K,(2,  R 2Pj@0T1 *jP,0@ 0, PT1:0S ojP,0 0, P11 0F0 Q 000S P!0S0 0 ?mP  , R0000@ 0f00  :j R,  0#P R,  0#PR 0#P LA0 0 0 ,0 `Pp8D<t0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0liiP`VP@@`@PFPL p-1LM `R@7 0P5 T00Q00SJ` t!* T|P0 RU 0 RUU00S p ]lDePዽ 00Pc4dx -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K2,P UP2 2pi\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 ck0OP@ 0 ZR Z 10 % f s :#:S `hP PU,P h @$ET P, UU` !@h1ShpWPU,P  h @$ETP,p U0 00 SR0 :JR|0 R0P@  Vf tbd4x4H8<DXlt p-1LM PR 0 R/0 R *0"*RPb%6 ` V#0 VpK0@ T@t0 p0@5h!Rjpp$܎,4dxH8<D$ -X L0PS HH 00CQ07 007k00;0P p-LM`0PS@'00 S0K0 0CR@0l T00\Q00Sp 00kpj``$ p-PLMpPp`@ 0S0X0T S0 ph?0 0CR0pphjjp -pL0@S`.P0 0S0"T 20 0CR@0x T00Q00SLq뜻 00jJj|`$ -LM` Pp\ :36021V 0RP!*PPq Ve0`0@0@0001300p YjPK@\ " @0d!ST 21 @!T 0U '6 p(K0(@ T@0 0@fQ 10 QX@ڤ21 Ln!@X @pn*02&60 ` p`8<DL -0LMR@0 0 40 p R d:#:SP,K0D,<(< <00f010 pPfP,`,0`V,`  f @$ET @`,` 00PVP" '~f1 S01l7@rfPp,`,0`V,`  vf @$ET `,p 7 F RǟW0 0d aQ0  0 6 Hf01 @0D0 6 R6 RvP 0<& 0Q@0 X600HP0@ 0 8FS46  0 4 0bQ@QcՍP`400a0 5"& ,6 080 D 0 f0S 0#P` `V,`  0#Y`V,`   0#Y V<  0#YZ VD0SK 0SPC 4R4 9 ,0Sd00 AS 0 S0 0 4 P 00< Rh4   < 0#% R5052"0<0 B20 5#0@,0 e1SJ 0J#600S00  0BB#60080Z@l @qe1S 01,  00C 04#@ beP&,` 0;#;S`,` <0S<  R00,` R00,``,` ,`Vm " Ne @$ET80Z,`V^ 0;#;SW<Q <  R00,` R00,``,` ,`B P0 S%*0S P40040  0 S*0SU@  @ 04 Q @ 4 D0P P0  0P00 0 S D0P Q0 P00P0040l4 0<  4 ^ l4  0S@ 0P00Pt  gk  {b  gBDt|pP8<H p-LM0<P0C*"*2pB!0`36h1 Rb \] 0\& t!0d1 R1 0R p R 0S 00K  1@ T@0 0  ;d@01 R @T Yg R \ 0S * R 0S  0S: PpgDpXL8<Dt -``LMPp !0@ `0`VQ0@JDX a0P00SC/f`VX@E_Z 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/f0!g -LM:L@0cP0S @0cP0SP+aC -PLM\\`p@P0SpC/0p_fPUX`EOZ_0  (пg -L0M0 @00 R/d(4@L\hx0 (0 $ (K, K00KKdp, L0 0KfPd 0 K0 (0 $ (K, K00K&dp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z 0-LtPM@KT 0K 0 %  @@ep 0 S 00 0@0@  p-0LTMP`XK <@KhK0 0h0 \0XK< Kb"@0 dK`0 \0 d0 dfyT  M-L@M@ 0p`HP{ 0 p`d>PPk 0`0`KX0-0S   0G R 4 40  1@ 0 (@\`$@TpPa`8@ X0pX L H T` Pp kFXKEP* <0 0PS` 00E0 @d@ 安 PG 0d KR@@ 0000UX 0 D0D#\ ,0$@(\ 0000@~fd M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0jXP0S0S 3`0K KP L 4 32a/@#b! XgP pj `@,,P}X 4$ p-L$M00 `P80 40 00 ,0 (0 $0 0 8@K2PP T P@ 0S4p -LpHMP`Dp @p  PPlgg -pP@L`r/0W@e T@@)0@"p0V`@ h0 2 `@\0@#$0$ ("("4 400g@IPlg -(!XL"x H` P S hSU H -LcS!!Q#7011A!1 ȠQS0!90KS0A0 !0xp00 cd1(0000 c( +S0! (a c0#7%c!c1c X@0ES08 #HT 0 @00, 0  S0 900T| ?A7c%c!c1cW XEنD!6!4!8!!\H!^@! -@pL 0R 0SZ`0 P@0E.>? B7c011N0 d 0!T 0 L0L " H!\/u@!4!:!!6!^! !UT0p0tP 0-0PLr/8U4@0, ,UB@0S0PlgghgH -0PL4r/U0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S LPp 0@W0 0 R@ 0TP 0PPlg -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $,uu P L -AMLM,$p(. , "h  V, 4  P 0 ,0S ,JP`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S ` -LMH L p r/0, TH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢  0 )TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 xPK00D"?WPOK?K@DH2L42  p70 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑx -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑx -OMLM@ 0r/ , hP05 - 0`PUT U U U 0R)l= K AAT !p: To!4oS- I>K0C 0C000S000@S0005\ =000@Q JY/0`00n0`A ` 7P@ h lxPpd  T7P< (K OKAPPI $< @REnK`F`F J4@@ ;P@(K R  )P&+(K0 S S %R0P S S \ \ \00\``V`@,L78 P`e $ (P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS|zH (PW$*(PK0 S SQ\k0P S S \ \ \00\@@TY`, 6 6P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  =(Px((@K0 S SrUUo 0 P S S \ \ PP P 0X r0 0  R  0SMKL LL@K '50  vNN.K B0 B0C P0S  R4EsI4 R2% % P l[IT ,tN 'P&(@K0 S S U UP 1115  \ \ \ \ 0 SSz ;S`w 0 SP 5P ;Q Qq 6  0P NKJ J  GPE %4!@% h1 5P`3  Q;Q Qq00  RP 00  !PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώlO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  BPx &Pd#(K0 S SLY?P  E " I8`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D 5PPV:00gP0:0 000,0 S @,4HPP $ENK@D@D,P.4P ,`4fHP= `p,4`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0S-&1S Plgghg||"@t -0LMP0r/L0pSD Y@ S S@0TP S S  %P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S %P  %P0:0t %P0; X %P0; < %P01Plg8WX<4<("4 <1QS0 W 0-L@PP@OT0K 0-LM@ P K 0K  P @@"Jp0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S ++++,^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP P-L \hB~/00h -LMP@`T,`K,pK 2P 010jP VX`@TX ,K E0V0.T00S` X  -"L$M0Z @ " P0` 00PUoS <0PUoK  0p  0S 0aPo 0  p`P v  0hgB0-@_0 0-\ @0S  S0S\ -L M, ,P0 `@ t00  R-T@ +T@VV0Tg V0T ``YqqBBYp XfphX t0 0Q0@Dt0 0Q2 t0 0Q7 DW D@T%^Y \ 00T00S  d "00@\00T00SL, z00S ^,00E 0XSxS@`P p-LM`K$P PP@ 0S 0S @TxU pF00,P 0Pp -LDM@@KD`KH @  0P < 0 8 4 , CP PpL T DPP P0 CPD@0U*0S 0 @T:L 0 0S 1gAL  Pp  DD\p 0pU 0` \`T0 @*0S 0 @T:\ `FV0#0%H0% %:H00\0 S2 S00T0  `T  0T0  \`[? `00p ` T ` M?T0S00pp0pP` p D ?? D `DpT R 0ST0S 0 P 00   X  `62` V`06` V  D `0S0V V p QX DXp > pVp p 0SV X DH@@=0 S S#00T0  T0 S000T TL000pDL0 T R 0S7T0S   X p`6 ` V`6 ` V0S V PX0 0S V X : p-LMP7.@P`0  j>0p -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``x@d@p$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' bp"00@40S\00pgS \,00E0XSxS@`P --LM 0 0 -- L 0 -MLM@P, `T< p 4Q& #$0K$K0 S2|4 ,0S t,NX 0H$@W KHH 0($B$4PP4 `W \ Q\ #0S0 0 #dBP PJ `0S ZJZ:00 00J žKIIR PK %R| T @D R@T<@  0P PJ >K 0CPcT RL K0 A ,P@)t W~ { 0  3P`K> @)>K 0C1Kc@@2AlA H D< L @L 6Qa07S K A 0P@N07S  0\KclA18 A 4< 0 < v6mQ T00%Q00S  `@Dvr `W!X< APPD@`PeX } 0 C 0 AP PJ `81 K@@ 0| P PJ ` 1 K@@#@ В,4X`K  , -LM0@s yP0000 -LtMp0|@ $0 " 0jP`KS  $0S $sAth KPK叀K*) DpPEPP0fp J| Td -PLM@R  ?  000 -LM@P 0 0 0P0 -LMI5 -LMp@`P0T@$K P,0 P00g Z@ؑ -L\M `\, l Pt 0%S U 000S,0 S ,c@zT0XUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU8XUUUUUUUUUUUUUUUUUUUUU`XXXX4VXZXYUUU8YU4VUUDYLYXY`YZYYYYUUUUUU0Z\LZZZUZ\U\] ]$]4]U<]U\]d]]]]]]4^P^`FmƟtl 0RPgl0S\&1|T l0 S010l$ 0  tl 0l 0l5 Ϡl0BP lll@ N 0C`l R 0L0b0 B`l $ l0 0l(Pl 0S 4 l0S䟕1`|t 0lt 0PR l l Xl (t0Ϡp0 x 09x3a#`!1!1"I2Gq#1/2b11Q3b11Qdßp嬣` !,0/C!b ?@1c!bb1cA 0c0cs0 0^I^"XpGx3l#a1!1!2I"G 22`11R3`11R[[0a Ba4P P 0VS$ gS  _t 00  0 l0 S5l0S p4Ÿl  P1l l0cl1 l l0 S|ըŤldK8@KdKt !0 >hl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1A `pH_l$h*t$I|Qnm`K3( -LMTp,@KP` 0  W>  0S  Q *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Q0 S0 R -LMP LL1R00 mm@ `  0@T1@0pT mmP ` 0@11 T!@ 0T p`P%P_00 0@T0@Tlpk0@Ps(0SHp0T%P00!L (h -#ML M$0PP,0 ` P 0:S /S .V%P PU  0:S0/S TtW 6(@3(@@ T*BNK@D@D+B% +-+)..%PP EP/p@ #\K(PE PE#8ELP741 0-$0)(0% 2R,p\ \^3^P2P ZZ0Y0 YQ001001 0 e b 0RQ @Xp@X L0 0 QsX Xp@pL0SP7d0T7 @S^ XX 0X0 1QuM@p0Xp@ X ZX 0SX7. X X  Y\ 0S\70X 00CX 1 RXl0 ,0S t, XPU/?$P8P0 $!rLtv0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDMP\ ` /\0<S \0@0cd0 0S TKP@ IP00 `R <R `@ ~`@a0S,S ;S XKP@s 0V0R00S D ;Q,Qh Qd@Q` 0011P'RL7`c \\%0011P'R\\ds01u.00\'RT0 0f  P'L7R`c\T0X d0c bL7`'0 Td7 PhY 00 0 0 SmM @ \="d Y0@ `2"@<KnP@ 0,SPKeP@ ^d TX0]~h al0 0`p LP7`Tdh 0< KhX0@hP KT0@000@000 L1`"`!!X1X1 !h0 "b"b3h0 0XTڄT0>CX0 &@>`@ 0@>S``@ T00c  L7PTdg\ >0@>S\ @ bd  s$<0\@ R !`0@d T0 Q -@LM$0S h -@ 0LS0 00PhD`! -@LM9h9L` 0-L4P@8 P0Sh!P. 1$PP!\ 0m ,TǃPǃLǃ 6!0hP 0:S H HP 0 ,!00hD`D_! -@LM9h|9L` -LM`\p  0P"P7 S@ u RA @0S@AL0 Kp ] P` T70m= 01(0 R0P R0  A! p-0``0^80 ``V0u 8 ^N 0 0R 0 0R80L080 A 0V?HE.²QScQ$Ių -Lhv -L,M@<Kk0 Q 0 Q  -@p0T`LP40c0h4 -@p0T`LP30c0h3 0R 0R 0R 0R 0R 0c -LtM0 00TK0SPPK?L@K< PhHK Pb@P儀KDK P PY}PTH^DńPڜ4^$ڔ4\  “Ϡ2l1Q`3l1R1R`@4!bH XP/H4^DńPDP$O2d1ap3d1U1UpW 00# 0A0d^ \D H0 0D0 )PH d!PT0;Q@0 v>8# 0ST Ŝ ŏP@@TPZ@ကK?0/0S0 P S@ ňK   P0SÈ0S S UP@P0CS0 @0S0 PʷTKP4\>`0 S; (("(Y 0@S1P1P}R pRJ0 S @TpG4UZ 0`S1PQPJP7  S K`VPE4UZLǕ0 00n0  0STK P` 40R00 ? \0#S gK    P00:TKwPT;0 T0 f QuPLDP0\  “2a1H`3a1R1R@0!^H PPKTK< YP 'lnQtt!h@ -LMp@P`\ 0 ~ -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 P1!88 8( 80QBKL !80Q8(0@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <8.K B8(  0 P1H P'R <(@8 R<( @8XH8( 0>K0C!88!aPǖ\04(D8@X PLLGdUPP P`,8SL'L 0 `bS00 0tth@! 0-4PL@4  Z@40L`tt0 0 Lv 0 0Fv@0  R J1u  0Q R@Z! -LM@K$0c -L M@K$0@K 0 `RA 0 `RS  0 `RS AR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `0hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh0` 0 Q 2RhF0P13P1 <2 -(0(   1P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0   -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP -P`LV@cp0S  SP@D RCA 0\R#R! B -L M@KZPT `0 -L"ɠ2l3c13@"c1MP 1K0   C -L^M⸠p`OKPC/MK@( h < 8 c&Vat0V$KOK`?cKpG 0@FfKq q A A 1 (0S (  -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @ $"(0K!48<#8 S*S 0H T H0L P J I@  Lh@hA Hp\ G0p4Slgp PBNK@D@DhL!L1#}p@) #pPu0#SEKEKALK 0 LAIP4 \ X T #X4P$0P 2hP22p$RhPV0 4,n@P  ` -LM` @0 0\ `0V -pp`@LTP S P `@T` 0V0000h鯸,n -LM$@0 S h0` -LMPp`P@b ,K0,px!0 #p  P @\T`E,0S HHH,,HHHHHHHHHH( 0"00,(0 $" "p P@T` (pP0P (0L 0 "(0 ,`K<P{\I -Lh\P0 -L  hB{ -LM`TPpP 0 S S 0d t" 0 0 @0$ c"@5d -LhP0  --LM ? -LM@$  0$0KQ \  0  K 1S01 -@LM u` 0-LBP|@ 0S L| 0SPeT 0S \00LS `000 0 -LDM@ d ,P d'P`} 0Sh 0S0J0@ @@`K VLpP dP00 H XP L T@ fXKP0SV1X. 0P0P0H0STTA 0@81H  FP $P0@ 00r00p0d  N X%4 40  `0X@\ 00r00 00(@, 00r00d -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00h[  % 0-LP@P0  P 0S S-P 0h'0 0-L@PP 0S S 00h0S 0h 0-LM@P0S0P  \0C 0 0-0 0 0LS@P 00S 0S 0S  0S 0hPT0\dlt000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ $@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 "<4(<"4!<0  -LM0@SK C < 4  j 0 0 p-LPd p`0@,$,!$#,B V 0? !<4<("4!<0cS @` V @ P,$,< $,4.l$<("4%<A0 V 0? !@<4<("4!< 0cS @` V<4, <$!4 , P 1!0 1!( 0P1D!D, W00  ,0i -L`p@ۤPP  m d P -0LM@ ,0( P00 0-@LPP P \ 031 1! \!00`0@'`0@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < b X0` 0n0C 00,`0 0X00 00C8#Ƞ ?Pp@00 0E8X#X4  R 0("X0e8#h 8! 0`0l0C0 , ` 8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h<  `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 UU800C800 R -LMP`  a("H T p 0 ʲ0S T0 fP  `ZQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S  1 0%]0 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 B  \0 0  pP!ᚠP Y 0(10S$1 0 ! 0S 0P  0P$1 0$1고 0-LMP @p 1 00 -L M`@ A nQP, p'P"MP 0 P 0, S 0   ]\0 0 e0 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 30 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<P PP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 D P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0< P 00 `1 P@ ˞PP  ÞP@  1S0C100! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0孞AT _ 壞0 P @-0@0 @0!00  RCA 0\R! BQ'  0R!5p5d5X5L5@545(5 2 2 2 2 2 2 2 2Q 0S !0S: 0-LMPK 00%0 @( 0ST 0S @S 0ST 0S [   Zo00 0o10*2 c 0-P@TUL P :᳝P@  0Y 0 0 p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000vP P*0P` 0PU:XP 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^%P], P 0 0e 0  y000P E  bP0g0,0 X 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 00000Πg p-L M0K K@C 00p!`8PUhC 0 SP P000pkP` 0 0 pп p-LtM@PP`K'P0@: S  Q  SL  p( 40R p; 0p0+ 0 pB -LM, PPpF0S@a@T 0 0S00 p@ 0S 0000 0E#10 0@S000,!0 0 Pp0S P 0o -L M`CPP쀟0S6p@T 0S @S 0ST  P ` 0So`0 .p@ 0E#1, 0@S0o 0-LTPM@KT 0K  0  @@Wpa -LM`@ 0pP`O -LM@{PP/0:0 p-LMP `@0 : 0ph* -LM@pP  0:0q0:0 -LMp` \0 P@ P@ 0-L0MpP0 @0 0SDK@ 0S ,00@@v \ t,@ P-L 0 hV 00h*C p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`R @0S R@- Mp-LM0`0 @`Ip Mp-LM0`0 @`6pP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10b -LMK -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*U00 0P0XR00S @ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@hS -LM@\Pp` h^\QU0SD R 0S=W00  00CSpSHSpSpS|SSSSSSSSSSSSSSS0 0R00 1 0 0 ;00 0 0 R 0;S< W  4 R 00R 0, X@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a d0K?aK@D 0KQ |A Q A v1` 0S  刚 p-R0 0c BSR48 R p-@P`x BRpR0 BRRR2**x *J** -p@L00l8#hP P08#x `0 0c8#hC08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o% -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , Q@0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# avL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0rPX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0 P@  0Y008 8(40Pou P0 00S"P@ 0S 0 00S 0rP  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \MO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0PQp  P MO0 0D@0@0< J PpBJ@ 4@00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` !0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 ; L001 2 Ld@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S| -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h}` -LAMp0P 0 LANK0AnK @D `FS@D `F) \0 0 AK A0A $4  0s1 {P U  0 pS $ 7 !X -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 400 0c8#Ƞ 0 )밀,000 0Pc PEP00@ -LM1@QPap r0 Rp8! ,5P8q8嗏pR0-P@ 0bR03 B0 -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6ztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shsleepmvexprdmesghostnamett q t8@@tXtttЉ  @@tcbsconvfilesibsifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zeroseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%u+%u records in %u+%u records out blockblocks%u odd length swab %s %u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputxxxuxxxxxxxxxuserquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-i is incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rwt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95gemdirexecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfruvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleasexxxuxxxxxxxxxmount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track 4< DH~PX\ dl t|  .|:ĕ̕ԕ ܕ #3#32 33#$@,@p6@4@<DLT`hpx Ȗ Ж@ؖ@8 (08@HPX`l t LȗЗؗ $,@4@@@H@T \ h t @@ȘИ ؘ C$CC$C(08@HPX`h p x@@șЙdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.13 2005/12/02 20:36:56 cloder Exp $Ffhnslinkit%s/%susage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.97 2005/11/13 20:27:10 deraadt Exp $xHLTPX\4`8dhd\{sƑOJNqեvuNuޕڵs!0 '+5/&f%kt9<^|⫓Z2}@mrXN㣈Odv2/fP@WmUvhQ*; k~}xrBT?"R=PYvh{]25xp꺂] ot+iֹecolaZ.^Ҽu[(821 5nx'G b ;WΕͫ۝<ᔑ&b競ЫVjaVk܇v \btKHwgl;] = 늾dX`J g x9y׷^mIzUyϖu i Xb1 ~صh:#(_pm%"" JY'-%kl j7^#Ai$;3lhPJO+Z8#z,G4_6xA%Q3 "5-<Ӓ,U绶ɜ[[N*i%0nzcA1:X._-^]_|2cD[y@bA!d@ui@^ lS&]j4p a LFsCW$l)LyaRw :xw6͝frz'3'eF8̏y4t?W F<<4 [._Gv"nc@ZпYiD0kDN ԠԀMH>[U/f& -`+n"Wᆱ ¼JL PB]b{{n5vF Dcrtj^5̟n8:+xhТ1mUY= &u 6naomo$AG̋ž6M{vav%lz.d0K8oab Gh@=S x(A$qt8,27~UZf&+CC_6WE!QPt!V'>G9 (Bc Ni՝ X S, f{Bb9  F4:B7p f#+P~e8+R,֍"8 I8̓(^!DsІ4tO !LF [6R0&[(+"$Di|p)B,O?orzoC;%%&xT cB5|̹;g H:{;z>yv-^rGT3&;]F))x]Pah5A%h$Y{żՋu(_;A~ahɴ؊ √駸i8K#B6rQ(:D $y^ m 4S#VRׂ2MSM65$˰8_ƴ N]~`gkBW$V$#h=kQLj٩ \Ȉzrdfv) 'b~|L0CRhs"k[РQ0IWk!ނ6&7\ S&D 8z42vyq\&!(3'R@ 6"qJ8)МG 6}+ demːy6k!K/h)elɉ >Usbq]`xpu젃K.csf +}u )R."p4#w("F R>P veyĻޚWej\}WACIK Ee@if1k@"8p@BL/-sl!oHo&ՁD(~#!|`O39 JȂz(BB+Q;si_4o$ X)+L`@Z8F~|uS@IwHWN*'…+ix%^Zu0"bh;K[Nۑ/*^]$a$)! bVc)cC_[@Dwf=um[p-n(ڭMKe,>V-SJidO˴|3j hg0ǘ(DPS`M-58cʢ7RcwMod Q1Z\{+zP-4}%,^/YȌ6Wi#FT0$"Pj5;LtMpeϙΜ-o6G:ꄱs~hs5SDmęH*ѭ%h_ ^VA]{ac47(ń+-9%E)m"ğO-n%IKFPQy ^}e۾*Eag69!W}̑6:ήIQ#A0|nN%M`U}Fﱞ*54=/DS- %%8 qMu8E)H$ہ9|T3'֍cvWcPuAn'#B lݴc]X9Hq~9:/L_[̻ڋ?֊m̻IR1+ vJ׭*g)riMĞ vlVMْ=Xe @\c|5f/hp EP8N,w>!ˁF;_k¼f}w>0}&"ı6LLȷr'aiMaw {LA-Րz"$55_cSOq8L9YtӸŵ=siLR*UNNNj&+SKQJ[ D1$Rs.^%5XC\j;{{6V9 ` H(JSy+nXݮT4]({g⢊#o95ۙPD:NΘϴt&l: ;S w &DPrS~Z ơEF7/Y=;>rq eQ-n &\v{]\Ro5r -XRr[h)T?tLA rST6 !v 5rrC՚&W'{il"ȅ-i߈(gD РjHO(6HFocHj^ZI9 $9ɊLG- _@6X)ҝ"c{PxmH?:Cevص9/' P|R|ԮJ)35GM!;3<Ħc7qBMC QەE~W'=ɹVqO"ky(}"2H/xT Tdȹ};T! b%:/بYlpuWtߙf3yz-=1ns8RL $s0o:ُz`-Ope_Ln|ʡkJګ8= :9Sp|J J3 `c֝W0rK1kS;kqA=EI4ݤI~}{]|}7AS=O|:VJc'O&4|3KqnK]}^Gw gf!諹 gO82zҊD 3x( ŧQhxC yB۠78*gٙwP2j}Yݱ1"O2|#6:IePʛB8YVZ6=v&NeD[Xs'Wn$N⮘>\y JЙ^&nK|9Y~)]`@y/5 = MeuL7ͭ<Ұ">4SG[^ψ:Ps{~ j&GAN 9-m/X}H&xE I͍3$=F֥,@RedvVe Sar۫o_:gscwרL.q7uXYh3'bi u6pKֲ ]BuJM_a@!4]ꡔZxmOwū!#Ed%ܖ"fp 48 W:/puijMP$$<]c Ќ >v׬Il)i=Rw,L"IR i-z]ZH^G7jՆM/Ei7ۑJϿH!tɽjɿv=%F`G)w\D3^4q{rI#M@pq0 4m6"6=BeiG8tZh@LgckLEޙ]J(\c.rEmZw9|/vyJc_4w-n,mv3VU猡 K=VkDp!ē=|"1ul\|QQ&HlgY$əM#7'_Ja\Cya??䏾< PbadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABEL/usr/mdec/unknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.writelabelErase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)can't read master boot recordwarning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFONONEbootstraps: xxboot = %s, bootxx = %s%sboot%s%s%sbootBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect ecc removable # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dboot overlaps used partition %cmarked as FS_BOOTwarning, boot overlaps partition %c, %scannot install boot programcmplabel [-b boot1] [-s boot2]usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.partition to deletePartition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk). Treating sectors %u-%u as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.29 2006/01/25 17:42:08 markus Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.26 2005/04/21 21:47:18 beck Exp $$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.63 2005/06/02 19:11:06 jaredy Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.23 2005/04/21 21:47:18 beck Exp $$OpenBSD: tar.c,v 1.40 2005/12/17 19:47:02 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdOnvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [pattern ...] pax -r [-0cDdikOnuvzYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T [from_date][,to_date]] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [-x format] [file ...] pax -r -w [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.73 2006/01/09 22:42:35 deraadt Exp $DI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfjLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [yn] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem checkSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d YggW|g W|g,Wg0Wg8Wg@WgifHWfPWfXWl`WmhWepW,kxWk|WtrW0sW0sWtWtWvWvWvWvWwWeWf hWhWhXhXhXh$Xh,Xj4X4c %d:powersave on (%dms sleep) (auto) %ddBm %sieee80211_statusSIOCG80211ALLNODES none restoreieee80211_listnodeslladdr %s %udB powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA1DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbackloopEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%s: bad valueprefix %s: %s%s=%o%s=%xusage: ifconfig [interface] [address_family] [address [dest_address]] [[-]alias] [[-]arp] [broadcast addr] [[-]debug] [delete] [up] [down] [ipdst addr] [tunnel src_address dest_address] [deletetunnel] [description value] [-description] [[-]group group-name] [[-]link0] [[-]link1] [[-]link2] [lladdr etheraddr] [media type] [[-]mediaopt opts] [mode mode] [instance minst] [mtu value] [metric nhops] [netmask mask] [prefixlen n] [nwid id] [nwkey key] [nwkey persist[:key]] [-nwkey] [bssid bssid] [-bssid] [chan n] [-chan] [txpower dBm] [-txpower] [[-]powersave] [powersavesleep duration] [[-]anycast] [eui64] [pltime n] [vltime n] [[-]tentative] [vlan vlan_tag vlandev parent_iface] [-vlandev] [vhid n] [trunkproto proto] [[-]trunkport child-iface] [advbase n] [advskew n] [maxupd n] [pass passphrase] [state init | backup | master] [syncdev iface] [-syncdev] [syncpeer peer_address] [-syncpeer] [phase n] [range netrange] [timeslot timeslot_range] [802.2] [802.2tr] [802.3] [snap] [EtherII] [pppoeac access-concentrator] [-pppoeac] [pppoesvc service] [-pppoesvc] ifconfig [-AaCMm] [interface] [address_family] ifconfig interface create ifconfig interface destroy getifgroupsSIOCGIFGROUP groups: malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%qu%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDFfailed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDfFm1memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a usage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagcan't allocate enough memorysetsockopt(IPV6_RTHDR)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host kernvmhwmachdepddbvfsbooted_devicebooted_kernelconsole_deviceallowapertureapmwarnkbdresetztsrawmodemaxspeedlidsuspendioctl SMODEmmapsysctl/dev/ttyC0open /dev/ttyC0/dev/wsmouse%s.%s=%d,%d,%d,%d open /dev/wsmouseusage: %s ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offxxxuxxxxxxxx4}x~ @~~ ě@̛DPdpbgdumbtimernfsv3rdirplusmntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value -- %sillegal -R value -- %sillegal -a value -- %sconflicting version optionsillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[s8~eWjbO6p;x7NĞݳ5!8H.Aq~&9ڗU"@ї|u}}>*}{{%nuFr7U2~o|>]x7;?[yȋb/֞~ıyE(2RqZTy =8n>{~wIvJy|zXx{^x‹^𢅧^ ߓo&nkCkv-icU檃+  8w@4h$rD3RpGl۷=+.eXBioio^0#ڦGFxee)TBFF7$ ĪȶqKa+)(* =,'l1q*G-nng0XG⻬JwX;[?: TZAkI.F[8-Q~+9= 1x V1#W^_SFN닠8,:XUĊ)+\ӵ kupNG<XNZiU 76^z$VY_||{!Uv&t.∾\&#;~4= cɇ`c߀~R0iu:2, '3< !q0u9~;W-rt9Rԉe9pti2B&lRX cp4&㛷G0q.s-ܭ9simU& CPz(W-J\J*}n~j'ٴWϴfo.,_= , /&c e,{S&7hU`F,'IQ3sL*NLܠv]ׂD[? Sa \(:ғ¦HC(SN% v6~!مRtQZE t}࿷6OזLNe_N&(œErxK #d[2;7;paɆCx[z'k;%q dLO »[xٙ: X"DoLP3lͿ@릗nţL*XS$"U0pd-Q/-xSV a7ì(ybV=3P,"KiTP;*I,%״Q%wlV@URsQ,ik%%vzh}\*JC)YaKq1KXs]?N4tp 2l]LW8:-B[hxw{umoD ջp}wqzq`xl2tTHЧH }ke!C29.Z sQ7ih^Sog>-9ﮩd/%σzNչQ(M+qXd&6UJ w0;L$KI{Mx^j󱀒a]fmOyցJxl2ja%!'C2Js0h8ǒ ?$klbxCN=\~,=Й^h0Ce-$h`}Yu$hEg)g]މ@uYSVi0yp8Mټo6?BZ"zgiPXΆ(1<} A/^--ae877!V^c١ה_0PKt&Doyz tpǖMfÙ?$c :ڞZ>La`6-2$>jXi(@!_sἁ!ũ@d@g2R9`ȭ8P3;zfxBᾩ8-.|iʆ_|[7ߨoL|0FEgf+q Ӫnv5,o+g2/?lZwi[dʲ ;THo>+ 8`Ume (oqr)ee'.X>iʊ57?Զ& l)v/tP$`$ijؙ KV~JRkiU$NUrl ~ZiK]n3 lf4 "sUlRSS+ydž IA%C[Bx,Ȣ~!Rl,| ADf\]3-&N36[[;&$+qJ F0 .#[>-[nA(U*Xo".͞jwxOܥJݾL] ikOH:&Ȅº{⊞ۍ:褻u3`[ڱY*L6P42N{?jK,‚=(mz#^k (աש6j\ coU+Gt!b챀wNxڨ)7goloߑ\8AD{"=d~Bj6 Ѵ`W`ZU %"ua9b\ v bDwNB- jq :꒵1vOw.ÐWFִu\z7 ~. +9n`Y$MCK2 頝ZTd&f5$πHݚ4!Y*C:R*ݴO̖sog]oL[9bsj:uRqu HڅV}Tn aUP 5 ]t uVaVUI{64֜ABT|WE&͔ $a KjXF0kGFZ&3 qvS٬֧Xёب$g}Lb oV߰*͔sLgmz',#G%;sϩy쩒Zgtk#MjFGPA;%hk$~ţ,FwMōc ^ͫJm@;R %ՋnmcfB3.KPN/w'Q%{݁ +9-~{6c5o\C#V }J>&$Zo1.e|:x^pzړ5ĂTA(ZnԒ$Ȩ{ﯽG!Mm[zs#{UJdy8927O6PMa3ļTww _ZRBh;9Fp@3m4ٝnNG+wl6`]{H8— `WՕ`~0䮙YɼH0j3'q!}L$sL $ ⇟ً,usage: %s [-ieu] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. /usr/mdec/mbrieuf:c:h:s:Cylinder argument out of range [1..262144].Head argument out of range [1..256].Sector argument out of range [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Aborting changes to current MBR.USER_modifyWriting current MBR to disk.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDIOCGDINFODISK_getlabelmetricsBIOS fixup botch (secs (%d) > size (%d))Disk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what paritition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinaryversionbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]%lldaFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]xxxuxxxxxxxxxGsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir $OpenBSD: fsck.c,v 1.23 2005/11/21 14:27:55 millert Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p UGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstexpiregatewaygenmaskhopcountifaifpipxjumbolinkllinfolockrestmpathnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtv/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longRouting tablessysctl of routing tableGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-*.*s Address%-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: AppleTalkIPXInternet6Encapp_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%d KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpGET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s Writing HTTP requestreceived '%s' 301302Too many redirections requested200Error retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46AadEegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s): Name (%s:%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] xxxuxxxxxxxx}@rx4}|reloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node - D@p     0  D  P  `  l  |   p  p p @ p p !!,!0!H!8X!Dp!!!!!@!!!"@",!,"D"DX"p"8"D""p" " "$b" # #80#p@# P# d#@|#D#8#8#@###p$$D,$D@$pX$$bp$$b|$$b$p$ $p$p$ $ $ $ % % $% 0% D% l%px%$b%$b%$b%$b%$b%$b%$b% %$b%$b%$b&$b &$b&$b$&$b0&$b<&$bH&$bT&$b`&$bl&$bx&$b&$b&$b&$b&$b&$b&$b&$b&$b&$b&$b&$b'$b'$b '$b,'$b8'$bD'$bP'$b\'$bh'$bt'$b'$b'$b'$b'$b'$b'$b'$b'$b'$b'$b'$b($b($b($b(($b4($b@($bL($bX($bd($bp($b|($b($b($b($b($b($b($b($b($b($b($b)$b )$b)$b$)$b0)$b<)$bH)$bT)$b`)$bl)$bx)$b)$b)$b)$b)$b)$b)$b)$b)$b)$b)$b)$b*$b*$b *$b,*$b8*$bD*$bP*$b\*$bh*$bt*$b*$b*$b*$b*$b*$b*$b*$b*$b*$b*$b*$b+$b+$b+$b(+$b4+$b@+$bL+$bX+$bd+$bp+$b|+$b+$b+$b+$b+$b+$b+$b+$b+$b+$b+$b,$b ,$b,$b$,$b0,$b<,$bH,$bT,$b`,$bl,$bx,$b,$b,$b,$b,$b,$b,$b,$b,$b,$b,$b,$b-$b-$b -$b,-$b8-$bD-$bP-$b\-$bh-$bt-$b-$b-$b-$b-$b-$b-$b-lxmediumreason/etc/dhclient.confFAILalias_routehandlerc:dl:quifi callocifi->client callocifi->client->config callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link ... giving up got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"no such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")can't drop privileges: %musage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK from %sDHCPNAK with no active lease. Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.can't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll errorCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %sCan't create socketinterface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.do_packeteof in string constantstring constant larger than internal buffernumeric token larger than internal bufferlways-reply-rfc1048llowbandoneduthoritativeackoff-cutoffootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefaultynamic-bootp-lease-cutoff-lease-lengththernetxpireixed-addressddiet-lease-hostnamesardwarenitial-intervalnterfaceax-lease-timeediameserveretmaskext-serverne-lease-per-clientrependequestequireetryenewebindeboottartsubnethared-networkerver-nameerver-identifierelect-timeoutcriptupersedeimestampoken-ring-host-decl-names-lease-addr-for-default-routenknown-clientsendor-classexiting. %s line %d: %s%s^subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (connection closed)buf_read (short read): %mbuf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input file%lu newline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory (D0D4DDahic `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@,H~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddir blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listCG %d: BAD MAGIC NUMBER dfpnNyYb:c:l:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodeconvert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKcannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKreturning to single-user after filesystem check catchquitcatchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/pax%s: mount (update, rdonly)unmount %scopy %s to %s failedrmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d) File system performance may be impaired. and ntrakrotational layout tables with nsect%s %s %d %s %d.%sWarning: insufficient space in super block for Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.21 2005/04/11 07:11:44 deraadt Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $sed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $\%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be empty% P P L| T l 04 č\- ̍/ ԍ, | H ؍T T d+ 0 8. 8. ,6 \u(̏< Џ7 ԏS ؏G R G $D P E 7 E $xH ,7 4PK <D D0> L> TS \7 db l8 t|I dsQ -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$,8p<tPf`ctdslmn(p d  p 0 Ȓ Ԓh p І ̓ , 8 @, ԙP l Pd E `$ p x 0   0 H ` ̓( ؓ   x  $ 4 D Lt \ p x l 8  ̔ ܔ    8   ,Х < H X h t8 |hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDHĘ ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }ԠĘl@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $aȣԣcܣ0ei`2kl X@em,C|n8f@HbPuXdlpȗrx44sxh vdxlettpx  $ a  .{}pħD ||&&!()|]]<>tn t!L    ȪЪت@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. no errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: rcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s LhxResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_af%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%uX  (,4Ј<@HPX`hlt|Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2x\ht|Ľ̽ؽnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,L ""too small%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.db__ttyname_r_basic/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*netgroup: %m(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: db getnetgroup: Syntax error `%s'netgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problem ,<HT`x 8Pdx ,<HT`x 8PdxHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3dsscanfb0b1ncdtscilcshssbpxbxfxoxtxdxsimulatedgetenttc%s.dbcgetnext|:execlexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Pad__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~4_X$48LPX\ pt    x 4<PT`hx8]2P 04 X`!"d4<e\`fx|#INCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/syslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log $(,048<@DHLPXdl0t| $0@DHJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0GMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZvsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding 0Tp8Tt8Tl; errno = %s ; s1 = %u, s2 = %u ; why = (unknown authentication error - %d) ; low version = %u, high version = %u RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATH  0 H ` t   $       @ P ` t        ( <8 \ p      $ D \ t      0 @ X |      0Th|$<`t$<PlUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequence ,<HT`x 8Pdxxdr_bytes: out of memory xdr_string: out of memory %$sniglet^&isatty ((((( AAAAAABBBBBB arc4_stirsnprintfHASH: Out of overflow pages. Increase page size %s/_hash.XXXXXXopen_temp Dlrp|rr@rr r(rtrrrTrTrTx\rLrMrVLrr\s1 s=s=s2(sLC0so8so@soHsPsȣ\s̫ds,pt8 lsts|ssdXs5sDGsDGsDGs(s(s(sL\= sX s s0 s0 s< H s x s s t th t t ,r$OpenBSD: args.c,v 1.15 2005/04/08 01:46:45 jsg Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $unblock and -DNO_CONV?@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: misc.c,v 1.14 2005/05/27 04:14:24 millert Exp $$OpenBSD: position.c,v 1.7 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.17 2005/04/08 20:09:36 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.43 2005/02/20 01:34:56 pedro Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.40 2005/05/26 20:16:21 fgsch Exp $@|} } D4| DL| D\| Dp| D! D||| D|||||| | D|u@| D|r|| D D}}@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ext2fs.c,v 1.13 2005/04/08 20:09:36 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.6 2005/02/02 19:23:17 jolan Exp $@@@h pp p ` @  $1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $8Ԕܔ@@lĔ<p< < (084<0DL<$OpenBSD: modes.c,v 1.9 2004/09/16 09:55:09 deraadt Exp $$OpenBSD: print.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $ $,48<DLT\ht|(Zĸȸ,|4Dиظ D D D D D D D(| D Dx DԷ D D,| D Dܷ/tmp/EdDk.aXXXXXXXXXX%$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: editor.c,v 1.101 2005/12/05 21:30:40 miod Exp $ $,48<DLT\ht|(Zĸȸ,|4Dиظ D D D D D D D(| D Dx DԷ D D,| D Dܷ abcdfiklnoprstuvwxBDEGHLPTUXYZ0\P4`IrL\0(48`In\(4H`In(4H`Ir(@MMD ؅($0\ I8hr.? ɚ;h7 ...@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.14 2005/02/03 05:03:50 jaredy Exp $ $,48<DLT\ht|(Zĸȸ,|4Dиظ D D D D D D D(| D Dx DԷ D D,| D Dܷ@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.17 2005/04/05 01:18:53 jaredy Exp $axXd\d`dddhd4́܁T$OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.27 2005/11/30 00:57:25 deraadt Exp $P.$OpenBSD: print.c,v 1.24 2005/06/15 17:47:17 millert Exp $$OpenBSD: util.c,v 1.12 2005/03/24 22:53:15 jmc Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)ping.c 8.1 (Berkeley) 6/5/93.dAP`l|1|o~/>~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x@gg 0|8W (,8W0@PW`pxs"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)\\a(Tb(@ ԐB(<c(hd(ADܑe(,@f(4`xF(g(,0h(dHA$i(ԓ j(4DJ(!hlHL( m((ؔn("0p(HP(Pq(\r("Hĕ s(!LdS(!@u("\ЖV(w("8(\x((X(APԗy( z(L0H"(h~(!t?(#(X̘.(A0l (press RETURN)... (interrupt to abort)h381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUtlxanciPdf4LmTxDmxajT8eȸkL,l$l,\l`l(xĻ8@лtAB%C|vDEF G0U8Vxa@bqcLe3fTh`ilLlnqqrsvwxu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.19 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $}}@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $lxPW  p 0q  8tXXd,@exWhW ! "#$ %& '$(,)0*<+D,P-X. Dp4\|@` pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL$!x4_0@@TVD(* Dp1zP= x d"0 <l@@(T 5\<8 L -Il<7N I $490Mt< HzdJ "< ;4 `$H_Sh@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. ` <@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.26 2004/07/09 18:49:57 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.18 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $ /sbin/dhclient-script( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.16 2003/10/18 19:15:43 jmc Exp $B$OpenBSD: cbc.c,v 1.13 2004/05/08 07:05:19 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $4$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $4H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.30 2005/11/09 20:03:29 otto Exp $ D$OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $4F8F?@$[8\D\T]l^x^__`{{|}}~ t|? D $,48<DLT\ht|(Zĸȸ,|4Dиظ D D D D D D D(| D Dx DԷ D D,| D Dܷn  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789abcdef 0000000000000000} lBlABAddlBlABAe lBlABAf <`  XL0XLX<(`U4cܳ4$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$ttvp$r%ВВf+5y>yCy JyQyZu _fq44~m!a  ln}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X " X _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#A< r m & ! P K  _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID { v   P _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin"vm,%KB k f  u p / * Q L   _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & Q nobody*Unprivileged user/nonexistent/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  _rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) [[ $_f == xserv39.tgz ]] || continue ( cd /mnt/usr/X11R6/lib/modules ; rm -f *.[ao] */*.[ao] ) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp set -- $(disklabel $_drive 2>&1 | grep '^ c: ') case $4 in ISO9660) _fstype=cd9660 ;; UDF) _fstype=udf ;; *) get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype=$2 ;; esac mount -t $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs } install_disk() { local _drive _dev _fstype _fsopts ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _dev=/dev/$_drive$1 [[ -n $2 ]] && _fstype="-t $2" [[ $_fstype == $MDFSTYPE ]] && _fsopts=$MDFSOPTS if [[ -z $(mount | grep "^$_dev") ]]; then mount $_fstype -o ro,$_fsopts $_dev /mnt2 || return fi fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=39 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_dmesg "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_dmesg "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $0123456789abcdef ])Hn,(,t ,, ](`(|,0(T( ],\^(<(d( ((8( ]4l-hr-$q-z-{- ]:0',hr-$q-z-{-!,X,j, ]<, ]+\, ],h, ])(hr-z-{-) ](hr-z-{- ]g ,hr-z-{- ]4l-hr-z-{-$l-`4] ]X&@|++@2X Xd$`]]]]]]]]]]]]] ʚ;5ym8@ E82(@AAA==(A*T]X]\]h]d]]p]t]x]|]`]]]l]gQ ]] `4aH4 ah4$al4(ap4,at40ax44a|48a40$?0]0H]0]0 3000000܏000000`G5hG5pG5xG5G5G5G5G5G5G5G5G5G5G5G5G5G5G5G5G5H5H5H5 H5H5H5H5H5 H5$H5(H5,H50H54H5H5|0000d2d040 000++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyJ5000 000D0400P00000Boldface.iso1 h^wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp,^h^  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ްd:^d;^2e;^);^a;^!<^3<^<^<^<^=^=^$=^4=^  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~=^o>^ ?^?^$?^4?^  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     ?^a?@^HA^XA^D=^&D?^!hA^E^h4pK5tK5xK5|K5K5H<1<1\R5<Ԃ1111  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  S5T51l11i"(U5xV5*LZ5P]5# # _5 `5a50w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Hb5{{ c5(c5 222 2H2222 22H22c5e53H333`j5p 3 333j5 3 333j5d3333j53333 k53333(5(.P^`>4P^`>m9`>D`>9U`>KXb>h  X?d<  5P^P^  ̶5 H$h[$/E"8:/EfaR!]2$fH+3d 25d5<-d%n/8' Ъ!lp0)]5=+tB#,J,2L^j#lqt-4~& *]5@5-p1"P5##2d2(]:.$C $hR5h5w<$'\ XQ-l5#\0!2$L5HK2(&p\3%D(S18@,dHpJ#XX5_x/Twd#xfaM^T03T#30 /5-!|/ R"\P1L&&44+E<%)8Uv`eh"hp'  _1`ae3<% 5$$ -5 }1XQ3. `$1-)>(="lHU hX5a <s+Dd50<l!<!$01'-&_0I/--!32dB,NL"<VtO^_Ի5p2`}dG 8|3ľ5\l&`$\m`0\f` x`T%1x0y`!4y`'M#h-@58`$@0LG^a.Hoi"|d ȣ#<1Ȫ%h'-!T5Ȇ.-|5 "d\^ X%|2O307H-F(a'\L@!o=-\}X`m!'H.r'"8* ] $# X04  4 A 5(O x5_ 0m 8maz h%p `a ( - 5 a \* L'H M1 (3 . >/x: L(E 0R P5g $q $0{ `5 da  w$h 2 5x ,r` 4]  {` <(! !@ l2 ,e+% 8g3- ?`8 x"hA 0xP t5a H3m <*-{ n&x ص%D _ 7$ p&P k2 {` +` g" ) h"X pO3t' 4#p9 2D P U /Pe 85`n f# x 8>!t 8( l#p 23  .P 4#  v0T /t 'D "P T%" E^7 0(pA 1xN 0&$] Ԃ.q 5 J1p 30\ `x"T 4/ ,N. Ժ54 <1 ",P @%D$! '~`17#By/R.H]#d Q+<u/&/8.5-p)W1THz& "@#(F!D1d%$/Q3(8 +HL%WTA/_!k+||5$0*X/0f% ts`5l'D0#dД%lD&ld" h!8' 9~ `Ct|`O8O^Y XgH +wI1@'1`#H/`|3e`\36!$f/[- `a<$%0$<-1+60,Ef3pL#PZ|-`/nB0|I*&H"0@`tL^5X=1$(aL$/|-$h&d&32pEaNa^X-th|/u(/a1aLf1x5`&ht5u1 $s)`#)"\9T$Gp1Ot2H^01kDp1$̾5,2\2@1@'L0 l"\`|'|/P#9.D/*8P5E"$N1T] -Tk*{pk10t&$f"l%(5p"t3,08`a  M+df`T28+@ &T1+x&<5^a0>@`J5U}2\_5i-q0!x}a$".0@+m`H"N2$2\-4`/`@11]:p!IE^T N^]j"hT"q!}N#!ȕ50-#h`#]h'03,X-T]$(pQ" *1',?#S.Db "Pk h`({ (D1U!@)!|5l&C2" xB/dfa)"</x$8(HC," K-0YT!TfK1p0aī-xLa]#/_ 0(6%܏0+@\2l7ԣ% AА(8R x`G D5X @`$h (!s 5 - t)  {1P pQ. X& V.t V1L w` !D0%!%!]%!{!`0!#`9! C!-K!4|*[!dr)s!&!1!,`!43 !]!T]!*!L^!,2`!{`!3 "-#"! 2"H2dB"p5P" "P]"&xo"U1("8+l"'",m0"Xy+"(")!4"L;0T#$ #O^#5#S-<)#!9#@%D# X#2$e#?$o#5#a#02#&#T%L#2`#-#fa#@&,#]$ $03` $<]*$2<$0/8Q$.LY$ 5m$%($t/$[$$ "$"$\!$D+$3$d1",$(ma$*%5%1 &%-p7%)E%0W%@-o%p!%"8%+l%(&T%Y&%l`%F.%]%"\%I(p%T3 & /X&%H &. 2&o&\?&d!R&S0pf&*u&`J18&@j/<&Xa &$.H&45&n, &أ5&-&D+&&"L'! 'pc"%'"@/'.`@'5W'@]b'Ta+q'paxz'a'%`'.'.'fa'#h'5'5']'w` (8%( '(P*<(aN()Y(0i(Paq(Xy`y(8(!((5(3((=%(t)(x)2(](8$(5(!X)2@)/@#) E"8,)%?))DM)5b)4N^l)l!)])%)^"`)dm`)&)5)") )P- *ؼ1!*l]%(*d 0*X30G* $&| W*d} _*p+k*/ u*e%*D5*H/t*",*@!*#*2<*]*L**/$+(0+x]"+ 1+["\8+/dN+@Q$LU+ -`p+6/+/<+F^+5+-L*L-8u1H[-+i-'\|-W!->/0-(--5-t2`-l&-]-1---P3L-$ .TJ#.\3 +.d$3.(2A.>!xS.(2`.$5g.}*x. 2.1.E^. 5.)8.X) .L1`.(._3$.'.#/غ%L /$(P/̱%/h2,/$q-D:/3B/0 Z/<1li/$$p/ta{/$/0/`/E1/x|`/G5(/!p/05/"/| h/(-\0&0%#0x"020d5C0\+hS0|$c0\@+$r0а*|0/0!0$ 0#0450$30ܻ' 0t`0U2\0t(!01hr-P1r)!1],1N$4180(D1t0/Y1L&c1%Xm1dg"P{1hh!$1(1H10$151@r` 1l^#|1|-(10$ 1<1$1x?12'p 2D&2/)2|]$32,%92h-L2(*@[2|,i2%s2%x}24 2 42< 2-2f"t222$0p2H+2+h2'p3 3,-%3v`/34h`(@3@ H3 Y3V2c3%<n3^#h3.3J$353$3L*353 4A3s!3N^3O0x3T54`<.(4x+X4/ 54X-E4t`O4Z"V4!La4 4 m4,^a~4y24D54D"0454V#4]4D'H48]4*, 5#5E^55'5^0\A5]L5. W5\4 c5]}5"5S1 525i25*50L5H]`5 5#/5hk16 .6<%"6i2 06Pp"<6X5$K6(U6,5]6 Hk6p3xw6!46}.\6P[&H6 06G#H6/26h56|H1L6@5<6X"6_7HN^ 75 7>!/7Z$|:7` E7]N7@*^73 p7a{7)7 `7܊%7P37#7"\72x7007hC%7(~087, 08 J*8q38l2#8-)8P# 58`#A8g!dT8`Z/f8Č ,r8 $2|83 8Db-8"828/8 4 8"p818\F39t29=/@&9@"-9]99faB90( N9D?#X9a8e9$'4q9V%h~9h2`9 1X9`'h9T"9 1&P9 !%X9l`9 H^ 901:t':xL3:4 :^,:H+9:t/G:h#S:l#\:."p:h32p:a/L:}'T:5:P!:m`:X1:DB$:0i!0:T5:_@;!;j.;>1x2;|J!?;4p#N;_T;af;<&|;/\;5;e`;K$;A$;8D/L;_;82;k0`;X .;g`<P$<8)D"<ܾ$x-<g%7<"l@<G"8 >da> .>_'>"`->X 4%9>1C>h92R>,`>0a*p>e`|>@5!>D@`>L) >)`>T5> ]>@j2>X,>$n,$>5 ?)$?h%?|~#l ?|"/?l.P7?XK!xG?h pd?\5w?|# ?0-?]?Tn/P?-x?!<?XS2?X)0?!?8<2@xa@|70)@&<:@(&HD@0`Q@L?*Pb@$Pp@5w@5@D&H@%# @*$@5@R3<@d.p@.4@L;.@<3  A<5"AY#4AT$D@A2PA,,X[AM $mAH3uAa28A,`Ana$A*lAH]Am% AT5Ad,1A/,A0M^A0BL+$Bl+X 0Bq39B"hHB!WB0tqB"|Bx`B)/BĘ-B<5BV.B8&Bw!xB0BaBe"\Ck#C"Cs 1C|(AC2hTCt/bC&pC]C''C#$C 2xCȬa8C(KaC!<CL]C% C(-C(B3CaCH#PD/dD|-0D4T2>Dx !LDX}'cD{`jD! vD_DH2lD-Dd$Dhu"tD0.XD$5D_D 0/TD#$Ep#HE1lE+d%E0)\0E8,f50Ofd._f@+lf&LwfL5$f(@!$fH/ftT3 f,+,f/xf/(fp1g;1 gx`g̯a&g3/gT&jJ#Ij/$_j.lj*{j%tj"j0 Djajtq3j1hjd?%j0/jP'j!hjp"Lj3! k2@k8-%k-&3k5:k%Ck_Qk = P]k-ikLe&(uk4@-k1lk5k|/0km+kD/kl5k/Hk'<k,@.l<$l` #ld&+l|"9l-LlG.d[l-nl5l1+lal45l"l]Pl50lx1 l/m@]md&%m$,m@#|8m4 Em/ Smħ$`mh*lm#p31q&|!qN.D=qv&8Mq\c$Vq1iql/}qiaqL "Tq6!@qH`q\5q $q820q\0XqdW.|q!\qq3rs&xr(b.rg`+r.!H?r8/NrP Xr4"@cr.jr!{r1<r|5r o2(rD04r|)r2#rs)rXE"8r / s#/s5's5 5s&4?sF! Ssx@ Has$#hsL" psL&\sT5(s`5s%DsH sas!`sx~1@s.sN^tY*|t y`$t_4t'3At2Rth)_t5!ftl&st%ztD,Ht*Xt*ti-t s)tHt`(t!xug` u"u0#+u*(9uj-Cu;!dSu(/,cu|hapuX-u.ul)hu2um+u#uؠ'uL1\ud1uh&v5v vȬ5$v43#v#x1vܾ5Fv0-^v)<iv̤%`rv *@v,b/v4#dvL"`v-v$l-v,mav`!v|m/v|-#v$"wLD!p w+lw $h$w f03w4/@IwD$Sw"|\wp!fw]nw@+wwA1w0/\w)w3$w+@w g3,wxK1wl?%wT-wD*wY* xq&Lx"4x*,x|E`6x !<@x V!dKx5Sxܙ.$]x0@ixL%ux|#l~x#x"x(1Lx`2 x]x&Px85 x5xȹ&xp5$ y@H^y(oaHyԐ)<#y &T*y9%5ya >y$Fy4F$|Oy0\yN.0jy#T~y\n)y4{$pK{+X{,.`e{ 0l{C3(y{,{"<{'0{2{a%{,J1{x-{xm`{5{%|O^|`a|<$+|g/=|.8E| R.T|$J1o|c.w|5|x&|M1T|~*T|$5|H%|\2|$#| l1|&|]}L*}#d!}HC!0}(@}\(0K}H3W}-h}$?0~}0p}* }](}`(} H}P14}z)l}|&} 8&~%@ ~H#t~#H\iaV|=!xc2Lw<3`-5Pn1.@ϖ4aۖl[0 !n#< `aH"d_*h!T7/ PFhW0,X0f%s|*H -l_3D-!P`_0`ɗ].TؗL-|]0+%  &D$%< 5#-65D@-]L*f$(pp .|D"3|1/ld.@˜X1И%$ޘx!L^000$d55.y"9 &2F ,LT8`a 2o/`zܻ+(f` !| 0$'/"4Ù@[.͙_ٙM1*lp5 hh.2x`' 51l57$!4H]U]\d*o|`z`%0-$LA3 (š ^ɚh0Pٚ#/@.d5 ^15$-PC!9)E%P|.`^.LgE`qX!0}\^a4x.P2h. &2,&l4 ̛Dq1,|#$$ć(8@^a_3$ t ,&X%(-*'l8&B!V1ft"8r<$ D!, 5$2tG1\Hy`ɜ|aќܯa)D8( %D71/.D$"@!Y11$"LB'P%a_l4*}5]V+25,=* ѝ`30۝X%$d1tо5R%H#()\,>]M-2\W.. f;`q1\{X1(<.$j$/#"ɞ$/۞-Tq`0,.4+!T2 g$=-DZ0TY.,dL5qp#{@"0"4L t$G$l2xƟ1ޟtP0X-T+2L/P .$_,<18-@5YPm& d<5l\2wH9%Py04*L&%d$0ϠH+pޠ4Y&%,U(85 &#&`u"3<]A4"K]Z\*ma{X%L01(/N'4]X$Ρ"֡a'  t_# 8"161A*|S*8a4)hm$O^w1]x&(|/00C.$Ңh18-\m&xr`4M# `93 ,tG^4x0LA`I0Wx-]T eئ$lq=.HaT`5P.%/\ƣ(tѣ5(ڣ`3$p 3,5TT5Q#`!H13#<2PL>`]`"ftR#`r-Y,"1H(-4.|ΤPH-hۤl32$3 3,'+f3d3)'G!0Z{1Lr|*Px"Э5$ؐ&05,ƥP ХH`3Dإt`4V%p,$L8-t2Py0D#/.{`<Р(N</xb]<m($,|P*X8N#lb'(545æ*l֦.^a,O^La`P3 D \9/2_AhaLd&W11bD5n`#xv/X$\O^5)!4G^ɧ] اa0h/<5 8245+-;Z$F5M 0X\h-r0%T}#l111$ H'0HϨDY%dר`5. $H% a<(l$4K!$7,c1lD)R3 ]d-p`*T@ ,D~ \̾'5ũP"`ϩ\/Hܩ'%|>1$5|r`@% $(/$@_1V`51(g|5wpM3L5܈-.@]8#h%,Ȫx2pЪ4%0۪l;%T 1)"  5LX1\/v&?HA`$K( 8`u`j }1-m'he3*ͫ`1T۫+X,44(%"hL%$t/t3lN3(<x+JaTaj*L{U$"H52D0x|34ƬR#`Ѭte&ڬX# 2 3H#]1 (C:3 Qf#T]#i$wO^ 5b1` )\\%@­1\ӭh#_$[0 -<%ht$4)17poaJ]8c<_xky`t+*@xM%,-d%@î3 ծ.5)D4 2L ~+)@(!4Ap^0,Z[&kE` y/Dy&ia"d H$F$Tį@]˯/4Tah./H~5`(5224]d5Ƽu!׼_0!\|& k1H`' |&1<"LHT 3 Y0W)d5t0Xl2G+$W{`aԤ1lk-$ı%]p54Զ5@]|G! L7/ 3+ "lL#/W*``y`mȅ#w)X%/4<-*1)'#* &d_Dt'(n&+\^=.hR!,P]<%1p4-|-,$T#1H/ 0'L``\&0 4!(na-!`5\Q+ Gp-S, ha jh`rp"@)!5 F^t/"(H5!,p&P^321%<#4 /:+95$Hd0R$atl#Hp]vs/s)p{#0]#hL3 $x/x)$!̶"h x]\(,47,t2@/Ix!`3 uLZ18"/ (j0,/$p5$"2"1 4 E^*!@B1Jt+3,V80Pj2T~($(72T!l0*0 .'05!1 $^ /&0-9p2J+,[5e E%kG! w3i$,,,S.?#p~.t44`t/T*La*(|5p1'"dm'h4(%C<,%hO!,^\-2tm`b.v@ |!paȾ%"%D!L-t&p05TC. z*4#!$q2x2(v"d?^3GS0@Uail5u#d\->2.`h#P)$$V$8-2 .8d1 `2#%`d+G2X5) @3G`aUxO2a\\1yP' $08/\)l .0 i$$/.T&H53 %241$Ѐ+42/l@<5Hm`Q14dw!x"h2$0L4#Xt]x#-T,^%<5.X&A#2h6!@9M3(BxZ0XR8g3X8|#g-`x$(PdJ!D..w*D!T8*2T N^0(c"<&D ;`:%'(/6h-LP0+hV5_h!n<`sDn3:"("1$ 5@+TNa`- P-< 2t` 5'19@'Ft34U1he.mP8$z-X",!</3`$6.8 'D0l,%!6$`=,((Ho# V`6!^s&hf`qr%`}823-o$d|Y2k-pq)* ?"d-3,5$-(m$\2%l@(-L%W` g`]t,hL*(8/3*ttL) "lx^'F^fa 2!-1l, C|r)] i)s5}4a053t 2C2T*` )`3na$#Xp/2 T=10)Hy`W"0f^q(%D{)55/x %"8]$x!8x]`^$W#dH^8O$( 0#p0Z39\G^CG^R|0^$]yXK#DI3 $41t[08#/ (r)-4(L<_$5%t 0904DK1 a\/k5x`i!p/!HC1Ts`H/ P(T`(5X0x)(0#4~,\7)DDm1TP^0 kp%v+$"| D$l8!+TJ!2-1d!0`!p09+|H?' \1Lg0H,]3m.(\w#p+ F^Խ#b%tHW1T\.` ̂/`T")l$51>P%JxQ3TQ\q%x^(1\k5G#D5h(\L_3+x`,H^#04 q&X8o) D-!]* 7D1GcaUē-gLq0pyQ!Tt4 TP,X-x*2#dLJ2T1  b.aX&X!X<$05$,2tA(OaV@!pk=$r'$Hj'8%0080XT/]x$3M.\x)4#3&Hc':Q3>aR-fHn,o_#tTy`1Na le/ġ1X 5#Hd*P)php1Pv`'x`3i2HC)HL %W|C!e(&Tr(2,/Pp+<N^\_3 .%@/`.\] aLT'$^0*L+0 P@-K\ba\V1Pq o+}/, Y$X5)X $%|"$3 32 #+&z"d 55$2p4 LI<5S)c Lm5|+X>+tv24 .xhe#0̙5_L'`'\ w`$5$32<p5P2haT-s% ~83TH3 4x/d(l<#4-N!(P!  @$$0#,?5W$P1\g-{<,$ *5$5$f.@T)/D' `2xt"< a*Ю5 @D )HHe`K-`gla,v`34" 'TE^1I $pWc*4cW.\wr)O1\81XD 10 5(t3B"!J$ 0aa.@`6 '0@ ,M/U($t[*8g5rP. &p/X0$1h |ar)(=0 #'<"M^+L.B(LM`Vl.i<(t&(34t* d%< `&4ȥ$Ȫ/,d%X-0H*(d%`9G!I1 Sh=3_al%Dz(W"D`f3 $3&e* >/DlD"ī%!`0-do,l (2U1,+ȶ"; tYF+l5|.$,)<-d(T.H`3 )#D5$&p/,#p./+?X-PO)Z``c"s]0Hx-%L!DX2400h,| 50$ '@! 13Ի/C@(DN0A$`W"+e`aw_}_a\A.2hH040-$%8["_]Te0| h.@$%(*#`;v`JA1U`b,P!p3!0Й2(1803DA!",5;`]@- %@+\2h^<?̺0hJ-+Ut%/b/kpP3q-$a#ȏ%dt`Z/0&#4 ]63/g+00,!,34+C4'DQ00dz0\uP`0.-!d|'80tl/=.\@.] 5-t5@'_1q;% 1`(P>#(-H#P.P<0.,F)h,!4] ?3-81T7l&? )2lGu' fP`pd- ~ p, N^2Lg.-5d%'Խ&H\0l 5( 5/`o$T8|3@ğ1 N@5_/t5 *Px#`5(:#1<" )(0P,hx4 %f'x8(M2$C@0L[D/k$#$0(1t\6.t&ȥ-$[0%<-tq2E^!$\(0"7h!LD/N8/l\%d(y`u3|!_.D(55%` D2Dy`pA`# 2 G1<c+p+x55`*(C5OI$Z0'n 3v/x'Daau'&L<+Y&5]t!`345*<0> 5Gd<"Tl +TeJ"oXaI$Q -0o1#x$$$L3@5_T!4]\,-x5$-4|.%"$p1L!h8]Go%Q+`!`sX0Pa5P!a#@A$,Pu"(!@(5!2(5%'3,159DD3,E3P0_awD ̚2h-Z!0<^a8& R$B!j.@#/(p|2$53$-4$%<<%G2$Q|!8d u&|l5b#hw `]T:0:0tG!P5,%/-x/?$Q.LP<5Y"Pm_#( 3p 2$`05L?2Pa( (]a`a&L.@)h<"#hb"-`D5HG`2_%jpD&0wЮ-55{`$a%L-!(LG2<T/\(5'!03\`?l1 M$V<3$]/y1/-\!,,-+oe/\.@\L%t8g3XF#Xu"p%84``b'XT \q` #@) 8P(+d1$0AD}`Ty`[(3$fa ow`y$%<d]t0HaOa X0-(M^lM^, \|#\ a" w!h82Ll2["1mܮ/H `),H1Pxt`LW$X2(^+&/(`s`\.$ 1 $-2 '? h5 D g.<M H/\ 80j Lw&${ $ 2!( L5 %@  `  E^ toa ] 3 T38 d& -( -/ ()L= 8r`G * Z -$h at P$@| 5 ] ] G0X 62 P28 ,#$ <2 ܬ% $< "T XM^ - a E./ @5 ; PI+TI (!^  n -x{ .1 3 ` . $k#8 p&L  (< D' ds` T*"  z`/ ȥ'H  \ xU1Dq /4 p$ `"D a/L &  \k#@ h&0 T1` !@ 2 0! | ܊!! P1< -LN 0&Z h2Lo &y +x H}0 # x~"  U"$  F0 \. %d T# T~!$ 5 .H515:w`D\ @L[+Y1eL*x V0\T/$5x`+|%P|"" g"$,"#$. `&ȗ%,5,P1,<- LQ(U$|^m1na#1) 5P#a5/ |"$3T1x$$]^21 ,# =P]H5[ c a p.x5#1h(4 %<I$5|t`Ԝ#@]!x/$*]4L-CA!0]tA`j-u!4H2T5] 4%<0L(Z3\]ah`T-Dl2 P,#`-3/C<%0N5Wt]b*\oL#0})`'8dc04X+K%`p&#>/$L&%5 -8X&P-"x> 7#|O5b4, lr('G%p3 1.5"x}%(3%.p z`] % *>`*tNQ-]4%,h5$zX+5$u2^#.  i1$g0|a%@# /d%<-4w`J;`S-c}#lk &|%l'P(^aay`(;# !}2D]0 `ba`%+ĩ08D#B(|)M!`!lh(1~]G!,x$l40-!5F%!p 0t.!{-x-܅37]<h!QLa0^<$gD$tH5Ծ!H)`1)8%$\ %D`/,p D+L'+ .d4Y/O&[_f,aub*5$B!$P/\%|;`;`-5d5Y.(! 0.81A|)Q 1Lc#l<4 y- -(_3$-<1pH5% /*1d \12$ DS0  #. /9 0G p-O H5_ $h 2{ (`1h / h/ a 4'  Y. P*D &"!@M !(!-*!T%4!d!DC!n34Q!X$Z!$i!|"r!5$!]!41d! a!t.!@&!*4!"l!(/!)!Զ'!/ "`a" X%x'"p&3"h0?"^aH"_V"Z d`" j")t"8%}"DH "a"0i1T"Ћ%"'"5"L]"P&0"H%D"j,"xK$"4W#| #G^#00#+$H/H$]\;$@-8G$(`P$ ]$ j$ 5s$G+$8+X$a$5$-$s)$p5$+$h#%x` % %8/P3%Y&D%A#\P%2Hb%0r%p('t%X&H%|%h%|+%X71% %@*%4$X%0\%12`%Hf#&<`&f3(&t10'&~.1&0-D&]!N&^0Z&H-$n&5@y&T54&\-&w%&D/ H&a&'&]&$&#']0' 5$"'5(-'X1h>'3S'*l'h-') ','|-'5 ',y`'(H'tH(t'@%('5(/((&+(32(s)L(j2a(@3,l(xoav(v! (/(p-(԰0h(pia('(ܼ#(."(h'0)H^)_&)%@')`(6)4n'L)5c)X5u)+|)5)$t0)*|)O^) ')5)P&,)p%@)%T)xE`*\/*H" *+/0* pM**xZ*]b*I 0l*@%Dv*X*L*'|*/*0+*̛#*2H*"*H"*Ĭa*($T+++(#+@#D3+X2\=+@&I+.T+Ժ't`+$P!s+2+^0h+H-T+1x+45+.+a +(`#+L.H+-+$@,5,`,+|,1`),̻59,aM, 5`,-k,5,4ma,2 ,l/,\",3p,%T,m`,#d,,-,-- s#<-4o!t%-"/3-hs`>-p0xJ-R1`-P,\m-,La-N^-P08---^-*P-!-d`-4J1./.!P.1<1.5B.l`K.x5LV.B1(e.ls`s.d$H.T !\.ps`. &.%|.5.#.5.`w%l.h!.L>*/a0D/45)/$}0$5/ *G/]P/|j/Xa/!r/]y/]/]/]/T$/<.,/ ./-H/\# /g`/l8#/)!0L5(0l0`000@:0|*H00V0t``02o0\00hk+@0&X0 U1X0%0P +0&p04'0x'0% 1/10-1t(61L}`l?15K1b$U15$f10,18"1 1'1'1L]1\]1)1 ,h1ԅ&81%L2401h2_% !2`O(d12lq382q'lO2$8^2%,m25$|2y!2-2B-(2Ts)2<52-2dr'p30&T3Ȭ-$3 , /3 &h>3,]P3"LW3԰5$e3\au34La3\P#83 !333H`3`(d3^(x"3'P3b#03`B04] 42`4x]&4(-4Q(74 TF4|, Q4x1Xa40s454S1H4`(424]24ܒ#|4< 14a4!(5Џ55 T%5%3255>5:,0S55^5d"g5 3v5|#-5 a#55(5)t5 +5(!5<)<5t#5pD35|=`5_5]6$\6d&H6B"(61$56$?6H2P6`.b6",q6ia~6\l`(6`a86\$L6\|!@6.\6-6X1D6$5&6?!h7u$740&7Z&|47a8F7 3(W7dA"f740!t}73,7lx27-7 "7ĺ"7a7P&7%7K18%/H8/P8$'8!` 08Lh3>801R8L Df8H.3 u82|8̅38_8 !8