,``@00ھ004 `@# ` "" $@` `T@  p b@"@H*/+  "b   0  "# "# * "#!` "#@㿐@#  a"a @ "  "8@c@  @   " @@㿐 c@T    "P@c# @ D ?#c' / - + ,`2 h@k㨒   # #@^㨒@a#@`b@S@?@2 @a aa @F`#@Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @"1?㿘 #@(1 @"1㿘@ʐ " ܒ㿘 @  㿘 #` @ "  `  "  ` ""J  *@J` )*@㿘@  #` @ "  `  €b  $€b 2$   " @ɐ"0   $  $`$` 㿘# b `   ``*  `b    '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 "   @@ 0(@  㿘  @ $ ? `$ *㿐 " /  0T@㿘  㿘 " `t€㿘) ! ?N  @  "!Т!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ "+  " * @7 $`0 "$`4 " @$` @ 2!&  %!  @# 㿘# a  @ 4 "$a & 4$a㿘 #*`@   #0@ \   #         #H@y` ` #@  #8 <?*  ` آ&@  `  #`@㿘?( ,1 \&" H L` T ` X P d l$ p  t @  .@ dd ? * `:```?  `h "`h"     d?"  d㿘 a'H'L'P'T 'X "a@/H @#h㿘 #p4 (4 4444444444 444p4444 44444̝㿘 'H'L'P'T'X#`@ H㿘 #`@8N@`N@`%` N@`|`  *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈 #x@ @,@  ?L?㿘  l`  !  cJ@ #! @ @   @ *0   @ *` ( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" %s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx %%%%%%%44,44444444   444p4p44444p 4-4 D84A4L4Z4 He4r4\4`44 4h4 44 l444@4p444 Dt   @@Dt-@``O /mntoQ`[[@@<@`bT Dt   @@Dt-@``@@<@`bT UDtO ($jAA DtDt8ـDt8ـADt2bDtÀDtÀAVDt2Dt5 RDt5 RP`X,`ADt2Dt Dt ADt2Dt2Dt2(WHADt2Dt2Dt2dADt2Dt2Dt2 VLADt2Dt2Dt2|M*ADt3BDt+Dt+юCDt3BDt3BDt3B ADt3BDt3%Dt5ADt3BDtDt>$AD]DtGDtGQADt3%DtCDtCPmADt3%Dt5Dt5ADt3%DtpDtpTDADt5Dt5Dt5NDADt5Dt6=Dt6=>`8CDt5Dt Dt XADt5Dt5Dt5UҲADt5Dt5Dt6=+x;ADt6=Dt6=Dt6=.B28DttDtNDt8ـ (0hpxX 8SDt6=Dt6Dt68R{Dt98pDt9Dt9 (0P)DtDt1-Dt1-8'Dt hDt hDt h9DtvDt>Dt>:MDt9DtDt]J;I$Dt!Dt*QDt]J@ B_s6Dt-LDtÀDtÀ8@HP:VwDt Dt Dt /tmpmNDt#FDt(Dt(H*AmDtׄDt98pDt+F7:aDt9Dt9Dt S+R!Dt9Dt9Dt S+*ZaDt9Dt9Dt S+ R!Dt9Dt9Dt S+ ŜaDt9Dt9Dt S+GQ!Dt9Dt9Dt S+5paDt9Dt9Dt S+y!Dt9Dt9Dt S+`aDt9Dt9Dt S+7!Dt9Dt9Dt S+T#6aDt9Dt9Dt S+3Ϲ!DttDttDt S+aDttDttDt S+n҆!DttDttDt S+ztPaDttDttDt S+>r!DttDttDt S+uaDttDttDt S+Pٵ!DttDttDt S+ȾVaDttDttDt S+ q!DttDttDt S+ r^^aDttDttDt S+ J!DttDttDt S+ ~aDttDttDt S+ V!Dtk Dtk Dt S+ aDtk Dtk Dt S+ ?!Dtk Dtk Dt S+ TaDtk Dtk Dt S+ omW"!Dtk Dtk Dt S+ jaDtk Dtk Dt S+9!Dtk Dtk Dt S+ jaDtk Dtk Dt S+g3+!Dtk Dtk Dt S+$!Dtk Dtk Dtk heaDtDtDt S+ ˜!DtDtDt f[4aDtDtDt Sjj!DtDtDt ˏnaDtDtDt !s!DtDtDt ŽaDtDtDt V\!DtDtDt raDtDtDt =P !DtDtDt =[7aDtDtDt !Dt8Dt8Dt XI޶aDt8Dt8Dt M0!Dt8Dt8Dt ѪaDt8Dt8Dt c\!Dt8Dt8Dt f43aDt8Dt8Dt 2!Dt8Dt8Dt 05aDt8Dt8Dt p!Dt8Dt8Dt  Z4aDt8Dt8Dt F=!Dt4΀Dt4΀Dt  0aDt4΀Dt4΀Dt y*!Dt4΀Dt4΀Dt  G? ]aDt4΀Dt4΀Dt s!Dt4΀Dt4΀Dt  /aDt4΀Dt4΀Dt !Dt4΀Dt4΀Dt  aDt4΀Dt4΀Dt %Ԥ!Dt4΀Dt4΀Dt )qaDt4΀Dt4΀Dt D!Dt4΀Dt4΀Dt aDteDteDt B!DteDteDt jaDteDteDt  g!DteDteDt X9!aDteDteDt X  <=!DteDteDt XүaDteDteDt X DE!DteDteDt XL +aDteDteDt X Ñ|!DteDteDt X-0aDteDteDt X |<!DteDteDt XmaDteDteDt X 6!DteDteDt X\oaDteDteDt X ~!DteDteDt X.aDteDteDt X !DteDteDt Xo=aDteDteDt X )[_!DtDtDt X4+=aDtDtDt X O!DtDtDt X*aDtDtDt X #fY!DtDtDt X-aDtDtDt X iYS!DtDtDt X daDtDtDt X e..!Dt /Dt /Dt X\maDt /Dt /Dt X /<!Dt /Dt /Dt Xa#aDt /Dt /Dt X b.xF!Dt /Dt /Dt X&BsaDt /Dt /Dt X Vt!Dt UDt UDt X *aDt UDt UDt X !β[!Dt UDt UDt X!,aDt UDt UDt X "_c!Dt UDt UDt "K&aDt UDt UDt  #_!!Dt UDt UDt #YaDt UDt UDt  $ⶒQ!Dt UDt UDt $d|aDt UDt UDt  %6!Dt!`Dt!`Dt %H)aDt!`Dt!`Dt  &ZOe4!Dt!`Dt!`Dt & 'aDt!`Dt!`Dt  '΂!Dt!`Dt!`Dt 'ZaDt!`Dt!`Dt  (,!Dt!`Dt!`Dt ()9aDt!`Dt!`Dt  )X!Dt"Dt"Dt )\9aDt"Dt"Dt  *ʉ<!Dt"Dt"Dt *maDt"Dt"Dt  +S!Dt"Dt"Dt +M(y\aDt"Dt"Dt  ,|dr!Dt"Dt"Dt ,0kaDt#*Dt#*Dt  -*!Dt#*Dt#*Dt -|aDt#*Dt#*Dt  .)!Dt#*Dt#*Dt .[aDt#*Dt#*Dt  /I!Dt#*Dt#*Dt /HRaDt#*Dt#*Dt  0!Dt#*Dt#*Dt 0YaDt#*Dt#*Dt  1!Dt#*Dt#*Dt 1kaDt#*Dt#*Dt  2Ap]!Dt#FDt#FDt 2]wFwaDt#FDt#FDt  3k!Dt#FDt#FDt 3&aDt#FDt#FDt 4Fb!Dt#FDt#FDt 4TiaDt#FDt#FDt 5Yo!Dt#FDt#FDt 5"aaDt#FDt#FDt 6'X!Dt#FDt#FDt 6J(baDt#FDt#FDt 7]~D!Dt$[܀Dt$[܀Dt 7aDt$[܀Dt$[܀Dt 8!Dt$[܀Dt$[܀Dt 8n<aDt$[܀Dt$[܀Dt 9g3!Dt$[܀Dt$[܀Dt 9V\ aDt$[܀Dt$[܀Dt :OO!Dt$[܀Dt$[܀Dt :q3aDt$[܀Dt$[܀Dt ;m%!Dt$[܀Dt$[܀Dt ;+aDt$[܀Dt$[܀Dt <U&!Dt$[܀Dt$[܀Dt <OeaDt$sDt$sDt =kz!Dt$sDt$sDt =aDt&%Dt&%Dt >+G)!Dt'VDt'VDt >a&aDt'cDt'cDt ?]!Dt) Dt) Dt ?5IضaDt*QDt*QDt z!Dt*TDt*TDt n9_aDt,Dt,Dt ȁ!Dt-LDt-LDt naDt-DDt-DDt qߞ!Dt/qDt/qDt ndaDt0GDt0GDt ?,!Dt05Dt05Dt naDt2bDt2bDt t !Dt3BDt3BDt n̒aDt3%Dt3%DtNJ ^!Dt5 RDt5 RDtNnr}aDt6=Dt6=DtN!Dt6Dt6DtNnl0!aDt8CDt8CDtN$je2!Dt98pDt98pDtNnhYaDt9Dt9DtNH5!Dt;3Dt;3DtNnaDtDtDtN p:N!DtbZDtbZDtNn |aDtbZDtbZDtN f g!DtbZDtbZDtNn >aDtbZDtbZDtN |T!DtbZDtbZDtNn SaDtbZDtbZDtN <!DtbZDtbZDtNn fB$aDtDtDtN D!DtDtDtNn aDtDtDtNW !DtDtDtNnAaDtDtDtN#;!DtDtDtNn3maDtDtDtN _Z!DtDtDtNn UaDtDtDtN&h!DtDtDtNn}aDtDtDtNȐ!DtDtDtNnaDtDtDtN~!DtDtDtNn#5aDtDtDtN V!DtDtDtNn8 aDtDtDtNQ!DtDtDtNn(laDtDtDtNe!DtDtDt沀ncaDtDtDt沀aA-!DtDtDt沀n&aDt,Dt,Dt沀f!Dt,Dt,Dt沀nLaDt,Dt,Dt沀 !Dt,Dt,Dt沀n ϯ$aDt,Dt,Dt沀 !Dt,Dt,Dt沀n `aDt,Dt,Dt沀 }6!Dt,Dt,Dt沀n |aDt,Dt,Dt沀 T!Dt,Dt,Dt沀n tuaDt,Dt,Dt沀 RQ*!DtĴDtĴDt沀n ;MaDtĴDtĴDt沀B!DtĴDtĴDt沀nt&aDtĴDtĴDt沀gw!DtĴDtĴDt沀n!]:daDtĴDtĴDt沀^C)!DtĴDtĴDt沀naDtĴDtĴDt沀6<!DtĴDtĴDt沀nDfoaDtĴDtĴDt沀!Dt]JDt]JDt沀n\*&aDt]JDt]JDt沀5:{!Dt]JDt]JDt沀nC#AnaDt]JDt]JDt沀X!Dt]JDt]JDt沀njaDt]JDt]JDt沀mS!Dt]JDt]JDt沀nBY%aDt]JDt]JDt沀u!Dt]JDt]JDt沀n]0aDt]JDt]JDt沀uG!Dt]JDt]JDt沀n3WaDt]JDt]JDtI !DtDtDtIn _aDtDtDtI(|!DtDtDtInzaDtDtDtIww&!DtDtDtInxaDtDtDtI `!DtDtDtInXaDtDtDtIA'H!DtDtDtInȰwaDtwDtwDtI3t!DtwDtwDtInaDtwDtwDtIN:!DtwDtwDtIn(aDtwDtwDtIUD% !DtwDtwDtInaDtwDtwDtI 8!DtwDtwDtIn&aDtwDtwDtIf!DtwDtwDtIn62aDtwDtwDtIV5+!DtwDtwDtInXFaDt'Dt'DtI-Ł!Dt'Dt'DtIn&f0aDt'Dt'DtI ;!Dt'Dt'DtInV)LaDt'Dt'DtI !Dt'Dt'DtInaDt'Dt'DtIoW>!Dt'Dt'DtInaDt'Dt'DtImt!Dt'Dt'DtIn.k aDt'Dt'DtI@@!DtDtDtInFzaDtDtDt߀!DtDtDt߀n^aDtDtDt߀!DtDtDt߀n aDtDtDt߀QkM!DtDtDt߀naDtDtDt߀5/!DtDtDt߀naDtDtDt߀ݙ8!DtX;DtX;Dt߀nNLaDtX;DtX;Dt߀hJB!DtX;DtX;Dt߀nUaDtX;DtX;Dt߀F !DtX;DtX;Dt߀nb/PaDtX;DtX;Dt߀ 9D!DtX;DtX;Dt߀n 5aDtX;DtX;Dt߀!l]!DtX;DtX;Dt߀n! ƵaDtX;DtX;Dt߀"X!\!DtX;DtX;Dt߀n" ·aDtрDtрDt߀#u!DtрDtрDt߀n#!lUaDtрDtрDt߀$ל!DtрDtрDt߀n$`d[aDtрDtрDt߀%g!DtрDtрDt߀n%pB[aDtрDtрDt߀&!DtрDtрDt߀n&zaDtрDtрDt߀'%=!DtрDtрDt߀n'yZaDtрDtрDt߀(P%5!Dt hDt hDt߀n(faDt hDt hDt߀) !Dt hDt hDt߀n)aLaDt hDt hDtv* !Dt hDt hDtvn*\HaDt hDt hDtv+!Dt hDt hDtvn+LӬaDt hDt hDtv,N!Dt hDt hDtvn,'S YaDt hDt hDtv-ƟR!Dt !Dt !Dtvn-"aDt !Dt !Dtv.ϻ!Dt !Dt !Dtvn.{oaDt !Dt !Dtv/ nt!Dt !Dt !Dtvn/łFaDt !Dt !Dtv __!Dt !Dt !Dtvn qWaDt !Dt !Dtv!U!Dt !Dt !Dtvn!'aDt !Dt !Dtv"~!Dt !Dt !Dtvn"aDt Dt Dtv#!Dt Dt Dtvn#&aDt Dt Dtv$Ѓ!Dt Dt Dtvn$ aDt Dt Dtv%z0!Dt Dt Dtvn%caDt Dt Dtv&~6!Dt Dt Dtvn&(aDt Dt Dtv'Ǔ!Dt Dt Dtvn' 7}aDt Dt Dtv(x!Dt S+Dt S+Dtvn( aDt S+Dt S+Dtv)F'!Dt S+Dt S+Dtvn):ZaDt S+Dt S+Dtv*>I!Dt S+Dt S+Dtvn*kaDt S+Dt S+Dtv+w{!Dt S+Dt S+DtI n+JaDt S+Dt S+DtI ,;!Dt S+Dt S+DtI n,l3aDt S+Dt S+DtI -K%!Dt Dt DtI n-\>aDt Dt DtI .0oH!Dt Dt DtI n.*zaDt Dt DtI /ǩ!Dt Dt DtI n/ aDt Dt DtI 0|&!Dt Dt DtI n0;saDt Dt DtI 16]!Dt Dt DtI n1yaDt Dt DtI 2>#!Dt Dt DtI n2pxaDt XDt XDtI 3 !Dt XDt XDtI n3xaDt XDt XDtI 4:K!Dt XDt XDtI n4OaDt XDt XDtI 5v!Dt XDt XDtI n5FaDt XDt XDtI 6`!Dt XDt XDtI n6yaDt XDt XDtI 7'!Dt XDt XDtI n7 aDt XDt XDtI 8ݚ!Dt Dt DtI n8-}aDt Dt DtI 9_J!Dt Dt DtI n9FaDt Dt DtI :Mb!!Dt Dt DtI n:KVaDt Dt DtI ;D-!Dt Dt DtI n;/YaDt Dt DtI <!Dt Dt DtI n<^aDt Dt Dt=[!Dt Dt Dtn=aDt Dt Dt>Wx!Dt Dt Dtn>aDt Dt Dt?T!Dt Dt Dtn?aDt Dt Dt0^h!Dt Dt Dtn0<.aDt Dt Dt1;!Dt Dt Dtn1E ޒaDt Dt Dt2D!Dt Dt Dtn2aDtNDtNDt3B!DtNDtNDtn3+aDtNDtNDt4!DtNDtNDtn4t&aDtNDtNDt5\!DtNDtNDtn5ӝaDtNDtNDt6-!DtNDtNDtn6OaDtNDtNDt7!DtNDtNDtn7aDt沀Dt沀Dt8H[.!Dt沀Dt沀Dtn8GFaDt沀Dt沀Dt9XQ,!Dt沀Dt沀Dtn9AaDt沀Dt沀Dt:f!Dt沀Dt沀Dtn:{aDt沀Dt沀Dt;nm!Dt沀Dt沀Dtn; aDt沀Dt沀Dt<$!Dt沀Dt沀Dtn<iaDt沀Dt沀Dt=}Z8!DtIDtIDtn=Wo4aDtIDtIDt>B!DtIDtIDtz9n>¼vaDtIDtIDtz9?L~:!DtIDtIDtz9n?5aDtIDtIDtz9!DtIDtIDtz9+ aDtIDtIDtz99!DtIDtIDtz9yaDt߀Dt߀Dtz9!!Dt߀Dt߀Dtz9T>aDt߀Dt߀Dtz9L$m!Dt߀Dt߀Dtz9ZU[aDt߀Dt߀Dtz9S[!Dt߀Dt߀Dtz9faDt߀Dt߀Dtz9bv!Dt߀Dt߀Dtz9I_`aDt߀Dt߀Dtz9(B!Dt߀Dt߀Dtz93jaDtvDtvDtz9!!DtvDtvDtz9"aDtvDtvDtz9/p!DtvDtvDtz9[ aDtvDtvDtz9 We!DtvDtvDtz9 (aDtvDtvDtz9 ,Z!DtvDtvDtz9 i? aDtI DtI Dtz9 !DtI DtI Dtz9 $gaDtI DtI Dtz9 8!DtI DtI Dtz9 $aDtI DtI Dtz9 a!DtI DtI Dtz9 q=aDtI DtI Dtz9@!DtI DtI Dtz9kaDtI DtI Dtz9M!DtI DtI Dt #;aDtDtDt\!YY!DtDtDt+6paDtDtDt>!DtDtDtaDtDtDt!DtDtDtaDtDtDtG!DtDtDtdlaDtDtDtWj!Dtz9Dtz9Dt}daDtz9Dtz9Dte!Dtz9Dtz9Dt%T'aDtz9Dtz9DtZ1!Dtz9Dtz9Dt?@aDtz9Dtz9Dt!Dtz9Dtz9Dt;L'aDtz9Dtz9Dt!Dtz9Dtz9Dt)OaDtz9Dtz9Dt"U!DtDtDt QtaDtDtDts0!DtDtDtSmaDtDtDt!DtDtDtYaDtDtDtHx5_!DtDtDt|aDtDtDtyd!DtDtDttu aDtfDtfDt{!DtfDtfDtP|aDtfDtfDt<!DtfDtfDt:aDtfDtfDt K@ !DtfDtfDtf ga9aDtfDtfDtf!՜!DtfDtfDtf!|sv?aDtfDtfDtf"Ug!DtfDtfDtf"aDtfDtfDtf#i!DtCDtCDtf#s ~aDtCDtCDtf$m!DtCDtCDtf$);aDtCDtCDtf%Q="!DtCDtCDtf%hKaDtCDtCDtf&a'H!DtCDtCDtf&:xaDtCDtCDtf'v!DtCDtCDtf'paDtCDtCDtf(-$!DtܓDtܓDtf(# aDtܓDtܓDtf)XlR6!DtܓDtܓDtf))9aDtܓDtܓDtf*"v!DtܓDtܓDtf*j2aDtܓDtܓDtf+IkD!DtܓDtܓDtf+4aDtܓDtܓDtf,=!DtܓDtܓDtf,a@aDtܓDtܓDtf- !DtܓDtܓDtf- aDtu*Dtu*Dtf.&*!Dtu*Dtu*Dtf.ПaDtu*Dtu*Dtf/l2!Dtu*Dtu*Dtf/KmaDtu*Dtu*Dtf0]R!Dtu*Dtu*Dtf0}i'aDtu*Dtu*Dtf1 !Dtu*Dtu*Dtf1laDtu*Dtu*DtC25!Dtu*Dtu*DtC2KDaDtu*Dtu*DtC3=!Dtu*Dtu*DtC3.N2aDt Dt DtC4H!Dt Dt DtC4+$aDt Dt DtC5>k"x!Dt Dt DtC5aDt Dt DtC6 z!Dt Dt DtC6MxaDt Dt DtC7׽!Dt Dt DtC7R_UaDt Dt DtC8Ԙ<!Dt Dt DtC8 1tgaDt Dt DtC9.O!Dt Dt DtC95aDtWDtWDtC:OB;!DtWDtWDtC:faDtWDtWDtC;T!DtWDtWDtC;iaDtWDtWDtC<p!DtWDtWDtC<wiaDtWDtWDtC=}4bt!DtWDtWDtC=9:aDtWDtWDtC>L!DtWDtWDtC>;aDtWDtWDtC?j`Ud!Dt>Dt>DtC?bCaDt>Dt>DtC@!Dt>Dt>DtC@:|aDt>Dt>DtCAU!Dt>Dt>DtCAfaDt>Dt>DtCB7F!Dt>Dt>DtCB{иaDt>Dt>DtܓCr!Dt>Dt>DtܓCcaDt>Dt>DtܓD e!Dt>Dt>DtܓDaDt>Dt>DtܓE"»!DtׄDtׄDtܓE] aDtׄDtׄDtܓFהY!DtׄDtׄDtܓFl1$aDtׄDtׄDtܓG{!DtׄDtׄDtܓG966eaDtׄDtׄDtܓHO !DtׄDtׄDtܓHGfaDtׄDtׄDtܓI!DtpDtpDtܓIaDtpDtpDtܓJoH!DtpDtpDtܓJZaDtpDtpDtܓKg*!DtpDtpDtܓKaDtpDtpDtܓL!DtDtDtܓLaDtDtDtܓM!DtDtDtܓMsaDtDtDtܓNg!DtDtDtܓNTaDtDtDtܓONV!DtDtDtܓOpBaDtDtDtܓi!DtDtDtܓ: KaDtDtDtܓ{5!DtDtDtܓ:qaDtDtDtܓP!DtGDtGDtܓ:VLaDtGDtGDtܓL!DtGDtGDtܓ:wǔaDtGDtGDtu*; ~!DtGDtGDtu*jQaDtGDtGDtu*,K!DtGDtGDtu*j~aDtGDtGDtu*9U!DtGDtGDtu* ckaDtGDtGDtu*x`!DtGDtGDtu* UaDtGDtGDtu*έ!Dt9Dt9Dtu* z8%aDt9Dt9Dtu*B!Dt9Dt9Dtu* HaDt9Dt9Dtu*d"!Dt9Dt9Dtu* 2BξaDt9Dt9Dtu*\q!Dt9Dt9Dtu* ;!aaDt9Dt9Dtu*!Dt9Dt9Dtu* aDt9Dt9Dtu*|FHF!Dt9Dt9Dtu* y+3aDttDttDtu*154!DttDttDtu* zaDttDttDtu* C8и!DttDttDtu* aDttDttDtu* M!DttDttDtu* ͫ(aDttDttDtu* !DttDttDtu* EeaDttDttDtu* H!DttDttDtu* "aDttDttDtu* 0!Dtk Dtk Dtu* aDtk Dtk Dtu*-y!Dtk Dtk Dtu*  r+aDtk Dtk Dt v!Dtk Dtk Dt  LaDtk Dtk Dt P!Dtk Dtk Dt xyaDtk Dtk Dt ą!Dtk Dtk Dt 8JaDtk Dtk Dt á!Dtk Dtk Dt aDtk Dtk Dt 2^!DtDtDt %faDtDtDt Q,!DtDtDt 1&aDtDtDt 7!DtDtDt q"aDtDtDt !DtDtDt ݊aDtDtDt U!DtDtDt LaDtDtDt d!DtDtDt DQaDt8Dt8Dt #d!Dt8Dt8Dt #aDt8Dt8Dt =s!Dt8Dt8Dt \aDt8Dt8Dt c!Dt8Dt8Dt x5aDt8Dt8Dt K!Dt8Dt8Dt  aDt8Dt8Dt Yb!Dt8Dt8Dt Ԛ7aDt8Dt8Dt rn!Dt4΀Dt4΀Dt T6CaDt4΀Dt4΀Dt !Dt4΀Dt4΀Dt %aDt4΀Dt4΀DtW PS!Dt4΀Dt4΀DtW UaDt4΀Dt4΀DtW!=!Dt4΀Dt4΀DtW !!paDt4΀Dt4΀DtW"!Dt4΀Dt4΀DtW "#VaDt4΀Dt4΀DtW#9]!Dt4΀Dt4΀DtW #`oZ5aDteDteDtW$;!DteDteDtW $draDteDteDtW%=!DteDteDtW %~tWaDteDteDtW&%Y!DteDteDtW &/aDteDteDtW'AG#!DteDteDtW '&aDteDteDtW(w+/!DteDteDtW (baDteDteDtW)\v'!DteDteDtW )aDteDteDtW* n!DteDteDtW *aDteDteDtW+.Ѹ!DteDteDtW +m{aDteDteDtW,yBY!DteDteDtW ,aDteDteDtW-=]!DteDteDtW -H"aDteDteDtW.]!DtDtDtW .IaDtDtDtW/1!DtDtDtW /a 4aDtDtDtW0!DtDtDtW 0^"aDtDtDt>14!DtDtDt> 1tCaDtDtDt>2%)6!DtDtDt> 2aDtDtDt>3sp+!Dt(Dt(Dt> 3 nmaDt(Dt(Dt>4m\!Dt /Dt /Dt> 4WaDt /Dt /Dt>5!Dt /Dt /Dt> 54aDt /Dt /Dt>6d!Dt /Dt /Dt> 6aDt /Dt /Dt>7[!Dt /Dt /Dt> 7DŽaDt /Dt /Dt>8p!Dt /Dt /Dt> 8W]aDt /Dt /Dt>9R{!Dt UDt UDt> 9sdaDt UDt UDt>:!Dt UDt UDt> :aDt UDt UDt>;lE`!Dt UDt UDt> ;x 1aDt UDt UDt><)"!Dt UDt UDt> <EaDt UDt UDt>= "Z!Dt UDt UDt> =DaDt UDt UDt>>~D!Dt!`Dt!`Dt> >jXhaDt!`Dt!`Dt>?F!Dt!`Dt!`Dt> ?$f!Dt!`Dt!`Dt!`o*!Dt!`Dt!`Dt!`o>[!Dt!`Dt!`Dt!`o@pW!Dt!`Dt!`Dt!`oC`4r!Dt!`Dt!`Dt!`i'!Dt!`Dt!`Dt!`iy!Dt!`Dt!`Dt!`iɋ!Dt!Dt!Dt!i!Dt!Dt!Dt!i!Dt!Dt!Dt!iB!Dt!Dt!Dt!i)!Dt!Dt!Dt!iA!Dt!Dt!Dt!ivM>!Dt!Dt!Dt!i g!Dt"Dt"Dt"a!Dt"Dt"Dt"z!Dt"Dt"Dt"嫺!Dt"Dt"Dt"#!Dt"Dt"Dt"u=!Dt"Dt"Dt"!Dt"Dt"Dt"j!Dt"Dt"Dt"-$p!Dt"Dt"Dt"f-!Dt"Dt"Dt"!Dt#*Dt#*Dt#* !Dt#*Dt#*Dt#*!Dt#*Dt#*Dt#*w!Dt#*Dt#*Dt#*n !Dt#*Dt#*Dt#*V{E!Dt#*Dt#*Dt#*kHK!Dt#*Dt#*Dt#*S!Dt#*Dt#*Dt#* /|!Dt#*Dt#*Dt#* !Dt#*Dt#*Dt#* !Dt#FDt#FDt#F Oyo!Dt#FDt#FDt#F Z:!Dt#FDt#FDt#F Q7!Dt#FDt#FDt#F u!Dt#FDt#FDt#F 5!Dt#FDt#FDt#F !Dt#FDt#FDt#F x!Dt#FDt#FDt#F қ!Dt#FDt#FDt#Fks!Dt#FDt#FDt#FԽ!Dt$[܀Dt$[܀Dt$[܀cc8R!Dt$[܀Dt$[܀Dt$[܀J?z!Dt$[܀Dt$[܀Dt$[܀!Dt$[܀Dt$[܀Dt$[܀4!Dt$[܀Dt$[܀Dt$[܀y!Dt$[܀Dt$[܀Dt$[܀!Dt$[܀Dt$[܀Dt$[܀?!Dt$[܀Dt$[܀Dt$[܀ܪo&!Dt$[܀Dt$[܀Dt$[܀((!Dt$[܀Dt$[܀Dt$[܀!Dt$sDt$sDt$sF&M!Dt$sDt$sDt$s|!Dt$sDt$sDt$sw?!Dt$sDt$sDt$s2 !Dt$sDt$sDt$sfK!Dt$sDt$sDt$sQ!Dt$sDt$sDt$s!(a"!Dt$sDt$sDt$s!Dt$sDt$sDt$sW*!Dt$sDt$sDt$sr!Dt$sDt$sDt$snw!Dt% Dt% Dt% R/a!Dt% Dt% Dt% '"!Dt% Dt% Dt% !Dt% Dt% Dt% cە!Dt% Dt% Dt% !Dt% Dt% Dt% Vm!Dt% Dt% Dt% 5k^R!Dt% Dt% Dt% v!Dt% Dt% Dt% "GK!Dt% Dt% Dt% e+p!Dt&%Dt&%Dt&%q^3!Dt&%Dt&%Dt&%2!Dt&%Dt&%Dt&%*c!Dt&%Dt&%Dt&% v%!Dt&%Dt&%Dt&% J !Dt&%Dt&%Dt&%!I!Y!Dt&%Dt&%Dt&%!Ϸ !Dt&%Dt&%Dt&%"8d!Dt&%Dt&%Dt&%"yz!Dt&6Dt&6Dt&6#̍!Dt&6Dt&6Dt&6#A "!Dt&6Dt&6Dt&6$z|!Dt&6Dt&6Dt&6$N!Dt&6Dt&6Dt&6% !Dt&6Dt&6Dt&6%ĩ!Dt&6Dt&6Dt&6&<!Dt&6Dt&6Dt&6&b!Dt&6Dt&6Dt&6'藋!Dt&6Dt&6Dt&6'v8b!Dt&6Dt&6Dt&6(H^f!Dt'VDt'VDt'V(P!Dt'VDt'VDt'V)H+!Dt'VDt'VDt'V)wW!Dt'VDt'VDt'V*[l!Dt'VDt'VDt'V*Z{!Dt'VDt'VDt'V+ή!Dt'VDt'VDt'V+t-!Dt'VDt'VDt'V,\!Dt'VDt'VDt'V,ώ!Dt'VDt'VDt'V-h(!Dt'cDt'cDt'c-Y!Dt'cDt'cDt'c.!Dt'cDt'cDt'c.jsS!Dt'cDt'cDt'c/˒!Dt'cDt'cDt'c/l!Dt'cDt'cDt'c0jAM!Dt'cDt'cDt'c0F!Dt'cDt'cDt'c1ڴ;!Dt'cDt'cDt'c1y*8!Dt'cDt'cDt'c2'P"T!Dt'cDt'cDt'c2A!Dt(Dt(Dt(39!Dt(Dt(Dt(37!Dt(Dt(Dt(4 !Dt(Dt(Dt(40!Dt(Dt(Dt(5kʡV!Dt(Dt(Dt(5Ҷ!Dt(Dt(Dt(6EH!Dt(Dt(Dt(6.Q!Dt(Dt(Dt(74>!Dt(Dt(Dt(7!Dt) Dt) Dt) 8jM!Dt) Dt) Dt) 8oÎ!Dt) Dt) Dt) 9ˢ>!Dt) Dt) Dt) 9#!Dt) Dt) Dt) :9p\Z!Dt) Dt) Dt) :*V!Dt) Dt) Dt) ;D!Dt) Dt) Dt) ;c!Dt) Dt) Dt) <ѣx !Dt) Dt) Dt) <ZU!Dt) Dt) Dt) =v!Dt)'Dt)'Dt)'=uaDt)'Dt)'Dt>EUaDt)'Dt)'Dt>gaDt)'Dt)'Dt>!Dt)'Dt)'Dtׄ6ް=9!Dt)'Dt)'Dtׄ6'Ϗi!Dt)'Dt)'Dtׄ6^aDt)'Dt)'DtׄK2aDt)'Dt)'DtׄDHaDt*QDt*QDtׄ*!Dt*QDt*QDtׄ6l!Dt*QDt*QDtׄ6:j%!Dt*QDt*QDtׄ6C!DtbZDtbZDty$89!DtbZDtbZDty!DtbZDtbZDtyi!DtbZDtbZDty^5!DtbZDtbZDty!DtbZDtbZDtu}!DtbZDtbZDt' XDBu!DtDtDtX; 6Bu!DtDtDt ! -PBu!DtDtDt S+ >Bu!DtDtDt  *Bu!DtDtDtN XBu!DtDtDt߀ ѪBu!DtDtDtI b~xBu!DtDtDt}J!DtDtDtP&x!DtDtDtP!DtDtDtPkP!DtDtDtP3vG!DtDtDtO'ZU!DtDtDtOVC!DtDtDtOs!DtDtDtO9DF0!DtDtDtQ V5!DtDtDtQ\!DtDtDtN'q!DtDtDtNt!Dt,Dt,Dt,Nic1!Dt,Dt,Dt,N4!Dt,Dt,Dt,Nw3!Dt,Dt,Dt,NX!Dt,Dt,Dt,Nn!Dt,Dt,Dt,Nr!Dt,Dt,Dt,NBň!Dt,Dt,Dt,N(!Dt,Dt,Dt,N !DtĴDtĴDtĴN "!DtĴDtĴDtĴN !DtĴDtĴDtĴN3;!DtĴDtĴDtĴN68!DtĴDtĴDtĴN!DtĴDtĴDtĴN;Kd!DtĴDtĴDtĴN.!DtĴDtĴDtĴN la!DtĴDtĴDtĴNWQx!DtĴDtĴDtĴN5 !Dt]JDt]JDt]JN&!Dt]JDt]JDt]JN!V(w!Dt]JDt]JDt]JN /c!Dt]JDt]JDt]JN - !Dt]JDt]JDt]JN R!Dt]JDt]JDt]JN2% !Dt]JDt]JDt]JNs4!Dt]JDt]JDt]JN3D!Dt]JDt]JDt]JNQ!Dt]JDt]JDt]JNCQ5!DtDtDtNnN!DtDtDtN@!DtDtDtNeg!DtDtDtNCNg!DtDtDtNY$=!DtDtDtN MKm!DtDtDtN jrO!DtDtDtN B!DtDtDtN%!DtDtDtN!!DtDtDtNPp!DtwDtwDtwNփ!DtwDtwDtwNM̝!DtwDtwDtwN!DtwDtwDtwNB&|C!DtwDtwDtwN!DtwDtwDtwN趨!DtwDtwDtwN!DtwDtwDtwN WW!DtwDtwDtwN `­!DtwDtwDtwN !DtwDtwDtwEU>!DtwDtwDtwEF=!Dt'Dt'Dt'EN!Dt'Dt'Dt'E?n!Dt'Dt'Dtxy;!Dt'Dt'Dt'wR{!Dt'Dt'Dt'wy.!Dt'Dt'Dt'w!Dt'Dt'Dt'wRT!Dt'Dt'Dt'w@7!Dt'Dt'Dt>p'<=!Dt'Dt'Dtp$6֥Bu!Dt'Dt'Dt9$,qBu!DtDtDtk $">Bu!DtDtDt4΀${6GBu!DtDtDte$ʋoBu!DtDtDt /$I:Bu!DtDtDt!`$QtBu!DtDtDt#*$Bu!DtDtDt=5H!DtDtDtT#!DtDtDt;!DtDtDt2WCaDtX;DtX;Dt  !DtX;DtX;DtG*saDtX;DtX;DtG q!DtX;DtX;DtG*䜴aDtX;DtX;DtG ]!DtX;DtX;DtG*NaDtX;DtX;DtG 1l!DtX;DtX;DtG*J;aDtX;DtX;DtG E|.!DtX;DtX;DtG*aDtX;DtX;DtG 1!DtрDtрDtG*/cJaDtрDtрDtG E!!DtрDtрDtG*aDtрDtрDtG /#!DtрDtрDtG*,1oaDtрDtрDtG  x.!DtрDtрDtG*V>aDtрDtрDtG Ӷ!DtрDtрDtG* %aDtрDtрDtG N!Dt hDt hDtG* aZaDt hDt hDtG !Dt hDt hDtG* - aDt hDt hDtG pڀE!Dt hDt hDtG* GaDt hDt hDtG M^!Dt hDt hDtG* IaDt hDt hDtG U!Dt hDt hDtG*dz"oaDt hDt hDtG Kq!Dt !Dt !DtG*giaDt !Dt !DtG !Dt !Dt !DtG*aDt Dt Dt9 k!Dt Dt Dt9*0=aDt Dt Dt9 Ͷa!Dt Dt Dt9* ›> aDt Dt Dt9 !~if!Dt Dt Dt9*!ܖaDt Dt Dt9 "++!Dt Dt Dtt*"%aDt XDt XDtt #e!Dt XDt XDtt*#R\aDt XDt XDtt $!Dt XDt XDtt*$paDt XDt XDtt %=!Dt XDt XDtt*%8MaDt XDt XDtt &E'!Dt XDt XDtt*&hSaDt XDt XDtt 'd!Dt XDt XDtt*'*aDt XDt XDtt (,0P!Dt Dt Dtt*(k2`aDt Dt Dtt )ۛA!Dt Dt Dtt*)z9aDt Dt Dtt *=!Dt Dt Dtt**vHkaDt Dt Dtt +?!Dt Dt Dtt*+W]aDt Dt Dtt ,ݗ!Dt Dt Dtt*,*&aDt Dt Dtt -K9!Dt Dt Dtt*-RIaDt Dt Dtt .E!Dt Dt Dtt*._aDt Dt Dtt /'!Dt Dt Dtt*/maDtNDtNDtt 0!DtNDtNDtt*0ZaDtNDtNDtt 1E8!DtNDtNDtt*1.aDtNDtNDtt 2W(!DtNDtNDtt*2aDtNDtNDtt 34P!DtNDtNDtk *3C.:aDtNDtNDtk 4@!DtNDtNDtk *4BaDtNDtNDtk 5_7m!Dt沀Dt沀Dtk *5DoaDt沀Dt沀Dtk 6 %!Dt沀Dt沀Dtk *6AaDt沀Dt沀Dtk 7 _!Dt沀Dt沀Dtk *7LaDt沀Dt沀Dtk 8=2!Dt沀Dt沀Dtk *8"yaDt沀Dt沀Dtk 9}'!Dt沀Dt沀Dtk *90waDt沀Dt沀Dtk :J!!DtIDtIDtk *:=QaDtIDtIDtk ;I4!DtIDtIDtk *;aՒFaDtIDtIDtk <Ǯ!DtIDtIDtk *<aDtIDtIDtk =ΰ=!DtIDtIDtk *=-aDtIDtIDtk >Pד*!DtIDtIDtk *>؀jaDtIDtIDtk ?P!Dt߀Dt߀Dtk *?O25aDtI DtI Dtk }!DtI DtI Dtk {88aDtDtDtk u!Dtz9Dtz9Dtk {yNjaDtDtDtk L]!DtfDtfDtk {̞IaDtCDtCDtk ʁH8!DtCDtCDtk {1GaDtܓDtܓDtk [13!Dtu*Dtu*Dtk {%aDt Dt Dtk R!DtWDtWDt{OBaDt>Dt>Dt]!Dt>Dt>Dt{aDtׄDtׄDt0Y!DtpDtpDt{aDtDtDt!DtGDtGDt{WaDt9Dt9Dt -!Dt9Dt9Dt{ aDttDttDt :B!Dtk Dtk Dt{ iaDtDtDt Ȑ/!Dt8Dt8Dt{  aDt4΀Dt4΀Dt P!DteDteDt{ bLaDteDteDt /f !DteDteDt{ MŮaDtDtDt;O,!Dt(Dt(Dt{0aDt /Dt /Dt7. ,!Dt UDt UDt{%daDt UDt UDtw?n!Dt!`Dt!`Dt{paDt!Dt!DtQ !Dt"Dt"Dt{{taDt#*Dt#*Dtpf%!Dt#FDt#FDt{k`aDt#FDt#FDtY6B!Dt$[܀Dt$[܀Dt{waDt$sDt$sDt;!Dt% Dt% Dt{nBaDt&%Dt&%Dt"!Dt&6Dt&6Dt{aDt&6Dt&6Dt8퟾!Dt'VDt'VDt8{ճaDt'cDt'cDt8z-!Dt(Dt(Dt8{ւaDt) Dt) Dt8" H!Dt)'Dt)'Dt8{(79aDt)'Dt)'Dt8Dn!Dt*QDt*QDt8{aDt*TDt*TDt8<!Dt+Dt+Dt8{ekaDt,Dt,Dt87!Dt,Dt,Dt8{2*aDt,Dt,Dt87!Dt-LDt-LDt8{4aDt-DDt-DDt86!Dt.}Dt.}Dt8{o_aDt/qDt/qDt8&!Dt/Dt/Dt8{'aDt/Dt/Dt81"!Dt0GDt0GDt8{jVRaDt0GDt0GDt8 !2!Dt0GDt0GDt8{ zrGaDt0GDt0GDt8!!Dt0GDt0GDt8{!DaDt0GDt0GDt8">J!Dt0GDt0GDt8{"lQ?BaDt0GDt0GDt8#E!Dt0GDt0GDt8{#daDt05Dt05Dt8$34!Dt05Dt05Dt8{$aDt05Dt05Dt8%iP&%!Dt05Dt05Dt8{%d-ԁaDt05Dt05Dt8&D+d!Dt05Dt05Dt8{&0MaDt05Dt05Dt4΀'!Dt05Dt05Dt4΀{'IaDt05Dt05Dt4΀(Z=n!Dt05Dt05Dt4΀{((FaDt1xˀDt1xˀDt4΀)8^*!Dt1xˀDt1xˀDt4΀{)@laDt1xˀDt1xˀDt4΀*&!Dt1xˀDt1xˀDt4΀{*>aDt1xˀDt1xˀDt4΀+!Dt1xˀDt1xˀDt4΀{+թaDt1xˀDt1xˀDt4΀,+k!Dt1xˀDt1xˀDt4΀{,80YaDt1xˀDt1xˀDt4΀-Wq0!Dt1xˀDt1xˀDt4΀{-RaDt2bDt2bDt4΀.k!Dt2bDt2bDt4΀{.ɾaDt2bDt2bDt4΀/y̯i!Dt2bDt2bDt4΀{/jaDt2bDt2bDt4΀0|!Dt2bDt2bDt4΀{0"daDt2bDt2bDt4΀1FME!Dt2bDt2bDt4΀{1jiaDt2bDt2bDt4΀2g*$!Dt2bDt2bDt4΀{2{nLaDt2Dt2Dt4΀3D1*!Dt2Dt2Dt4΀{3ZdaDt2Dt2Dt4΀4P!Dt2Dt2Dt4΀{48aDt2Dt2Dt4΀5!Dt2Dt2Dt4΀{5OaDt2Dt2Dt4΀6#+.!Dt2Dt2Dt4΀{6_uraDt2Dt2Dt4΀7JUi{!Dt2Dt2Dt4΀{7ڮ'aDt3BDt3BDt4΀8R!Dt3BDt3BDte{8aDt3BDt3BDte9*f!Dt3BDt3BDte{9yaDt3BDt3BDte:׎!Dt3BDt3BDte{:c|aDt3BDt3BDte;pP%!Dt3BDt3BDte{;=2'aDt3BDt3BDte<!Dt3BDt3BDte{<WaDt3%Dt3%Dte=NO!Dt3%Dt3%Dte{=daDt3%Dt3%Dte>Y!Dt3%Dt3%Dte{>~[aDt3%Dt3%Dte?/!Dt3%Dt3%Dte{??!Dt3%Dt3%Dt3%:!Dt3%Dt3%Dt3%j)!Dt3%Dt3%Dt$[܀".!Dt3%Dt3%Dt% }9!Dt4sDt4sDt4s L!Dt4sDt4sDt4s dO!Dt4sDt4sDt4syk!Dt4sDt4sDt4s !Dt4sDt4sDt4ss!Dt4sDt4sDt&6zn!Dt4sDt4sDt'cLl!Dt4sDt4sDt4s0!Dt4sDt4sDt)  V(!Dt4sDt4sDt*QFRaDt5 RDt5 RDte (!Dt5 RDt5 RDteaDt5 RDt5 RDte  !Dt5 RDt5 RDteaDt5 RDt5 RDte MU!Dt5 RDt5 RDtenUaDt5 RDt5 RDte ;!Dt5 RDt5 RDteyaDt5 RDt5 RDte f,~!Dt5 RDt5 RDteʩ/]aDt5Dt5Dte n!Dt5Dt5Dte6`aDt5Dt5Dte !Dt5Dt5Dte_C%aDt5Dt5Dte ;]8!Dt5Dt5DtetK!Dt5Dt5Dt5"O!Dt5Dt5Dt5!I!Dt5Dt5Dt5V8!Dt5Dt5Dt5*+!Dt5Dt5Dt5#Zz!Dt6=Dt6=Dt6=1+!Dt6=Dt6=Dt6=]E!Dt6=Dt6=Dt6=Gҹ!Dt6=Dt6=Dt6=M~!Dt6=Dt6=Dt6= }U!Dt6=Dt6=Dt6= ]w!!Dt6=Dt6=Dt6= =)y!Dt6=Dt6=Dt6= !Dt6=Dt6=Dt6= Xt!Dt6=Dt6=Dt6=dt!Dt6=Dt6=Dt6=J!Dt6Dt6Dt6>!Dt6Dt6Dt6;Y>!Dt6Dt6Dt6=Й!Dt6Dt6Dt6t!Dt6Dt6Dt6-ʿ!Dt6Dt6Dt6O!Dt6Dt6Dt66S!Dt6Dt6Dt6m!Dt6Dt6Dt6,!Dt6Dt6Dt6^஧!Dt6Dt6Dt61!Dt7nDt7nDt7n#!Dt7nDt7nDt7n#[!Dt7nDt7nDt7n2HZ!Dt7nDt7nDt7ny!Dt7nDt7nDt7nC!Dt7nDt7nDt7n В'!Dt7nDt7nDt7n!+3!Dt7nDt7nDt7n"qk!Dt7nDt7nDt7n#!Dt8CDt8CDt8C$2|!Dt8CDt8CDt8C%!Dt8CDt8CDt8C&[!Dt8CDt8CDt8C'S!Dt8CDt8CDt8C(S&4!Dt8CDt8CDt8C)9!Dt8CDt8CDt8C*rv~!Dt8CDt8CDt8C+dG!Dt8CDt8CDt8C,-h!Dt8CDt8CDt8C-7Qx!Dt8ـDt8ـDt8ـ.9!Dt8ـDt8ـDt8ـ/]k!Dt8ـDt8ـDt8ـ05S!Dt8ـDt8ـDt8ـ1i!Dt8ـDt8ـDt8ـ23!Dt8ـDt8ـDt8ـ3K!Dt8ـDt8ـDt8ـ4!Dt8ـDt8ـDt8ـ5)!Dt8ـDt8ـDt8ـ6/!Dt98pDt98pDt98p7ҕ!Dt98pDt98pDt98p8T5S!Dt98pDt98pDt98p9$!Dt98pDt98pDt98p:)!Dt98pDt98pDt98p;q8!Dt98pDt98pDt98p<,n'!Dt98pDt98pDt98p=C!Dt98pDt98pDt98p>!Dt98pDt98pDt98p?f08!Dt:iDt:iDt:iss0Dt;3Dt;3Dt;3ss1R-Dtz9Dtz9Dtz9audio0zrɦDtDtDtmixer0nADtCDtCDtCsound0 DtܓDtܓDtܓaudioctl0x±mD]D<{Dt`hpxn%k<*m&WD]D<{Dt^!/׊DteDt$[܀Dt$[܀ (rhkBDt,DtĴDtĴ"PTDtDt hDt h/tmp/disktab.shadowutDt S+Dt Dt /tmp/fstab.shadowp_.Dt沀DtvDtv/tmp/resolv.conf.shadow w Dtz9Dt Dt /tmp/hostsn"SDtpDtpDtp& ذDt+Dt05Dt3%Dt8CDt1-Dt1-GxmDtĴDtDtn}!_>wy2;~%C:/ kH+=C(RaN$&& eJtN6ԛ GGy3 H0nd^(YՏ1lDrV OiB7e0u?r)QYSxO  . .. catchmodchgrp cp4 ddD dfP ed\exprhostname+g ksh sh ln lsmkdirD mt mv pax tarcpio rmsttysyncElite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163:  . .. pppfirmwaregroupspwd.db protocols;services6disktab.shadow disktab fstab resolv.conf4 hosts ... ... ... ... . .. bin dev etc mnt mnt2L sbinL tmp usrvarinstbin.profile<upgradeinstall  install.sub bsd install.mdboot . ..chowndmesgfsckfsck_ffs+gifconfig+ginitmknodmount mount_cd96608 mount_udfg mount_ffsg mount_nfsgnewfs  mount_mfsgpingping6reboothaltroutertsolumount disklabelgdhclient+gPdhclient-script ... . .. binmdecsbinshare . .. ftpgzipgunzipgzcat sedgrepegrepfgrepless`morep . ..bootbootxxbinstall:( installboot . .. installboot . ..miscTkeymaps . ..termcap ... . .. tmp db runempty . ..! tmp ... ... ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: dialer:*:117: nogroup:*:32766: nobody:*:32767: ELF`404 (UUU!U!U@4@4@XXddtt {x444OpenBSD㿠@ @D* @ +#@㿘"#@ `'"  @, / &@ &J `  *"J` c&*#@_@<*`:` J " 㿘& ? `     , `2 ?, ਠ??@@??㿘& `    㿘     && `"U@!㿘 `  "`㿘@ J 2@@6@@{ /  @  `"@  2     %UUa@ "@㿘 ?@?`Ŕ㿘 %UUaȔ@ w" `  ` )U+U@ f@  O4@ d"@@ _b`@ @ W"@w 㿘@]㿈'&")&" !"` B%&@`Ѐ $`Va8@. @s = 2,V`ВaH@$  L `V`Вa`@ V'B `0!@  &VaH@    "Va@  €# ذ  $!& ؀`@"@ $  ؀` @V@9U! `&Va@Ր !T &Va@͐ !XC"C"#"@!C "C"&$ "aXVb@ &!T  Va@ C!&"aX V! `2 Vb8@  #@?   $  #@?    $  Vb @m?㿘@@㿘@R&&"`"(㿘@I&"aT㿘@B& "aP?"aP㿘@7 "c 㿘& ؀ @+&"`& 㿘& ؀ @&"a(& 0㿘@l&:8㿘@e&:㿘Vb@ 㿐@ޔ ?2& Vb@8P 2J& Vb@ `k`m`b". `w . . .  'J`x 4&``*2& @:@` "&`ЖVb@  Vb@ 㿐 @     & Vb@7 2K& Vb@  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @! 'J`x 4!&`#`*2&  @ @@ "&`ЖVb@?  Vb@: 㿘&!\ &    "@    `*&!& ``$   $ @$   $`$`&耠& 㿘V bb@ 㿘V bb@ 㿘V b`@ 㿘V b`@ 㿘@ Fc@g FcD@c F@ &!P? 3 @c ?`&c @@ 㿘%&   V"$  $ @ $ V c@7 @ #    )&Vc@ )&! #&V#8 $ $$ `'"& @! $ `؀"& @! $ `$ !` #&` V@6Òc#&@ga'& @2a ` @ؐ? $Vc@@6 $a !&!T  @Ɛ  $a !T@@ $aVcP@6 &  aa`$"`$ ` " @b  $@@ x    @ה    @ "@&Vc`@ !@G’  @"P XV c@6O <     a@     @ ?  @n   & 㿘&!P &!`!`` %&@ @  &  @  '&&   @ '&  @   z$ 63 ؀$2VV c@5 # @s~@        @+ @ @sj@&&" !`@  "#!`   &$ `@  $ "`@ $  $  $ &a`` "`& ؀` !&  &"! @d y$ @@& &a`` "` @&``&` X"`]&㿘&!XC!̀@C&"@C$ &"Ȁ@&*& !&!`&@  " @ !@ !`"`&! @ 㿘&! !``   H# ` &Ԁ 2 `` V"@5H#` "$` V@ʒc'& @64 &V cx@ @m{  V c@4 &`  > B;  @2   # !&!  " &   #   !@ -"@ !  & - %X'@F/ &!!X" 'X\"@`'\А"@@'X'\XW W?00 \ DB F?0 ?0 `V d#\@<8@I'8 `$`W W W d@- %@@2$ '&``  (W W `W( d@k- 8"@<$ \@##\``- @W` BXW@ d0 ¨ @I;`8<@$@$@J  W@ 㿘@l^@l"㿘V@! 㿘)&  2   @~    @\ ?A?W`@4  6  @  "  D?D? & c ?"c W`@  ؀$ `ـW@qh  рW`@3ΐ 㿐'&    @'    @ ?vtW`@3  $ '7a@ cW`@3    X$ T@ 4A`6W`@3   7 'a@?W`@3u ` D 4,$ (@4 W`@3[ ` D 4$ 0  D 4$㿘@5 X X X X X X X X X X X X X X X X X X X P X X X X X X X X X X X X X X X X X X  X ( X X 0 X X X X 8 %! ''|-G+)W|'W5 $7W 0* @€    `Ȓ @Q @C@D؀??\* & @ @4@@p` |W`a@2Ɛ ? '' '| ''|'@ @k$`-WWa@Y b @2 @~ 㿘 %Wb8@V"@v 㿐@  ' @2 @ `@Ր㿐 !W ~@n"p "L@ " n L` o `@[ = ", `"@ː 2  .W @ @ @`WW""Wbx@  2 &*@ &" b@Ґ  "&&@ @E # W2&@@j{`"2 &@WbД@ &@ 㿘@)%T%%%%%%%%%%%%%%%%%%%%%%%%% %%,%<%%H%%%%%%` /I#/!/%/9/-/;/+ )'W*7W $%* (@€ $a$! $ $!$a '! % 'aaH Wb@L @ @S@BД耢?Ӑ? $#\*@` & a W@1c @<@   2@Wc@@1s  !@Y@Ɛ@ `R' @@  @m@ @@np=`< @ @2 @@@@ 2-`%a@@ !!  @W@@1Tx`@X D 2 aWc@@1FD` @@np`@    @`  @ 4?a` $ a @@@ΐ`?㿐@ Z  @6  @ ` T@! 㿘 !H  a`?  #&@    2a@ 㿘 WN  nWc@Z  &N  o&& "a "! %   @捒 , ` @*  $H @0 $@ , `$@  @v , 2*@, $@㿘/!` !H` /!` @ ϒ ., ' D! @"!x /!`@! T@a!!㿐@ݗ?WW#Ȓ@l̔0#@lȒ㿘 :  @|  : @t     ; @k;`㿐W  @l# /   " !ВG   @ @ 3@   @ +@  ` @ @ @ ϐ @ @ ` @ @ @   @ @  W#@lN 'X(B?@ՒX 0 BX 0?W #@l1 /a )X  "' X(B'X(B X0 BX 0 X? @lX@l X @k T㿐/!`X 8@'XX @h@k//!` X x$'@'@ XX h@kє/!`"XX@kɐ X@kƐ Ȁ` !x/!`X $X "XX h@k`n T ` ``" 2'@  ?X'!X ‰ F?@`X!0` @6 `@ (@ ` ` `@ @` ` @6 `@ @  #\`@ @Ӑ#\`  @  @ @ ` #` @ @`#`#l#d#h@k;a!a㿘@ ?W@l#p?@C @  @ K㿘 @ꯒ@~" @f` 4 @f@ښ %X"ؒa`@ 㿘  X %ap@"@ 㿘!& ! D?!%\F!T@"&;? 4& 0& (&  8@<  ̘ d & < (#  ; @w<  @ޖ d$"@& @' ,?& Ȑ&& &$ X!T@L Z@H ZXDa@  㿘+. $ay$ O?a 8;#S@2H? L (&B? $*& 4 * &@  (   $@ Ɛ4 ?@ `@Ր$&  & "@ &a& & &&$ X!T@ Z@ ZXDa@㕔  㿘@=8(8(7 8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(78(8(78(7,8(8(8(8(8(8(8(8(7T8(8(7l8(7777㻀 %!X''  ;X%+ 5X9/)X7XS 8NM* @€ 'G  /C"ac@n =3J@ 40,X@] ,"bl Xc@ @Ƞ@@H   '!@<#H  #H@ @T@>)?? $c\ * &@ `   0bl08䀠 .`? @  @#H X @P @u  X @X @'    @&  " @ X@  Xc`@,  @D D "@!@] bl "@@@j @X@cp@,o @ 6@ 'X@c@ @X@y  @ T X@c@ @o  Xc@,B  D& `&@@& ) T@  X@w XX@c@ِ  @E "  @?#H  X @9P " X@c@      2`Y@@ Y @@ 2`@  @n@R(@ #Y`Y@]0 Y 8@m!耢 耢 @f ? @d=`Y`@@+ @ @㿐  @, '%Y@f@`?@h/X  2@㿘 bp  bp@"   J@ " @  @ %!H'@i  X#pX" O X#HX"@֐@xY`x@|  `5X@ .@g@*(@H Y`@+A @v Z @o  /!`YY `@gЖ  @I!  Xc@+ 'DD <@R&D/* &   ᰑ* &*& 'DY@g D  6 Y!Y.  @g D . Y@g @D@Bs @ )`  00Y@hp @2c H##Y;Y@`$@Ӑ&@f@c>``@hT`@ 2@@c0`Y!@hF@ @@@@gL @Y@h6!(+  `:  a0# ` /@ Y!0@* /!`H@ Y @h a@  a Y@ʐ!8` %!'Y  T !@@g  D/>a *    YYX!Xa`H@f  "p` D#3Y"p `/Y-Y+Y@`  2 X`ah@f ,@`  뀌@`!YY!`!h@Y!X"Y!p@f!   4'̒@Y!@f/`@# ?Y!Y!`Y!h ""YY!!Y@f!X  @  YY!`!h@f!X YY!`!h YY!!@fm!X  "!YY!`!hY@f]!X  " YY!`!hY@fL!X  @" YY!`!hY@f<!X  !YY!`!hY!X@f,! 2 @!YY!`!hYY !@f! 2 $@!YY!`!hYY $!@e! 2 (@!YY!`!hYY (!@e! 2 , !YY!`!hYY ,!@eє! 2 0 !YY!`!hYY 0!@e! 2 4 !YY!`!hYY 4!@e! 2 8 !YY!`!hYY 8!@e(! hYY!`!h HYY8@e}!!Y LYbP@ew"H PYb`@er"HY T"H@embpHb@ Y@ĤY!`Y!h@!xYY"@eN)b@ 7Y!  ! l 2 p !YY!`!hYYY l" p@e)"! 2 t!YY!`!hYY t"@eb@ކ Y!  ! l 2 p !YY!`!hYYY l" p@d"! 2 t!" xYY!`!hYY t"@dؔ x " xYY!`!hYY!X@dǔ x " xYY!`!hYY!X@d x " xYY!`!hYY!X@d x " xYY!`!hYY!X@d x mYY!`!hYY!X@d^c@ 8Y! l  YY!`!hYY!X@di l " lYY!`!hYY!X@dX  l 1YY!`!hYY!X@dG("@ݺc0 ! !Y!@d7#8  YY!`!hYY!X@d&HY#PY @d Y@Đ#X㿐@Ԓ  @6  @|  @u T `@! 㿘 "l  a`?  #/@m    2a@ 㿘 YN  nYc`@ ΐ  /N  o// "a "! %   @ , ` @(*  $l @& $@ , `$@  @ , 2*@, $@㿘 L@ @@ @ Y @&Ӓ p@Ж0@>@㿐Y'@#x1Y  -, , & @ܬ =   , *& , & & @c( X 2J&@㿘 %YYYYZc#` @I"@i 㿘 Y@ܧ`  Y@` 26 @А "0 @ܖ  *Z @ܐ`@ 2 Xb@܉ 2 Z@& H Y@}b 2  Xb@v "   Z @&r  㿘@㿘@_r 㿘@㿘@Q@㿀Z'T`'  @ 2Zb  @u 2] `&` 2 NZ"h@&.@NN u2 NZb@ "  N <2  Zb@  `( 4*@  @ `Z" @&@#J`Z"@%@ `(* N ^N `(`? `-   * `(*  &`  㿘 ZZb@_ c@\ 㿘 Z#0 @bK Z` `%Z  ` @ @b>  2 @_@ZZ#h@b0㿐'H@y : 'HȐ H+Z 'H/Z-Z@k = 2,@,@`@:pN@ c Zc@ۀ 2N@s&  i2 N@Zc@s 2N@f& i2N@Zc@f 2 N@c@:GU& $ l2 N@Zc@U 2N@H& o2 N@Zc@H 2N@;&  oZZc@;  Zc@:*& ( `  'Z N@J@2  @" 2  ? @9  , 2 H5H  H@ai〲 N@ i㿘@@㿈@L@ -2&` &`` V` ' @ 2 # 2  ` [ @$ג@  "  & &`[ @$ƒ@ @ 㿘   D@u 㿘  " $@0 " `  & & & & $㿘@  & 6 F $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@7 㿐    ``'@粔   '``@窔 & 㿘 @ @^k &  @$**@"" "$@$   """$ "     " "  " 㿘 @g @^  & 㿘  @0 @$  ?` # & & 㿘@I  & 6 D   $g`  ˒  " " " " $" 㿘[ F @`j D㿘@ [@`a Ё㿐 `'@ [`@# 㿘@ `n [`@# 㿘@`o [`@# 㿘[a a @٢ 2    ` *@&`   &` U&`  2[#t`#t @و 2    `*@&`  &` ;&` 2\"8`"8 @n 2    `$*@&`$  &` !&`$ 2]"`" @T 2    `*@&`  &` &` 2  %!'' "^" ^^"^^@_ @@_ P^@_ ` @_ p @_@]@ ^ @_^ @_^`@@_ " ^@_z  ^@ ! 4 ^ `@@  4 ^ `@@$ 4 ^ `@@  4 ^! `@@  4 ^! `@@  4 ^! `@~@ ^! @t@  4 ^! `@i@ @ 4 ^!( `@^@  4 ^!8 `@S@" 4 ^!H `@H@ ^!X4 @>@4 ^!` `@2@4  ^!h `@&@4 ^!p `@@4 ^!x `@@( 4 ^! `@@4 @"^! `@@^@!  4 ^! `@@! 4 ^! `@ݐ@ @ 4 ^! `@Ґ@  4 ^! `@ǐ@4 ^!Ȓ `@@" 4 ^!В `@@$ 4 ^!ؒ `@@( 4 ^! `@@4  4 ^! `@@ ^! @@  4 ^" `@x@  4 ^" `@m@  4 ^" `@b@ "  4 ^" `@W@ ^@F"  ^"( @I@  4 ^"0 `@>@  4 ^"8 `@3@ @ 4 ^"@ `@(@  4 ^"H `@@  4 ^"P `@@  4 ^"X `@@ "  4 ^"` `@@ ^@"h(2 #4 ^"p `@@ #!"^"  4 ^#4 ^^@ِ"x4 @Ր" 4 ^@А"4 ^@ː"4 ^" `@Ő@4 ^" `@@4  4 ^" `@@4  ^" `@@$ 4 ^" `@@4 @^" `@@4 ^"В `@}@" ^@j"Z ` %^` @@ d@u@c` @ 2`@O D@K Z  `2 ^^"b d,`` " ` @%@M`  @^@B 2 ` @\ @\ݐ` @ ؀!^@\Ґ""@\ϒ  ^@v#㿘!/! ^@\ $!/"!ā㿘!/!  /!Ĕ^@\#$!@!@`H ^^@\#^#@\ $!@\# !@$!㿘 ?  1/^!(@ &!/1^ #0 ! M.! -*  ^* ? *4* ^*@**!@ %! $'H'"X '% $'H@@0?2 e"  f a \+ g\% ! @柒  '^ ȒcH@  \@H*` ^@Ykc8\H*`@' ^\H* @)'H ^cP@ `@Ɣ ^c`@U `h@⻔ `^@\ܐ#p` `H H` HHH''@ OH +^S =H 7H 1HJ@? &`   `  H@l@@Y@Y3'Hc@/  Hl`'^@#@/H 'H   @  ^c@Ґ    `g@4 ^@\U# ^@# 㿘  ^ %c@n"@ 㿘@2rHrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrTrxr`rxrxrxrxrxr`rxrxrxrxrl(+\)/'/%/!/#_/ $5/9W7 -* a@@€  %!̐  $Ȑ $А $!@@/`??\!ؓ* @ &  "  . " `. @_@`@- @ @(@@ ?@vL _`@ <  "@@@  @@  `@@@ /! %a '/@v  _d /!̀`/<  2 /@VZ "_P !Ѐ`i#Ӕ t€ '/<   /@E _0 #_$`@#( @V(  ?"`@[?"/!Ȁ`/@[  /@V`2 _/!Ԓ€ _ @[!   _@ݐ 㿘  _ % `@6"@V 㿘@OzTzz{d||8y@y@y@y@y@y@xhy@y@y@y@y@y@y@y@wy@y@y@wy@y@y@y@wy@y@y@y@y@y@y@y@y@y@y@x$x4xDxy@y@y@y@y@y@y@y y@xy@xy@xy@y0x$$$$$$$㿈 '/! -9+9#'A599_/A)87_q;8 8l]* 8@€ T  @  $ T_' T  @  V$ T T  @   'K$ T  G% `$ C%`$ T  @  :$ T T  @  1$ T`.'0 *$0 && T  @  $ T`Ȑ#H@ҷJ `J `" @ `  /8 %8" %"@ }@-0?? $#\ T*@`&  $ T 0  `$    T "9@ X T9 @` "(A  `@H 4 6 TA 4_cP@m ?`] *` € @ 5@ @6 @p @ %@o A@& 4@ Zx @ @\ @   %"@0  %* b:  @ @ W? 9@ 9b@0_`@#X _`cP@ @ 90@R @F0/8 , `m@[ %_c`@ ?  @   ``@b90b@b@!@  9 0@@㿘@Mǐ _cx@p @!&&& `&$@ 㿐8" ` _@ː#!9 (_@Ɛ# (`@ `@ @  !W&&6@ A`0t6A`8   e`f@ 8@S` 8@S``h p8"`   aD + 3` @;   aD + 3` @ ; `  @W8 2H'  @ה 6 ` ' `m@ަ 6_@#`@T ` @  0%8 !' `m@ދ  _@#` A 8`2  e`g@y  ` @ 0 㿘@Su "`   `_ "` _ ! !x`!@ 0#P@Xs㿘A 0`s8"`  * 2`   :  @@` ! @Wn  @   9 `0@rc 9A 4_cP@ `p !W`p ` 8@ ɐ*  b8`@"08@"``0" "P !W !`2  2   "@ *  80" (_@#P2 9 ` `s@ː 9`bp@Z 9 $`8"e`r@ݹ `b@I "e`e@ݭ  `b@= `"`@_& 㿘`( 2 @"&`&`( @!@Œ !Ԁ@ `J b@ϐ *J㿘N```"`b @Ȗ`N` `b @뿖``"@+`8 ` #@* `c @믐`(c(@몐`(`@륒c8`,`@렒c@`0`@뛒cH`4`cP@떐`8`cX@두``<c`@댐`H`ch@널_c(`J`cx@z_c(`L`c@p_c(`N`c@f_c(`P`c@\_c(`T`c@R `\`'`,@F,` L  #)@9`7`5`/`-`+a@ 7`@-= @#@'`@" ` a *@@ ` @ `  2` ` ,`@i< @`@``@ ¢` @ܴ@g#dd aB(#ddaB(8 +D](&$'#ddaB8#ddaB a @a@a @a(#x. / ? @@? @ a ȁ   B@a `0@ꈔa0@ a #`#d#h#l`H#\@ya  a  c* @a`h@l0 `p@g  a_  @a_ `x #(  @ a `@I`(@C .ja`@9f `8`"b  @{a`@+ @P`8  ?`&  @& * *@0?`&  @&  * &@{ `8  @K??a`@ `8@P  ?`&  @ * *@Z ?`&  @  * &@H ?`&  * &@: 㿐.>` % |*`@ R`   A 4a`@鱐 `A 4a`@驐`  #@* a`@鞐aa`@阐aa`@钔 aa @錖` 2*`(aa(@酐`X`aa0@~`X aa@@w`X aaH@p ?`&  * & @֒`(a@]aX`,a@Xap`0a@Sa`8aa@N`4aa@I. :``<Wa@ 9 ?a`<a@7 Baa@ @* <`8a@ 9 ?aa@aBab@ @ a`Hb(@ %a'a)aB+a`Ja@b8`La@bP`Na@b``Pabx@`Tab@ab@`\`   ? / `"? &   a!a.@"@Ȑ.ab@`@輐#0c8@跐`  <`` @ %! '@ΐ 8?a@ңcH ?_@_#P@T^8 b@!@@TАx     acP@tac`@p@-_/_+9Q)b !@E@& @O Ԓ@ڔ!`0 @ݐ@S8!( %@" %(` ? "`@( (  "( ? %"(`? $`@(  $(` 2` n N@  8@ՒX 2XP@S@TY8  b@!H㿀bbaPXb'''!`'@o' b!hb ax8@䀢?b@S!V  '@T  @Q  @N 0 @N`#b@ϐ @L  b!@Qђ@ @S!@S$ @O  ` `:`@W5  @R ?@NX`@NR`  ' @   @   @  `?㿘b@OaL  㿘1b@N!L  !, @OL   㿘 & L  ?   ` "     @,, 㻈 %!'&`  &`0a@ ,@ "%@` : b!@`,ba@x :bb_ "8a@  _" #@ <? " @ @ *? 쀢`'耢 b!@E6`b@: :b'耤3L /-b)b'b!bN@&  '@"  '@(  '"0@`L@ &`XbH@ )b L `\)b ?'쀢`'"X@, $ t L@ p  mbx@)耢 ? b"@Ȓ Y6`W6`b_#(b@ʶ b `b@ʭ b`@f ?b@ʡ b ?֖쀢 '耊a"+&`(b"Ȕ@#`b@ʆ b ?쀢  'b"Ȕ@x ` &`,b@l b ?쀢  'b"Ȕ@^`&`8c@R b ?쀢  'b"Ȕ@Dת`&`0c@8 b ?m쀢  'b"Ȕ@*`&`4c(@ b ?S쀢  'b"Ȕ@`&`<c8@ b? 8쀢` 'b"Ȕ@`6`Hc@@ b? 쀢` 'b"Ȕ@ےn`k6`JcP@ΐ b? 쀢` 'b"Ȕ@S`P6`Lc`@ɳ b? 쀢` 'b"Ȕ@8`56`Ncp@ɘ b ?͖쀢  'b"Ȕ@`&`Pc@~ 2 @ ?쀢  'b"Ȕ@p`&`T cL` c*`: ` b#6`* @m ?쀢  'b#Д@>`&@U ?h쀢  'b#@&`$A, ; c  X   " @\  *L@? &`   `    -'$:  '쀢 c耢 c @',  (n#i ?쀢 ^$b#@’U`ݐ? @'H, b#@?`ǐ ?ږ쀢 4$b#@+`? Ɛ@k'耤, b#@`?  4$: 6` H@n`#@ʔ b@@`?  c@ hb#@U`㿘 (  c x , 2 0c 2 4c @;   2 Hc @2   H 2 8c @)  8 2 < ,@ 0& 8 < 2  8@ 4& < c @  @Jg ( c@! c!8@  @JV ( c@!P `c!@   \)@ /c-c+c  a @ܓ= @J3 8 ,`:`@Ӑ @J* 8 ,`:`@ʐb 2  "    c@"X  <@,`c"@:`  < c,`"@:` 2    ,`c"@:` @  4, #ca  " @c( `% %X'!@⊐!@⅐'XDP'H'L7'@ݔ! c@#Xp %!'%_c (ch@`@Ӑ! %,@cc@Ԑ"cc@А"cc@̐"d`@Ȑ"d`P@Đ"d`@"d`@⼐"da@ⷐ"da@@Ⲑ"da@⭐"da c@⨐"dd0a@⢐"db@@➐"dbx@⚐"dd"ؒb@└@  (   @*`2 P4444444444444444444444444444444444444444444444444444$444444444444444444444444444444H84$4444T4d`4T4X4<                           ,L \     l| ތެ ޜ ޼ $$$$$$$$$$$$$$$$$H$$$$$$$$$$$$$$$$$$$$$$$$$$$$$H㶸 %!('@!  `  @4  e @.   e @(  ee`x@v e`@ ɐ$@  @ @ @e  "e`@\ e"e"@ @ݔ! ܀ 2ee@m `8$  7$ d'$ , 4 , e@]! `' r'r 2e 7re@H!X@৔!(1 %e"@挐$@? e  ?`$ "* &"@{  q/(/)e"@ e@ *`:` pK* j@€`e p@ e!@b@^! @ )@ &@8@Գ!  @F! eِ!@<!@8@ @ԗ! 2eߐ!@&!@"@,@Ԁ! 2ueȐ!@!@ e`r@0 e@ \e@LM"!@@! @ @ @@E!  @ؔ! 3ek!@ΐ!@ʐ@ݐ@)! 2eq!@߸!@ߴ$ @@! 2eX!@ߟ@ߛ! @ f@ c@@!  @߃! e  e %"8@bbe@ B@ ?@s@ ] "e@ 2e` L@" e @H e"p@F' eL@ ee"xeb@?e@H8b  x  q!@@H0e"@Ky@;@ eA 8`4 @ .@x! *)e%e!e` @ %#x*`@ R``y*: `  %#x*`@ R` n `"@#8 2L@`ǰ L@`  %#x*`@ R` y 9`0 e@ #@ @ ڒe@i#X)e`eee#xc@ eL@ eeb@ e#@K e   b @Ʋe@!   @  e@/#e!@ތ!@ވ!@ބ@  @ Le@#eA 8`e@ "e @ @ɔ! 9e@"e`0j e@ 8#@e@L!e0"x `?""xf f e@I#e@5!@1!@ efL@I e %! f@5 @㻐 %!'  f % H@b $ * :?    ,  %f"ؒ`x@u p `G  `C %f"ؒ`@e: -f` +f   , @`2  "    a//% %)f'f@@C p@` N,  ` @ @.! ؀   6 ,     6 & &&& & @8 &.  . ($&  . 6@ % " {&$&@.   +  ". +      "  +  2  `+ . @ @  2N& ϐ@ f!p@H a&&@ @ 28&@  21&0"x`" 2@  2"&@  2&@  2&0" &t @}? @ f@!㿘ff!a@ 2Jf %"@Ւb07*   &  %f"ؒa@@T`0&    ` %f"ؒb@Fa0 `   *  a*@  %f"@1b80@ 㿈ff"hb@r 2Jf %"@⋒b0.    ' ' '' &   %f"ؒa@@`0     %f"ؒb@a0@ v w    `  " ` `       %fb"@Ř , &" &@ D@ % 2T$ N$@ f@Ð#$ $@ k #0"x`"'   2! @ g @    2 @ א  $$ $ $  0bt @\? @~㿘ff#(c@@ 2Jf %G" *!?  h" `  " "``""` &"`"`"`"` `0M   * %f"ؒa@@ `0A `  `  %f"ؒb@a0/ f %#x@vb0' 0bt0"p      ` &" " " ` " *@ @y&@㿐@Ւ 0b"p0bp0"t `@@   * @  8? @ ?   + @@  @  #@    "&@+  "@ @    +  +   `+ &@@ 㿐gg (`H@ 2Jf %j"   . %f"ؒa@@T`0o `   %f"ؒb@Ha0cg@a@F- @@ ` ` #\  #`@ggА@̒??f %/"2@g %)! 9 `   # @  %g"@ a00'" &@"@ @ &@ ` < g %!X@fb0`0bt  $@@? @㿐@ܒ  @00"pbt  @ # `@@Z@ @ ?㿘/ g!*a' %e p@E(a$@i 2a ` ,a X ?4  " X* $ X @  ! a@z ?L ", L`?@ La`2La@$La ?ax % 8\ ! `'@A-g %b( ?/@E6$@  ` /X ?4  "X* $X @  ?@" ?L@ O ,@O ?O@:O ? *`O ` `b?L@`  %#x*`@ R` c" 8 k &"B b %-OJOF" ( m gO=O95,@ (,@1 d 4 @$ ( (@ @pq,@ga g$?@z <O @pb,@g! g$@z?O + - @@S'"@pH@@M?`";?J`@@A? 2"g'B!؁F '@Đ 'g!؁F 7ā@' B'-:  + -"'`@?> 'g!B 8' g!BgagB!聨7ƅB' B' @ዒ"8@ᄒ" @~"g!@D %! g@z!؁㻈 %!'@  0@Ւ @`@ u %" g/g)g-g-`,`@@   _l?l""@2 2``a`a@C"`h@C(    æ/g - %`'%"$* @Cp(/$@q O X` ?"` X* $ X@  # O` ڐ?*  *  @ @ @&y`@ -`(2 @@  ! g@z" %!!X'@A4g@CG"  ;g9g7g5g/ % g *`ؖ b袒 "If@#@    `Ԁ  , @ 2  )@CHh@ݟ† # %)g`%g, @C# @ݑb  , b` ?"`b* $b@   gg6 #cT 2 f %"@lb %" &@f %b@b"@r! %@ )g'g%g# % ,#\#` #{ ?〤? @Db ,& ,)h'h%g# % 0#\#`  (c ?ˀ? @,b 0& 0)h'h%g# % 8#\#`  PhK ?? @b 8& 8)h'h%g# % 4#\#`  3 ?? @b 4& 4)h'h >bt <"@  %h"@xax <! 4 @Ԑ  4@А #\#` ?j?2  <g %! @Ȓb <#0Δbtˀ @$ @h&@@g!@bt8$bt& <)h'h%g# % H#\#` !Ԛ ?#\#`p?? @: @"@ @9 b@ p"H@" @,  㿐.` ppb")f# %%g   #\#`, ??"@b  24  @b  㿐.`  ` `( !*` pp"bذ   , @@ 2 ,` 'p@=D# !,` f %"@׿b +p)p'g% % ` #\#`cH#`ߚ ?ꀤ? @ר ` ,`  㿘. `E A ? = ;.#p!p /p@ @ί@̐ *&@e`x@  %#@yb@c#p#O  pf %"@hb c@ 2N@  @΃&@ 㿘 2 @@ 2  2@ `?@6(@t? q` @ @b! #ee`x@Ⱀ `r@d 6 &@`e@] 6&@q`8@ &㿘  qqq P`x 2 f %g"?* : `3dj#h*` €2(q %U!(& (,& ,0& 04& 48& 8<Q& <`2`(q %B!(& (`,& ,`0& 0`4& 4`8& 8`<>& <2(q %/!(`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@ q %!H@֝b0q %!@֗b؁㿘 " " " "   <& 㿘@2{XX` !Ѐ?" @  p  ?AAA $!" "@# D" 䀠u#a{"( € x P"a$!В @,!  $!@7xX@AA !ЀT!`P @ M!Ѐ  x x "a$!В&@!  $!@7bx@A !А $!Ѐ,!`( @n %!Ѐ  x x "a$!В @! $!@7:x@@  !x   ""!Ѐ ?1! A@1  A@7x!@@Ր Ѱ? !@`P 6 `P@7 !x@@Ð ! < !xa@@ !@Y??$!$䀢2 !a@ڔ   !А $Ԓ  @ ?2 $Ԁ2 $@6`2$ Ԁ`2$ p  `!@   ""as#!(i{"*` €c? p  `P!@ "!Z"a(`P H>c? !"!("a( p !Ԁ  !( >"!?;"a p !!@  : `P@c 8@%!@?"!(% 1 >$!(!(  : `P@M 8@!(  p $!( p ?!( &!&!" "a"(%  $ܰ 㿀 aЀ   AA"! "`@"DaT #  !Ԁ`# !`' ?`" * " @Ґ !x@Xa8@# a䀢 !A@ P   P<    <8  @;a$a  p` ! !`!耢 @7 @J!耢 @: !T  !Ԁ`2 A!  x@Ԇ!h @"aA @?$AD   t"@`"D aؐ "a!T b"! !`' ?`" * " @T $!t !!aHxaLap@@H;"a x!@.! xH H H8@͔  x@βa#!@! #H!8 a#\t#`#d#hx!a?a @Η@ $a ?c % !Ԧ `' a܀   ?#! !В@T? 4!$ x@p !㿘 ! "a 1 !Д  @    !@)   @5 ?x@>Ɛ 㿘 !Ԁ`Axb(@> ? ` !(x!b`@> ? 㿘 !܀ 4 !Ԁ  a@T (A  #" @! "(A" a@To A "`@ $!@4 x!ؔ@>t 0 !xb@>C 㿘 !܀  aТ @J   A"`@"6$!$! !Ԁ W 1 Q !aД  @T E  > b a@ ; 7$!܀ 6@4g`".$!@4a`"($!@4[ `E# @4T` xb@= $!P @4H`"$!@4B`" $!@4<` $!ܰ   "A "`@  xc @= 0(  !xb@= 0  @4 x!ؔX@=А 0 t``"x@SԐ xxc@= 0c@= 㿐A H`g? a܀ b  `p? xWcA @A "`D !Ԁ 4=# @9A  # @2$ a7  a'@ 6&$%܀ # @aԀ % "% В  @  > @@ dВ@{   $# @܀ y`P@=-  y` @=' ?㿘  >2@ `(=  !܀ 4 5!Ԁ`21 ! !В  @H   ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up  . .."MAKEDEV# fd$presto0ah0 % rpresto0a0 &presto0b0 ' rpresto0b0 (presto0c0 ) rpresto0c0 *presto0d0 + rpresto0d0 ,presto0e0 - rpresto0e0 .presto0f0 / rpresto0f0 0presto0g0 1 rpresto0g0 2presto0h0 3 rpresto0h0 4presto0i0 5 rpresto0i0 6presto0j0 7 rpresto0j0 8presto0k0 9 rpresto0k0 :presto0l0 ; rpresto0l<presto0m= rpresto0m>presto0n? rpresto0n@presto0oA rpresto0oBpresto0pC rpresto0pDbpp0to0Eccd0ao0Frccd0a0Gccd0b0Hrccd0b0Iccd0c0Jrccd0c0Kccd0d0Lrccd0d0Mccd0e0Nrccd0e0Occd0f0Prccd0f0Qccd0g0Rrccd0g0Sccd0h0Trccd0h0Uccd0i0Vrccd0i0Wccd0j0Xrccd0j0Yccd0k0Zrccd0k0[ccd0l\rccd0l]ccd0m^rccd0m_ccd0n`rccd0naccd0obrccd0occcd0pdrccd0peccd1afrccd1agccd1bhrccd1biccd1cjrccd1ckccd1dlrccd1dmccd1enrccd1eoccd1fprccd1fqccd1grrccd1gsccd1htrccd1huccd1ivrccd1iwccd1jxrccd1jyccd1kzrccd1k{ccd1l|rccd1l}ccd1m~rccd1mccd1nrccd1nccd1orccd1occd1prccd1pccd2arccd2accd2brccd2bccd2crccd2cccd2drccd2dccd2erccd2eccd2frccd2fccd2grccd2gccd2hrccd2hccd2irccd2iccd2jrccd2jccd2krccd2kccd2lrccd2lccd2mrccd2mccd2nrccd2nccd2orccd2occd2prccd2pccd3arccd3accd3brccd3bccd3crccd3cccd3drccd3dccd3erccd3eccd3frccd3fccd3grccd3gccd3hrccd3hccd3irccd3iccd3jrccd3jccd3krccd3kccd3lrccd3lccd3mrccd3mccd3nrccd3nccd3orccd3occd3prccd3pvnd0arvnd0avnd0brvnd0bvnd0crvnd0cvnd0drvnd0dvnd0ervnd0evnd0frvnd0fvnd0grvnd0gvnd0hrvnd0hvnd0irvnd0ivnd0j#!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up # . .._ 0rs` 1rsa 2rsb 3rsc 4rsd 5rse 6rsf 7rsg 8rsh 9rsi 10sj 11sk 12sl 13sm 14sn 15so 16sp 17sq 18sr 19ss 20st 21su 22sv 23sw 24sx 25sy 26sz 27s{ 28s| 29s} 30s~ 31s 32s 33s 34s 35s 36s 37s 38s39s 40s 41s 42s 43s 44s 45s 46s 47s 48s 49s 50s 51s 52s 53s 54s 55s 56s 57s 58s 59s 60s 61s 62s63s MDTERM=sun MDDKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' ARCH=sparc md_installboot() { local _rawdev=/dev/r${1}c _prefix if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_checkfordisklabel() { local rval=0 disklabel $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std random bpf0 R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M drum c 7 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 640 kmem ;; xfs*) M xfs$U c 51 $U 600 ;; uk*) M uk$U c 120 $U 640 operator ;; tun*) M tun$U c 111 $U 600 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 121 $(($U*16)) 640 operator M nss$U c 121 $(($(($U*16))+1)) 640 operator M enss$U c 121 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; pf*) M pf c 59 0 600 ;; openprom) M openprom c 70 0 ;; lkm) M lkm c 112 0 640 _lkm ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; bpf*) M bpf$U c 105 $U 600 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 30 0 644 M apmctl c 30 8 644 ;; wsmouse*) M wsmouse$U c 80 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 81 0 600 M wskbd c 81 1 600 ;; wskbd*) M wskbd$U c 79 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 78 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 78 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyFcfg ttyF0 ttyF1 ttyF2 ttyF3 ttyF4 ttyF5 R ttyF6 ttyF7 ttyF8 ttyF9 ttyFa ttyFb ttyEcfg ttyE0 ttyE1 R ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 ttyE8 ttyE9 ttyEa ttyEb R ttyDcfg ttyD0 ttyD1 ttyD2 ttyD3 ttyD4 ttyD5 ttyD6 ttyD7 R ttyD8 ttyD9 ttyDa ttyDb ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 R ttyC4 ttyC5 ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; bpp*) M bpp$U c 104 $U 600 ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 125 0 666 ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 36 $o 660 dialer uucp M cua$U c 36 $(($o+128)) 660 dialer uucp ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 19 $U 660 operator ;; vnd*) dodisk vnd $U 8 110 $U 0 dodisk svnd $U 8 110 $U 2048 ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; chr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R presto0 bpp0 ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 R sd1 sd2 sd3 sd4 cd0 cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 R tun3 bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 R fd1 fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B fd0C fd0D R fd0E fd0F fd0G fd0H xfs0 ss0 ss1 ch0 cuaa cuab cuac cuad R ttya ttyb ttyc ttyd ptm local wscons audio0 uk0 random lkm R tty00 tty01 tty02 tty03 apm pf systrace xd0 xd1 xd2 xd3 R raid0 raid1 raid2 raid3 std st0 st1 fd ;; presto*|xd*|xy*|sd*|raid*|ccd*) case $i in presto*) dodisk presto $U 26 25 $U 0;; xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; raid*) dodisk raid $U 25 123 $U 0;; ccd*) dodisk ccd $U 9 23 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi  . .."MAKEDEV# fd$presto0ah0 % rpresto0a0 &presto0b0 ' rpresto0b0 (presto0c0 ) rpresto0c0 *presto0d0 + rpresto0d0 ,presto0e0 - rpresto0e0 .presto0f0 / rpresto0f0 0presto0g0 1 rpresto0g0 2presto0h0 3 rpresto0h0 4presto0i0 5 rpresto0i0 6presto0j0 7 rpresto0j0 8presto0k0 9 rpresto0k0 :presto0l0 ; rpresto0l<presto0m= rpresto0m>presto0n? rpresto0n@presto0oA rpresto0oBpresto0pC rpresto0pDbpp0to0Eccd0ao0Frccd0a0Gccd0b0Hrccd0b0Iccd0c0Jrccd0c0Kccd0d0Lrccd0d0Mccd0e0Nrccd0e0Occd0f0Prccd0f0Qccd0g0Rrccd0g0Sccd0h0Trccd0h0Uccd0i0Vrccd0i0Wccd0j0 ss0Xrccd0j0Yccd0k0Zrccd0k0[ccd0l\rccd0l]ccd0m^rccd0m_ccd0n`rccd0naccd0obrccd0occcd0pdrccd0peccd1afrccd1agccd1bhrccd1biccd1cjrccd1ckccd1dlrccd1dmccd1enrccd1eoccd1fprccd1fqccd1grrccd1gsccd1htrccd1huccd1ivrccd1iwccd1jxrccd1jyccd1kzrccd1k{ccd1l|rccd1l}ccd1m~rccd1mccd1nrccd1nccd1orccd1occd1prccd1pccd2arccd2accd2brccd2bccd2crccd2cccd2drccd2dccd2erccd2eccd2frccd2fccd2grccd2gccd2hrccd2hccd2irccd2iccd2jrccd2jccd2krccd2kccd2lrccd2lccd2mrccd2mccd2nrccd2nccd2orccd2occd2prccd2pccd3arccd3accd3brccd3bccd3crccd3cccd3drccd3dccd3erccd3eccd3frccd3fccd3grccd3gccd3hrccd3hccd3irccd3iccd3jrccd3jccd3krccd3kccd3lrccd3lccd3mrccd3mccd3nrccd3nccd3orccd3occd3prccd3pvnd0arvnd0avnd0brvnd0bvnd0crvnd0cvnd0drvnd0dvnd0ervnd0evnd0frvnd0fvnd0grvnd0gvnd0hrvnd0hvnd0irvnd0ivnd0jrvnd0jvnd0krvnd0kvnd0lrvnd0lvnd0mrvnd0mvnd0nrvnd0nvnd0orvnd0ovnd0prvnd0psvnd0arsvnd0asvnd0brsvnd0bsvnd0crsvnd0csvnd0drsvnd0dsvnd0ersvnd0esvnd0frsvnd0fsvnd0grsvnd0gsvnd0hrsvnd0hsvnd0irsvnd0isvnd0jrsvnd0jsvnd0krsvnd0ksvnd0lrsvnd0lsvnd0mrsvnd0msvnd0nrsvnd0nsvnd0orsvnd0osvnd0prsvnd0pvnd1aprvnd1avnd1brvnd1b vnd1c rvnd1c vnd1d rvnd1d vnd1ervnd1evnd1frvnd1fvnd1grvnd1gvnd1hrvnd1hvnd1irvnd1ivnd1jrvnd1jvnd1krvnd1kvnd1lrvnd1lvnd1mrvnd1mvnd1n rvnd1n!vnd1o"rvnd1o#vnd1p$rvnd1p%svnd1a&rsvnd1a'svnd1b(rsvnd1b)svnd1c*rsvnd1c+svnd1d,rsvnd1d-svnd1e.rsvnd1e/svnd1f0rsvnd1f1svnd1g2rsvnd1g3svnd1h4rsvnd1h5svnd1i6rsvnd1i7svnd1j8rsvnd1j9svnd1k:rsvnd1k;svnd1l<rsvnd1l=svnd1m>rsvnd1m?svnd1n@rsvnd1nAsvnd1oBrsvnd1oCsvnd1pDrsvnd1pEvnd2apFrvnd2aGvnd2bHrvnd2bIvnd2cJrvnd2cKvnd2dLrvnd2dMvnd2eNrvnd2eOvnd2fPrvnd2fQvnd2gRrvnd2gSvnd2hTrvnd2hUvnd2iVrvnd2iWvnd2jXrvnd2jYvnd2kZrvnd2k[vnd2l\rvnd2l]vnd2m^rvnd2m_vnd2n`rvnd2navnd2obrvnd2ocvnd2pdrvnd2pesvnd2afrsvnd2agsvnd2bhrsvnd2bisvnd2cjrsvnd2cksvnd2dlrsvnd2dmsvnd2enrsvnd2eosvnd2fprsvnd2fqsvnd2grrsvnd2gssvnd2htrsvnd2husvnd2ivrsvnd2iwsvnd2jxrsvnd2jysvnd2kzrsvnd2k{svnd2l|rsvnd2l}svnd2m~rsvnd2msvnd2nrsvnd2nsvnd2orsvnd2osvnd2prsvnd2pvnd3aprvnd3avnd3brvnd3bvnd3crvnd3cvnd3drvnd3dvnd3ervnd3evnd3frvnd3fvnd3grvnd3gvnd3hrvnd3hvnd3irvnd3ivnd3jrvnd3jvnd3krvnd3kvnd3lrvnd3lvnd3mrvnd3mvnd3nrvnd3nvnd3orvnd3ovnd3prvnd3psvnd3arsvnd3asvnd3brsvnd3bsvnd3crsvnd3csvnd3drsvnd3dsvnd3ersvnd3esvnd3frsvnd3fsvnd3grsvnd3gsvnd3hrsvnd3hsvnd3irsvnd3isvnd3jrsvnd3jsvnd3krsvnd3ksvnd3lrsvnd3lsvnd3mrsvnd3msvnd3nrsvnd3nsvnd3orsvnd3osvnd3prsvnd3psd0a3prsd0apsd0bprsd0bpsd0cprsd0cpsd0dprsd0dpsd0eprsd0epsd0fprsd0fpsd0gprsd0gpsd0hprsd0hpsd0iprsd0ipsd0jprsd0jpsd0kprsd0kpsd0lprsd0lpsd0mprsd0mpsd0nprsd0npsd0oprsd0opsd0pprsd0ppsd1aprsd1apsd1bprsd1bpsd1cprsd1cpsd1dprsd1dpsd1eprsd1epsd1fprsd1fpsd1gprsd1gpsd1hprsd1hpsd1iprsd1ipsd1jprsd1jsd1krsd1ksd1lrsd1lsd1mrsd1msd1nrsd1nsd1orsd1osd1prsd1psd2arsd2asd2brsd2b sd2c rsd2c sd2d rsd2d sd2ersd2esd2frsd2fsd2grsd2gsd2hrsd2hsd2irsd2isd2j (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxrsd2jsd2krsd2ksd2lrsd2lsd2mrsd2msd2n rsd2n!sd2o"rsd2o#sd2p$rsd2p%sd3a&rsd3a'sd3b(rsd3b)sd3c*rsd3c+sd3d,rsd3d-sd3e.rsd3e/sd3f0rsd3f1sd3g2rsd3g3sd3h4rsd3h5sd3i6rsd3i7sd3j8rsd3j9sd3k:rsd3k;sd3l<rsd3l=sd3m>rsd3m?sd3n@rsd3nAsd3oBrsd3oCsd3pDrsd3pEsd4aFrsd4aGsd4bHrsd4bIsd4cJrsd4cKsd4dLrsd4dMsd4eNrsd4eOsd4fPrsd4fQsd4gRrsd4gSsd4hTrsd4hUsd4iVrsd4iWsd4jXrsd4jYsd4kZrsd4k[sd4l\rsd4l]sd4m^rsd4m_sd4n`rsd4nasd4obrsd4ocsd4pdrsd4pecd0afrcd0agcd0chrcd0cicd1ajrcd1akcd1clrcd1cmrd0anrrd0aord0cprrd0cqxy0arrxy0asxy0btrxy0buxy0cvrxy0cwxy0dxrxy0dyxy0ezrxy0e{xy0f|rxy0f}xy0g~rxy0gxy0hrxy0hxy0irxy0ixy0jrxy0jxy0krxy0kxy0lrxy0lxy0mrxy0mxy0nrxy0nxy0orxy0oxy0prxy0pxy1arxy1axy1brxy1bxy1crxy1cxy1drxy1dxy1erxy1exy1frxy1fxy1grxy1gxy1hrxy1hxy1irxy1ixy1jrxy1jxy1krxy1kxy1lrxy1lxy1mrxy1mxy1nrxy1nxy1orxy1oxy1prxy1pxy2arxy2axy2brxy2bxy2crxy2cxy2drxy2dxy2erxy2exy2frxy2fxy2grxy2gxy2hrxy2hxy2irxy2ixy2jrxy2jxy2krxy2kxy2lrxy2lxy2mrxy2mxy2nrxy2nxy2orxy2oxy2prxy2pxy3arxy3axy3brxy3bxy3crxy3cxy3drxy3dxy3erxy3exy3frxy3fxy3grxy3gxy3hrxy3hxy3irxy3ixy3jrxy3jxy3krxy3kxy3lrxy3lxy3mrxy3mxy3nrxy3nxy3orxy3oxy3prxy3ptun0tun1tun2tun3bpf0bpf1bpf2bpf3bpf4bpf5bpf6bpf7bpf8bpf9ttyp0ptyp0ttyp1ptyp1ttyp2ptyp2ttyp3ptyp3ttyp4ptyp4 ttyp5 ptyp5 ttyp6 ptyp6 ttyp7ptyp7ttyp8ptyp8ttyp9ptyp9ttypaptypattypbptypbttypcptypcttypdptypdttypeptypettypfptypfttypg ptypg!ttyph"ptyph#ttypi$ptypi%ttypj&ptypj'ttypk(ptypk)ttypl*ptypl+ttypm,ptypm-ttypn.ptypn/ttypo0ptypo1ttypp2ptypp3ttypq4ptypq5ttypr6ptypr7ttyps8ptyps9ttypt:ptypt;ttypu<ptypu=ttypv>ptypv?ttypw@ptypwAttypxBptypxCttypyDptypyEttypzFptypzGttypAHptypAIttypBJptypBKttypCLptypCMttypDNptypDOttypEPptypEQttypFRptypFSttypGTptypGUttypHVptypHWttypIXptypIYttypJZptypJ[ttypK\ptypK]ttypL^ptypL_ttypM`ptypMattypNbptypNcttypOdptypOettypPfptypPgttypQhptypQittypRjptypRkttypSlptypSmttypTnptypTottypUpptypUqttypVrptypVsttypWtptypWuttypXvptypXwttypYxptypYyttypZzptypZ{fd1a|fd1b}fd1c~rfd1arfd1brfd1cfd1Bafd1Bbfd1Bcrfd1Barfd1Bbrfd1Bcfd1Cafd1Cbfd1Ccrfd1Carfd1Cbrfd1Ccfd1Dafd1Dbfd1Dcrfd1Darfd1Dbrfd1Dcfd1Eafd1Ebfd1Ecrfd1Earfd1Ebrfd1Ecfd1Fafd1Fbfd1Fcrfd1Farfd1Fbrfd1Fcfd1Gafd1Gbfd1Gcrfd1Garfd1Gbrfd1Gcfd1Hafd1Hbfd1Hcrfd1Harfd1Hbrfd1Hcfd0acfd0bcfd0ccrfd0arfd0brfd0cfd0Bafd0Bbfd0Bcrfd0Barfd0Bbrfd0Bcfd0Cafd0Cbfd0Ccrfd0Carfd0Cbrfd0Ccfd0Dafd0Dbfd0Dcrfd0Darfd0Dbrfd0Dcfd0Eafd0Ebfd0Ecrfd0Earfd0Ebrfd0Ecfd0Fafd0Fbfd0Fcrfd0Farfd0Fbrfd0Fcfd0Gafd0Gbfd0Gcrfd0Garfd0Gbrfd0Gcfd0Hafd0Hbfd0Hcrfd0Harfd0Hbrfd0Hcxfs0cnss0censs0 ss1nss1enss1 ch0cuaacuabcuaccuadttyattybttycttyd ptmwsmouse0wsmouse1wsmouse2wsmouse3wskbd03wskbd13wskbd23wskbd33wsmousewskbdettyFcfgttyF0g. uk0ttyF1gttyF2gttyF3gttyF4gttyF5gttyF6gttyF7gttyF8gttyF9gttyFagttyFbgttyEcfgttyE0gttyE1gttyE2gttyE3gttyE4g ttyE5g ttyE6g ttyE7 ttyE8 ttyE9ttyEattyEbttyDcfgttyD0gttyD1gttyD2gttyD3gttyD4gttyD5gttyD6gA P@ 8C 4 P2 > <(>P8@ b >8  !@+   @3N?y @= ?$a܁㿐 !܀ 6 !Ԁ M  y~ `(|$ܐ @<`s? ! q `(o$!Д  @   @3y @<ҔZ?b  !؀`y @<aK?    !@і D @2y @<@8?@= 2 "!(1 `(/$ܢ :`@ɖ@ y@t ` t?? <  @B0@( #t@,T @' t@( t2@b @B t`(a` @ș @'C! z@j"x %!?cP '@   t`D  t`  @2 !`@0 @ z-'?` t ???<"ؐ f @' c t@+Ґ @#a !?!x`6" @1 /a ax #@  "#H @fax  ?`H  `V?`@ M`@&  t@'  t @.֐  <@ah  !\`9!?" @ߐ 1ah !\``@#  "#`H  ah ?`H?`@  `@` @ @B0!T    @   @ "a  "  "@ " @/z @8   6 4? @@`  @ @ @B`T@.CT p!`l   `?"`@* "@@ [$!@  t  @ @ @mB@.0H? <ؔ @T `!`   `?"`@* "@@K $!`2 ?"  @ @9B    @a  @.pz@8, @  t`(` @ؐ @1M@% z@i5"㿈  t?` '@-  @  t`t`, t` 0@.  @+``% '7z@ "@- Ȁ`   ` @  '@.@7 0@&r @@-X` !` @̐  @@-E0}!T  @@  $ `ƀ" @t` aT ሀ # `?"`@* "@@d $a@q0Bt`@@faT  ሀ # `?"`@* "@@? $a 3耢  `쀢 ( @耢 %`    `@ `@ِ `@)j !?8'@-] 1`t`4@ua` @ź !d`@0*@5 %! ?#P`t '@    t  zc@6 y t`D q t`  ka  @, c t @./ XaT    `z@4c@ "a  a  @, " t@.  @  t@(ؐ  @xB  t`(@,Z @y T  !!   z@]#p$!T  z@g}#x %! `'@,L !@    t`D ?#P* ! z@gS#?bp?H? %#PaԐ? ' ᤢ '@,z2 !?L+ /!?a)c#H@M / /-@`-@,""a@K  "@,4za@5 Qa< @ @zac@5 Da@* ?a@ :a@. 4!`@, ,a@10#??b'@(  '᐀ 2L!x`;L /d?@xzc@5z 0cHbؐ@` #-@᐀ ax   @c   H cax ?`H?`@  @@* ͒!`@$) Ȓ!`!?#H @% ah  !\`+"ؒ @ $ah !\`  @#   H #ah ?`H?`@  aT     @< "a !`" @< @J !T g!`c   `?S"`0V   ? @ @ !T@*!T  @Ȕ ?bԦ  '@+z @4ڔ0 @M 6@ݒ@*t0"@ؐ@w@ђ!T !`   `?"`@* "@@ $!@c !` @] @-@a {@e 㿐  tA` Ȥ? ' 5{- 3{ "g?  @ `T( p E @4B`x `@䀥 t` $€ %t` ``8 ( `  p !{`@4   Ȓ @\ ѐ` `8   0{`P ?{`@3 ?a   "a 㿘  @"`  "*` * & 6@ Ap?@ * @*`@"t@ܒd `ȴ " 9 7{ U{@y O"   p L? @3 @v 4  `@@  " `@A Ȣ@*` *  . `@  2  p ? @3w  A`Ȓ @Ź""@Š" {a @3b ?㿘a@ B Ƞ "`  t`&!@!@? {a  !{aȔ   "" {b  @35?0a ""a(      ?!@  @88"`# а 㿘  pB`Ȱ" !@? {bP {b "@2?0a  J ?a(   # :H#`̰ B?  "!("a㿘!`{b @  !( "@ "a( "!  s  Ц " a  @ :; F@g@  @a :@ D E@d ( Ȁ`% Ȭa@$Ѐ@ % ( - ̐ $Ȕ"  : a $% a$В@ % aH@ab  %(;aH88    "`p {b @2B?㿘 !`L   p`{c @20 C? ! 7?H ;   ȔB@ " 8H"`(   :H!#   :H  a 􀢠   {cX@1 0g  K ?㿘`Д" "`@㿐  p?` Ф" :   2 @ Ф   в@fU% !( :`@ @v@   :?H@ f @ B D (8H.  В"@:`   ` @h:   2@ Д в  d% Ѐ` а 㿘#``Ȁ ! ̐ "@   a@e$`Ё㿘`$" '#% `Р"@  @@T @?`В@o`в&@@$`Ѐ` 㿘`$'#`Р"@  @ &@ `А@E`а&@$`Ѐ 㿘'  Р"   @a &!?< 2 @Т Д@x в@ < f $Ѐ ` ( P@'  А"   @a &I>: 2 @Ж Д @FƐ  Т@ :d $Ѐ 4`8 @'` {  {c@0 ">@ @&` {@0 >?@ {c@0m >  P@  '"` ,@ڳ  Ѐ 2  P>@&| @0p  >'/0- :2 @   Ж#\@Ú !` : Д   #  Л: $В  @ d ` Д"@%@ Ē   P`4   `@ 4 ` ! ?!`2   @|`0 @/ΐ  PX  * 2`  *` '     "2  @   @ Ѐ 2  '@& | @/Ė'#' `Ȑ@ #\@ <@ E`Ȑ@E 怦!@% | ` @/ 1 P    @   |` @/Z @ٰ   @@% | @/s   |`Ȑ @/<   P`  `@9㿘 a  )  $% # ! o   :H`!  "a?H `ȑ> B@" 8H"`Ё㿘!0!0 ` 4+  1%!8!8!0  !0'% @3' |`@.Ӑ +      =a8i"! Ȕ   "`̀@=a8] && %'    =a8 MȀ "`&& d@ `a8 <`B=a8  ̔@ &"`$  " a8Ț@ <`C &!=a8@$  `t @$ А@D  "a?㿘! "  1 " 2?!=@  $"  "| &"a`@.C ?㿘! "  1 " 2? @  $"  "| &"a@.& ?㿘! "  1 " 2?!=@g  $"   "| &"a@.  ?㿘! "  1 " 2?!=@J  $"  " | &" b@- ?㿘 "` E1|!=@$O* @ ! `! $2 !`2? `2.1|: !  @淐 !`$!  @ѐ (!=@$'* "@@O   & |H& $@^ `21|"@2& $  @  &㿘 "`C E1| @#* @ ! `" $2 "`2? `2.1|: "  @ "`$"  @r ( @#Ȑ* "@@Ռ   & |H& $@^7 `21|"@2& $  @'  &㿘@Ґ "[?N V b   &N?@&!= * @ #   @  #  7?! $a  @ a`$a  @&}!=@ ( , "@  @3 ?` &@ @ѐ @'  $` $ $&@ $?㿘@q "[?N V b   &N?@&A * @ #   @  #  7?! $b  @' b`$b  @& @ (, "@  @r ?` &@ @p @f  $` $ $&@ $?㿘@!㿘|b@t   ? P`@  ?㿘 <    < & +& "*0.P(P$#"P(0  #&  &  &  &  &  & P   o @& &  <@!K ? % %!?#P' @s '  '|b,'t@ΐ` `t0@ |@]"㿘l|b@+ ? 2 |L 2|N   |b@+ ?㿘 P   @   4!  P P@ |@+c? P,  W @"&,| c0,@ N,  |cP@+t ?㿘`K |cp@   ?㿘 L h!    :` @  & `  @  & ` @  &` @  (& ` @  ,& `$ @  $& `* @  0& `0 @  H&  P @&  8& `A@ : `;@p ` &L < (  @ &,., Y ?  W㿘@"@ %!c'@"Ԕ ư?``   :`0& ",    A4  #`P  A @՘  `|cx A @A  !ǒ @8  ~#`   @.  t`   @%  k`    @  b`(   @  Y`,   @   P`$   $@  G`0   *@   >`@   0@   5 ; @   - L  `  ``|c     2 ,֐, 6 `|c@*!  ? |c@*  ! }@[] 㿘`m }`(@4   ?㿘`m }`0@&   ?㿘 @."a㿘!` n Ӓ n #`  :` @ + `& ` @ % ` &` @  `(& ` @  `,& `. @  `H& `@& `8& `6 @ u `P:`& @  `$& `> @  `F @  !?# @ `*  * `& `N @  `V @   @ `*  , `0& `f @ Ԕ `&`^ @ Δ  ??& 8 n ` "  .< (  @   @  b  `:&,.,    @  b Y ` ?  |㿘 @ "a  %!'?@!? #?` ``0&!`!’ @   `   ! @     @   ` "(`  (% ##`P   `  b ` ;@ 6 @   `}Ò`8,   ;   ;@ 6 @ H  %   @ >      @ 5  (   @ ,  ,   @ #  @   .@   $   &@   v `  >@   l'? @ `2 @ F @   _0 `  N@   U V  2  @   I ^ @ ܖ  A n     n  $ )  }"``    # 2! ,, & , $   6 }`@(  ? }`@'   }@Y> ` (:`((!Dž0: 2`(0 ?؀   ؐ?㿘ڒ   !    S;` `*  & ` `*`@& ` `*  & `  (`*`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `*  & ` (` *`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  ;`*`+ 2 *  @ :``, 3`@`H`8& B&?&E :  $ 3` < @ (@ `P   &,.,   `  b` ;;   @  b  ` ?}  &p %!?c'@ !B?  ?  0& Ѐ J  `] [  P * 2` * 2` `@  c * 2`   ` `+=  `-5@ *   - @ (`(`(`(``-) }`, ; ;  , ;  `***   : .`.`.`.` )   =(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  2 *   (`(` ( 2 *   (`(`  , 2 *   (` {(`  $ 2 *   (` n(`  0 : *   (`a(` @ ::: *`@ `**`@ (`(`(`J(`<  *` @ (` ?(`d  ^       }"a     $ 2" ,?,   , "   6  }aH@%  ? }ap@%w   }@V!ddde(eede(e(e(㿘#`   c.@b 6,`@\ #?@!P` } , ( @}  }@%^  ?&@9 㿘`D !`  , (  @:aX  X`  3& X  @   x`  |`  8 @   @@  @R} @%  (, @ǒ  @?} 0@$ ?<   @B }bP@$ ?㿘`    @+  ( @ю !l`  2    }b@$   (@k O#!l`2Q @@`@ }b@$h @?<  @ .#0 @ Y (#, @?}ؖ@$t 0"@$m ?@aP  `@v` }  @     %a  '   ` ["`*` €@u} @$/ *?!}@# !` @#?,@Ԓ < ( @e 2' &`0 `0 @’@3} cH, @ }c@# ?"%@! @ ``!P` } ( , @ؐ ~}@# ?!`` (, @ʐ , @o `oaX  !X  3& !X  @ѐ%`F) !}@g# >@  (!X@2 @} @#e @ c@a!X  &` @N )    x `  |`` @;  x   |`"  8@ @   }@TF#(@ߒ #!l`2*?<  @s 6 ` @B}@Ӑ   @4~@" ?(L /?  / )  @@N  6,@ϔ 2 , c@a@Ŕ , @ / ,@| @! !,?( "(""('$ 3 `x   |`b(@\ `x  $b(  |`b( $ @~0 @"b(@  @~P@"s ( "8""8 &$ 5 x   |`@̎ x  $b8  |` $ @~0 @"E@ݒb8  @|~P@"7 㿘@Ǩ 6" !~@ @b` !T`@s 2 ?@S~@" ?㿘@  6" !~@ @8` !T`@I 2 ?@)~@! ?㿘@ 6" !~@ @` !T`@ 2 ?@~@! ?㿘o@  @~@! 㿘@'g  @~@! 㿘\s)~ 2 '&@"&`(& N    L "  2'<`  @w  >@4 7 !!Ȁ  ~`@  @1` $~a@! ?@?*@@ @h~(@!# ?2&㿘!??@*    @M~@@! 0bH@   @=~(@  㿘@ @?&@!d`  8   @ 4 ?c  %!'  `  &c  ` 8?# :D @ 6  `@ @@6  ! P      ~aX%? @ː  @  ~p @   ~a@ Z ?  @  @  ~@ q ? &  ~@Q!ЁxxhxxxxxxxxxxxН㿘!  "`܀  "!`ܐ "!`ܐ @" "T`@%, "`~b@  ?@  ?!d` @k? 6 㿘 ~N b@@  ~b`@ܐ ?@?`$ N /".  bT$$  $ $  bX " "bX ""X"bT 㿘 "\` "`!` "`!t` `  "` bP @^ 㿘!d` @ "T )~' %%~  4   2 `2 @}" @) 2 㿘 "P + @$bP!%)~'~bT`   @0, 28?"\ "&"\ &"\-?"\` "@@a  "\@?"@f 0@@ bT@"\?@W 0 $ @ $bP 㿐`耢 % "`耢  % # @P  $b` ٰ? :?` 5#0*` €!d`b` @ @ b` `i0b`~ c@ 0b`~   b`~ @@ 0b`~ ` ., b`   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X;`X `;`` h ;`h< "9"20QRb`b`M (-  PAb`08;b`!d 3&  @ 8@ )b`% # @ & : & , @j, 6 ,@b`~x @r 04&,  & b` @3,,&,&b` `&  㿘!|`)"% %('~`? $`@(  $( *`@@ = :, *`,? ! %@my"( *@ 2%,( `  2,0  %"(`? &`@}(  $(@2`~c@Ґ  (a| %!'  !T`" @ے@?`&@ * &@Ȓ@ʐa `@צ !2  `(;!@@  0@~`(@v @ /` ` #h`   #`#d`@#\ @ ` ? ?` 2   ``X@`8`h@@n`&@  * &@a @u ?` @P p, @h  2 @D x, @\?`&@ * &@2@4a @NP 8a %!'  @;a @3 4  0%@@~ @uc @ "/  @ @  @N 㿐@XV` N N N @+@Ւ N 2N0@͒   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0(2   0(2    0( :( ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ?    *    J ** 㿘  "`Ȁ`4`I?"J@ - $ ` *` "c\J `@꟔3 . :  ""'?@G  :2J @ %"` :2.  $\  %@"ؒ`@  ?*@$"\. > hh(4\hx $$$$$$$$$$$$$$$$$$$0$$$H$$`p$$$$$$$$$$$<P$d$$|$$$0<$88 8$888888888@$88888H8888l888888888888888888888`8t|8XX,D @ P\dt  㿘@@V /`"!`@$!!@D!` @0!@:!x @H0!$!@P  5Y- `JT#*` €O#`@!$!@`G`a@ @? "ap9 "at4 "a. "a)  "al$@ "a "a`@t 0 -* : `#P*` € " x   " |""X# x " |  "a  "aXLa@ @) L  ݤۤ@E`Ȁ Ӥ "!dͤ  "!Ǥ   "!T @! # 'b" @ H  "`t a@^  % "@ybآb '+@"@(  `H"@jb00P"8"a!@6 :00 0   a0b@@/ @a0 a bX @#"@g "!xa ! Ȥ @'"  ?T"a@ef   N"ab@ 0@ `Ȁ A "!;   "!5  1"a@"!, @ ^`Ȁ $@ r`Ȁ  "!  "!h  "!\   "!| @G@??B   %sې" "` !%pqȐ   @@  !  @  ! " %p @@ؐ@  pp ` # "`tp`A#<*` €! $! $#\7#\ *@@ #\@#\ $#\0& $#\@b@L @?. @"a#\ #\ *P@ #\@#\ $#\ "!㿐  " '    ) 7; `J *` €#`@ !` $!@`a@  @!@* $!@ % p "! `J@ -2 J` "! ~'"!z' w" |u s  "am"X i"a f% p@`Ȁ a@f]Z% paT U"aT Q"a  " |L% p0"8 D"a @"a@-`   @c@Hu `,"?'"? #"a!'  "a#0"a#@ #P #`#p##"a@ ؀?O? $#\& *` @ p 2 % %" %"'` p?   p @H"  p   y -;97U5` 7@O# ) %"(@h㰢 ! @)@ !@  @@ #@-  @S #c@  @@@c 2 @`@ (`% `@X` 6 @@ "@@c  `@ 2`"!  # # "`t@j @T! p+ ˒  k+ @Hh` D   !@8!@#  %"(c@h  !c @@  ! @@ #@  @ (c@m @!@@{c 2@`@ ".%a`n  @  d` @@ @@Pc  `@ %a !! "J @R  $!J #@$!( %+<@ @ aL `?,@, @ e`@~!  @ ?    @  ?` /,`ΐ P !  ?#$!X t"p"aP#al"|#!     /9 $`D!*` € "ad "&!P "ap %`p "a &| #h  "`t%`p %`p "a %" "`%`p&l "aTw"8 ~%`pz"a@@a`t"a@! @fc  % Ȓc@f @%@Ē @Ő @`V c@Q @O`J - J  B% ?%! # 'b" @ H  0"`t `P@*  %  h@Ebآb %)@@͒(  `H@6"0@ "a#0 "a " "`t@@2(?@?#\`p* `G@!*` €@ ? @K` 6@@@ 2@01@  b@Ր @q@"a `@h@  @b "!%! %ђ @""(   `@ @M@K㿘!! %`@T"   "hJ 6 `@I"@Ɛ 2@ "`?"`"ؒ * $"@Ӫ 㿘@@ ∀   ∁㿘 "``@k ! %1"@! 2@ 㿘 N  a@i c@H :?a(c@@ @0?L , ' @" , 2,@@ = @D 䀤`."@ "`"` `  ""  $L ې 㿐 @  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @ @  㿐@d  2  J?` '@  @@* "`  㿘 %b@!@@D? 㿘 %b@#@D7 㿘! %"@ "@{!"@w!8"@s!!@o"@D 㻐 %!' "N  bH `L@` @`\*`: @2`hbh@?  b@ u?,@@ @$b@  @Q_?`,@ J \2N2 2 *@ސ @6*bh$ $J + !*:  P" g G" 0  p"0 $ $@ݶ @,@"@ ?J   `h $ " l"`h  `l " "`l! @C#㿘 N  c @  c8@ ?$@0$  `$ $ `$ $  `d " "`d " d"` 㿘  `  )' %%  2 `2 @_#h @   2 㿘  ``  !`   \$  W !t`22 ` 2 *`2) `2*@g   $c@"  ` /*@6$  ` /*@$ @?$ J / * $ $ &  `       2    @9" &c@ ?㿘 ``  &!`/!p`4?2   #@.         J@ /2 @w 2  apap`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ !t`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  㿘  ` )/ N  /&` .  'N   . @ @O&`  $` @` `N  /"N ` 7hN, /3h` ? ,h  .,  'N,  ., @, @,&,`  $` @ƒ`  hN, /h? (N, h  ,@ؖ  *     , ,,@ǖ !`@     ,, @,㳈 %a !'@O -+)'%!r@DX@B`@@ @O, :@y @30@,O@+ 0〢  .@$!#  O逢 @!  !H@ @`@,,,&,& ? @Aq!x㿘 @ ? ` ,, @ ? 㿘N@`/ "@l$&@a@ ?  ?*@  * . ?*@ .   %! %?`h''L@, F D@3  @ 2  ,@` @* @#@p  %?Wa@ Z L@ @"@  L    ʐ    2ª  ?@0,@` @@L  @,@L  $aȔ@d % O  O耢   %"ؒa@ O"ؒb@O耢  @9L"@  %! @@"㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @̔:&* &H8㿘 @"  "a@C @e!@" L@ #@o ' %J?`/"?@Ґ  $c@ Aᄀ @ݔ"ᨒ /* "ᨐ_@N &+@B %  p` h*` €X!`c8@! ׯ r?ᄁ㿘 "aT "cX@a 0c@\ ΄@!d`@@?" h @   ?@ @   ?@ @   ?@z @ 2?@o @M#   "@   ?؄\ؔ"!`  '''@"   Ȁ    @ Y @  Ȁ    @ G @  Ȁ    @ 5 @  Ȁ    @ # @ڔ  Ȁ    @ϔ  'ؐ @Ɣ @    @?@  ȴȄHǔP㿘  ` @s 2   ` @ې 2    `" @   㿘 "S?N # `   !=@  $`8`(N # \N  #" @Ö 2 ``@ ? ,?  @b @G!=@`, @ " 2@=  ``@  ?, "  "" 㿘 (!=@ `* `"  @ 2` `2@ 㿘 "S?N # `   !=@9  $`8`N # \N  #" @Đ 2 `@ ͐ ,?  @b@ @w!=@6`, @ " 2@ː  `a@  ?, "  "" 㿘 ,!=@  `* `"  @ 2` `2@ 㿘  N a0@  / "N,@`N & ?А , *: * :  .2aH 2aH @ P J 2 @b  `ap L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ a@  S`L@  @@rR N$`$ @ 6  a $ ( L $@~  6   a@ @2$  $  @ b@ ؐ @ ? ` $  " "`   ` " "`b0@  ? `AH@` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@N`   & J?   ` 2 .2? 2? J 뀢?@lw  @ 2?L?Г* @L *`В@ `=r$@$@` k!*` €N Б* N * ?Д * *  * 8$` "NNБ*` N * `?А @$` ?Г* @N *`А@$` D  d$`N?Г* @N *`А@$` ,  )?$`N?Г* @N *`В@$` ` `""?N?Г* @N *`В@`$`  N?Г* @N *`В@ `;$` ?@pb&@?? 㿘1  2 )@   &  b@  ?㿘  `r%`$`g )@ `-  :      @ 2  @ 2   , @~i,l&,,&  `  &  ? $  $@@$ @p  @_  $``$  `$$  - ` $ @ $  "@ @b@ 6 ?㿘!  8#`$`3` / - +`@) *  "  2  `   @ 2  @ 2   #@C@A㿘 `   *@  "@`@,@*`2㿘1  1B !G@  & c@ Ő 6?!#0 #01* * * * * * * * * * * * * * @!  "`!@ 0 @!@@  ?㳈 %! ` ' 2  1@G- @`<+@2(``!    @ ` `   @ch@  ^?@gG@o{ ```2@`  @`  B$`@ @R  1!    @p  <` @?  @-  $`$@ $`!" @@{@ 7  `@rc@  `?@F? @:@ 㿘1  2 "@:  &  `@ߐ ?㿘  ``H@Ґ I @Z"`, @`0` `@@|Ԑ 2```@|ː + @`@^ &``x@ @^  &@@^  &``,   &` " @@@ؐ`@ ?㿘!  @@ " * @ @| 2   @|e &@&@ 2㿘1  2 !=@  &  `@R ?㿘` @  ? 㿘  `-!=@`, @` `2` " @<  `, ""  "" `@  㿘   ` }  @ 2  " *     +2$`& `W& `R   B`25 "5 @ 9"" "$ 5   &z   @!q  a  &` @  `"" "$  &   &a @ aP@  㿘1  2 !=@Ӓ  &  a@x ?㿘 `   *@       2<㿘  `6!=@Ő,`@     2  2  @R  @\  $,`$ $ $ $  $ " @ma@ 㿘!  &!=@ *      "  2  2     "@ & &@@@>0?㿘1  2  @" @$ &  a@ܐ ?㿘  ,  !` @2  @4*`  $଑* $ @\&, $@ @b(@ 0 ` 4` `($``  4`$`$㿘 ` -    $+) ' ,`aX     x   x 2|    @@$%㿐`@  @6` `   *  `'  * @|`0H``|                                                 <<D$                    dXdd㿘 ے$ $ J@" ?   " @   (  ((( ( 0(2    0( :( ?   @    *  *** * + 3` ` 03 *   0*:* ?  !    㿘a$?N b!@kh    茔 Ւ"? "a ?㿘-)'+/$%@y0 ! @y*⸀    b@   "`p?   @  ? % ~ ۢ" 㿘" !ΰ? @w   & $ &`?  Ė,@j d&Ȑ, ,`@b d&,`d   / &`l   (& `t   ,&  `|x  P 8  ` H&     ; @& 8&  :N` `2 `5`0"D., 4@., "5;`L4:., `K&7., N`(@  & X& @  &  &O& K  P@" a  b& 8 6: @&  &.&., &,K /`  `$` &  & & `P@`  a"@   b  `` & `& a : :K /2 +?& 㾈  % ` '-#*` €! `$%İ  cH cx c c, d, c%   d ` !@d d ,.  :?, /,  2  1,,  d, d   c!P ,d  V` " @  b a:!   `dƖ < (  `l 3 ,  `t * @  `  !! `   !  R  ?       `@@C  a @4 h㿘 ?,  ?㿘 ?  ?㿘a$?N!Y N "?b!@i:  2?  ] "? 㿘ݒ"  ?# `@~ `$ & `& NaY    ,>aY /, `?  ,Ė"@@a d&Ȑ, ,`@X d&,`d   / & `| y  P 8  ` H&  @&  8&  ,.aHa)ے 6 (`t  & (.a(a m ``l  &``  ;@ 8`0& N``L#(*` €  @K     $  &&  & L /2} &y,N` 4 `  ` `  ` & & aI 埔  aQ嚔 ?c , *`  0P&N` 2   (@ & B& `   `$ & ` & 6& N` K  P@" a  b8 & :`P@`  a"@   b  &` `& ` a: : 㽘 % !`'`B`p``   , c, 5` @> `* !@I'    :, Q , /, ?","  d ?` F*` \ € 54, ` 4 3, 0 ` I  ? @ `2 @Q     6, ` 1 2,,  d,徐 |   % `  0 7,! P @" a  b   ;@|    `b @` @`(l `  !  !?} "a@    D  k ,t 9  !! !'!?V "aH@ !   D!   d  : @     21 ( ܒ  @  , 3  @)!Y   V!  ϡ  ?       a@  a @1֐!`c` ?J/2 J"`4 ` 㿘` @tZ:@&乒㿘"@Z  @z b!   $ b@z   "`@w~ @ !` b b@0 ?㿘!  'H'L'P'T'X H@@xF 㿘`   @O 2. ?@s 2* 㿘'P'L'T'X L "a!T` 5 %1!  @x`@\ &!!b@@ؒ@ؒ@N 㿘'T'P'X P "a!T` 7 %1!  @w`@3 &!!b@@iؒ@[؀` @ibH@[ؒ@ 㿘@[0                         H X     t h $4DTdt4tĝ %!  '//'  @C  '|'x"cb@$ @ @Q#@%@E+  `Ш /'d; 'l'h'`'p't 3* @€`   #@]"`Ȓc @  $'|$ @$@  !#H@i& @  %`$b@Mw `@K @`Ƞ 2 `ȒcP@p  / , , ,"$`@% "H =`bP `Ȓcp@O X `@  `@hݐ c@> `)=` $ $/ %@f " `@h cH@    #@˚o `Ȓc@  f$`@t$_ Z$ V$ R$`? #  @ E# `Ȓc@  $`Ȓ   @2'x`Ȓc@ѐ  $`Ȓ   @{/`Ȓc@ !$`   @f#  #``Ȓ`@ @@/?? $#\* & @ @`Dbh#"#""cЉ’    H`D" @h@ *-`@J "@ 2 `(@h -` @ @q!##   `@@S `̀` "` @' `h@    ̒ @ -̒`@  @?c "##`< 8  %#c c+c *" "" @  `p@X  @?c @Z  ?c @P @?c$@E  <` 8  %$ d $ d`x@Ӑ +  @& #<* @ *@@ x"cc, |4 4 4  , , $ $ `$  &<` 8 2 `@  ?   '/?//??? d @ ( 6@n @-    @ј  a@    @  a0@    @   aP@  '!?##`@ј ap@ @'?#`@  '?a@| ! #a< 'aa@q  a@w  a?@4 `!@ ` `l@' c@   c@Œ"@~z `@~v !x@~r @2 2@b  4`*`@N  `h@! #'  @ ''@ 2 * +  & h  @U  ' `@}pp  t@g`@m͐b0'@Ӑ `@ @ː 耢`㼀 @'@] @, 㿘@?@<`@} c耢#@ c @Д 0#`   @y~ `"   Œb@}ِ @ϐ@"㿘@  @Ր @"?c %!+ `Ю' --   Ȭ 5 c`!*5 #05 @4`: @4`   *@* %,!?# @Đ#' ##' #`И#* #* #*  #* #*  *  **  ̢ @bc  5 # 5 @U5 c#Д @  㴀@l"p?#c@,@@) 㴐   `Ր @  @ %@,J"x@P  -  @ #a@#'"@0&@ #@ c   V"  / / / / / / //?" "@ ''Вb@ ?? *`" * "* * :@B:@z  a  薂  B;a ( 8    1   :1  #0@: M@ <   #`?"'#@:  @   *@ - #`e` `Ԑ @[ v@{'@֐"@Ґ"c쀢` #@w  @y# #@ `@#   ̲  `@D @ ̒@# ̲ @ 6%#` 2 @X @c`̲`@  %`@  ޒ`#a  *  @@a @@oh@c +'  "    `D " @O#  ?  %#`' %` ?"`* "@     *   @ *   *  @"@I@c?Բ`y?    @?maЀ@ `'a@| `'  `'`@#R%`'a$aВ@$a@#ȴ %#'2 %` ?"`* "@T     *   @ *   *  @?@?@cմ?@#?@ ? `@#  % ? 7   % b`?"`" * $"@ @q"`  ` `? (?888* 2 ?cx %!?c' `/  % b`?"``" * $"@ѐ @pӐ" c@b ?#c@)?#@b?#-@)?c @bːc 8@)q@bc  P@)c@b`:# h@)T*?'`&'B' !B` B()!B ?@)+??#c @bu?#`@bm#f?#쀢``#  @uؖ  @uє @x`@ @[d ?   #@u  @wH#  #@u  #@w< #\ #@u#` #@w.#d #@u#h #@w"#l@(@b?#@a@ʐ  % @( 㿘     (   @u_@B: 2   B* 2`@ : b`D 8 怢`  㿘 @y   # @ze`?# @(A`?㿐`ݓ*`" €@!0 `O"h*` €@! 0@!@0@!`0@!0 `@ސ!0@ڐ!0@֐!0@Ґ"0@ΐ"0@ʐ"(0@Ɛ"@0~@"h0z@"0v@"0r@"0n@#0j@#(0fc#@@#h0`  00@#x @# @#  @# @# @'@y 01@u 0M@q 0  P@l 0D@h x0@   @Z 0@V 0   @M 0 !8@H@ 0@B!`0@>!p0@:!0@6!0@2!0  @-!0@(!㿐 @ " 2` 2`  @"X 8 ?* 2` @ "x  " @# '@@b @' @b,  ! %# @b`"`?"`" * $"@` 㿐#` ' @ɔ  @e'!H"@'!"@Y'!"@' !"㿘 * `  * *`@ @"0`   * *`@ @"(N@ ĠȢ̂ЈԖؘܚ &H `@ ` D `@k H 2H#l;p#\#`#d#h;x;#cH@ȭ ?#" 8 @ @ `. @ ( #`@+# @ #@#b`@&@ 02 2 0((  ``? 㿘 %c@ "@&+ 㿘@㿘` @] /%#)!+-1 %'5 $-9€ 8" * @€ $ !$` % $# $` %` %$#"@C   $#   %"@`0@%Ґ @0(?А?\ * `@  `  `  # @0@d@l" `X@ʐ @% 㿘 %’``"( "+)'%¢ `h @hӠb(   p@F- x@9$   %@ @k 2㿘   % %$`  `` 2   ` `` `@, `@2 ` `  `` $?"`` $* $@ $Ȓ`+#`` ^?"`` ^* $@c ^` I?"`` I I*#`k`/` M?"`` M* $@9 M` -?"`` -* $@# -"j ` &` `  `  `/` ^?"`` ^* $@ ^E` ?`@`? "`` *:    * `? "`` ,`:    `* $@"  ? & @k7  &  @  @ x  " 6  `@`X@r 㿘 %"(R ’`` "+)'¤ `h @g|   @xj  x@$ T` %@T` @ 2( %Rb !`)+@ `X@( d*$ @H%c %!`@ %!@@7 ?2X@  @!@ &c? 2   @ x "`㿘@1)|))))))))))))))))))))))))))))))))p))))))))))))㿘     @, @# `@?J@ -B  J@ ( ?* : `,ʐ ,*`        "bÐ "`  @ @`J 2   ? `@ @ @fx  (?@c@  Ð @fl  (?@c@  `#,!$  " @fv@ 2$$ ?`   "!*q  "Ā @ @@#  $ @  @@#  !'Ð!` @f'  2Ð!`@ @"  4?" p " t@@f4cȀ  @@r ?`@"  @@f"a@ @Ő!` c @"֐  `"@f@ 2  2   " $   2   "c@ `4  2   "1? ?@` c@n € ?`@` ``2 `@Y €?`€@  "?` @ * !   !  (@ !\  @e  @r  @ 1   `0@h  !  ` @ea   @r `@@T @"0 㿘! !Ȁ?@%  @X À "` ?$!$!ȁ㿘 !#` %0`P@- @r 6V @``  az@r ` @"@r} 6V @자 X"?"` 0a@rn 6 @쏐 h"!X"!X` 0a~@r^ 6 " "  h) %!'' Ȑ@=M $ @dܐ %0 @r?? @D "7?@> "1?@8 )?`x@ ؐ @v '`@  @r?`x@   `@  @|! @! 㿐   ! @E `@} @0J? &    ?@Dc `@]   `,J? &      @dh 2 @Vx 2 J &    "{  2°"В ! @   @  @Y !`  @   @  @I Ô @d  @d      &B @  ; "   @d  24 ` À` `")    `V @2  @  #,`#, V @2 $ @  $ 2     Z`@E`@{  %Ð"ؒ`@] @ } 㿘J !Ò`  @c!`  az@p!`?`@ 㿘!Ò`  @c!`  ay@p!`?`@s 㿈  ?' 'à #0ax@p͔?2`@\ @{*  a@S ax' @p'?a@@F 耢 4' @ ` %` ?"``* "@X @͐!``@  %`?"`‒ * "@@ @{c㿘  ` ""!"!\ 8  2`€㿘 ` € 㿘 ` € 㿘 ”` "@pDa @f!h㿘 `x "@p2a @T!h㿘@ (   ""\"a㿘    2À`6     @}ސ À`" ’  "!\""!\㿘@5!㿘    # p% %'’!`@1 #` 0a@oה `X@f `  @bdWÀ`" @@"  7` a@o a@I  @!ȁ` Ä4d d4d d㿘!@ 㿘!@㿐И"@'   @~ aؔ@ @TZ  R  a@ a@b Ð 4@" p " h@baЀ Ð 4@" t" l㿐 R   a@ â L `@qz  b@ @Aː `@Ő     2 @aڒ` 2 ?? @@ 2 2 b8@X $` @C$` 㿐!Ò` ' @a!`   #@!`"b`@7   @na @ "p㿐!Ò` ' @as!`   #@Ϛ!`"b@   @nĒa @"h# %a'  $@|Ò` @aG N @|J? &    b@ސ @a+  b@Ԑ   a@n?ab@  @g#h# %a'  $@|Ò` @a N @|J? &    c@ @`  cH@   a@nA?acp@А  @!#㿘N 0    %#x* R  x" 2{ zN" & @  D "  & @  D #@m  #@#a 8 `  &     Д `  %#x* R ?  `* &     Д `  %#x* R ?+ N \2 `" N @`8 2 ,  N` `@`)  $@ 6&"@{ &㿘 `   0   %#x* R  x#0 & @   2 ` ` & J   2 ` 2##@惔0@怐#  @x# &`# %a ''ĐȒ Ā !/Ò`  @_!` !`0$ a@m a@6 a @ x# %a`''7@  @a@zÔ Ò`  @_  a@l?a@ 8a @ H% %'@7Β 8x@7ʒ @ '̀'b' X@9Ē '̐!'Ȳ .`А?``"@ NÐ `@9ʔ  2NȰ !'N  &    ( N  :$ *: ?'̰   't`pNt /t.`" " ``  @' x't 4t t''Ò`  @^  a@lS?@t  @3 x# %a`'?#@76?c@  @aÒ`  @^  7a@l ?a@A a @ x% %'Ò`  @^#` 0a@l?` @!  'a@k?@! @Ӑ!p% %'Ò` 'Ԕ @^p#` 0a@kҔ?@    #@Ԁ'a(@ `  a@k?@֐! @!@㾀7 %!'!`  @y͐#$ `  @^,' 0@ka  8@y`  @^ 0a@kx  @y`  @^ %0 @kp`  @y`  @] 0@kaaH  @y`  @] 0@kRa0  @y~`  @] @kD   ``% %!X@~ Ȁ 4 @~!hɒ`?"`` * $@א `p` `?#@`@A!p`'7X@m6   \X7@'@-!  !@~ ,  , %@    $@  0a@jє?!@~w   `  , @ "  "  & @     :"    X@7   @ѐ!  %` ,?"``* "@B ,,  ` % X@~4b@  %  ـ  %`?"``‒ * "@  ` @㉐!` %@ WD!!x@z! %`?"`‒ * "@   @  @ !?cP / % `'%?#( % %?@5  )Ò  @\'  a@i H А@4 Р@4>>' ' @\~ 0a@i @"-  @"     @ "(?#А@+ %` ?"`* "@|  `| "0Œ?`@  @"8㿘 x %  4 @ϐ!h  %`?"``‒ * "@@  >@ⵐ!p x  @ @⫐! @ @⣐"P R@⟐"` d @♐"h B  B `2`@⏐"x %`?"``‒ * "@  ^?# @`6 ^@&b %`?"``‒ * "@  x    v* * 2 @bh# % a '" Ȓ  (@w7Ò`  @[ 0 a6@h  @ c@ """ aÒc @(  @ǐ#0㿘  0#bbȐ * !$bÒ`  @[[!`b!` 0$ a5@h cH@J 㿘  cX@  c@ %c@  `4`@,`$㿘z )c@ʐ "?c 2  @`@ ,  %"㿘T  ` @ "`P@ "@ "`0㿘:  `@ "`@ "@ "bȁ㿐 '  `@p 'a@j ?# @ ` `    @a8@T *` $P 2```2@"쒈 @2  22"㿘!@N? ΐbؖ@ 㿘 !̒@;? b@ 㿘@;  `@B  T@2 ?c@ # @ @l`p @rx㿘  `@2   @4 2   2?㿘` i@ਐ#8"#H!xm#@c@ !`@` 2` @ `#P@ 0 T` 2*`?# @ # 2!` #`#h!x@` c@ p!x`@U @?# @ `` 2@6 `@E#xp) %!'!x// "@u)Ò`  @Y 0aK@f : @ #\! @r c@Yk! # @w#\! @rǚ c@YO!#@! @#) %!''Ò @ݐ   @!X`@ϐ!8 `@Ȑ!H# %b`?"`b * $b@@ ``  ` "  ` @@@ߦ!X  @t  @Xh%' 0a@fV  @t @ߊ!h@Q30 Ȓ  (@tv  @Xؐ a6@f< 耢 !@ 뀦 @p*   a@ a6@f#'쀢 6a@ @Y!ؒ  ؀@;b`?"``b * $b@Ɛ b`?"``b (* $b@ ( y b`?"``b )* $b@ )% %`?"` * $@  Q@!#̢ 5 &# @2!#̓,`  2 #@!!x  @ ` `  @ג ` آ`#̓,`  @Ð!ؒ`?"` * $@< "Ā '  @   2耤2@ޝ! @ޙ"(  @ޒ!`@ ` `@p3    @ 0#,` #, *!q @  $ 2 * ! @"x1 %! 'a#`  %@ +!`P@ +Ò`  @W`)¦!p @rא '@xڐ@7`  @W`` 0a%@d` 6 @ 1@ " @s /"#/ )!p @r` 0a"@dΔ? ` @ 12 @r ` @"(`  @WQ`!p @x'ܒ@"8#@"@ 0# ap @rx 0a#@d? @١ 1 @r @޲"PÐ!`` @W ap    %'@x[ܒ@ݸ"` %`?"`‒ * "@0 ! @P"p㿘  €   "a ?? * " * h+ %a''    @B +&a`P@Ɛ ސ  #\! @p, ax@V!"@W  @В ! @rAÒ`  @V @qې 0Ha"@d @ 1"@" @r"  / / #\! @o ax@Vq!"@В ! @r1Ò  @Vc@q  0Ha%@c”   @ 1 @ސ"  @|@"Ȓ ! @qݐ  @V? @qx 0HaI@c  @آ 1#@ݹ" @ʐ" @Đ# @ܾ# @ܸ#  @ܲ#0 #@@ܬ !Ā V ! @q  @U @q3 0HaQ@cX 6 `@] 1">@s#P9  "2@H& @|#h` &@"#x@n!`@i#@f#@ &@"#x@X!`@S#@P!a @#㿘"Ё㿐 " .` ` , ,  @.\ @̐ @@p 0@  #@`  @i$ c@ 㿐 " .`   '  @y c@  `, ,     @pݔ 0$  * "@  * *㿘  N 2 , .`#@ȕ2, #@2p %`?"``‒ <* I"@3 <FN, 2 : :  %` ,?"``* "@ ,* : $  %"`:?"`` "* #"@ * :  %NN 4N` %`?"``‒ >* "@א >㿘`U PN@. 2 : D  %` ,?"``* "@ ,@* :` . :`  %#x* R  %"`? "`` *:  "* #"@ `@* :` ݕ:`N@N@ 4`N@``p ".`ؒ  @oސ  ''cx@ՖԀ  @cBcؔ@ߐ ` "`c@֐ @oa `? ?  `  ` `&`6` @,ԁ㿐 ".`  '   @xd c@  `, , ``2   @o 0 @o} ` ` ,` ` "@ * ,      " 2 "   2   :2" 8톀2  &  㿘 %c@oN"@nh) %!'  $@o#Ò`  @S' %0 @`?@ A!@ ;!`@i  @dÑ4` '`@_  @`Ŕ?`@T   ``@Sl  2@ #8@ 쀤`@ސ!! @ Ё㿘!  @%!㿘@o !@=!0Ò`  @S!`!`  , ,  @!   a@`l @ڎ!(㿘@㿘 D@S`D㿘 D@S `D㿘`@ @ (`( 4   ? ,`,  ?㿘`@ @ (`( 4?    ,`, ? 㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ 0`0 4   ? 4`4  ?|㿘`@ @ 0`0 4?    4`4 ? i㿘`@ @88@4 2  @<<@( @ `@88@4? <<@?>㿘`@ @88@4?2  @<<@( @?`@88@4  <<@ } ~~ ~0HXhx~$~T~~~x㿈@W]   @l!8 @* "c`h @_  ` "# "a"Ð "`@)À  Ð "`%+' !5 $-7À`Gސ#ē*` € % " ""$Ò "" " $"" "#!o% Ò ""!"f% Ò "" "% \$ "a"$T% Ò " N"Ò " H"Ð D"a A`Ð ="`Т` Ð 8"`Ò " 2"Ð ."`Ð *"`Ð &"a Ð$"`! Ð "aÐ "`Ð "` %` $Ð  "`Ð "` $@e@3!@?h?\*@`& ! ` ؀`!`  ` "`   Ȁ`!`"`  ؀` !Ò @u &!: $ `䀢 % "  @  = 7 ,5#0 耢`.!p Ā`"&"8$ "      " 耢` !  Ā`!ސ D"` ̀ #!`"(   < `# 8 %@  c@ 㿘 `"Ĕ @   @$ @@q  Ȁ`j а` `  @ /-+L) 8`D  "N`D0B3 "2N`D0= . 5V`8  Ԁ`3 `@֓` $`@֌ah&@@- Ѐ @ 0@!p0N`D!``D`@F`@%@I 2`:@-`a@  %!'H'D' U ! ` '`!`  ؀`H '`H'x'|' ''t'p'l'h  'd'\: D@EƠD@! $ Ò " 2 LD2( Ȁ`2($ .2 ( Ԁ`2( $ | 8'|` @@D (D 8' x 8'x88 8<8! `z'!` !\@  @ ! \@_ @ @jh4'h@jl 4'la  @rLN !@jp@ 4'p   `  @g  `  @ڒ   @N$@ @  $` @Nϔ<   't ` @  $`@NN`-"$@g$d 'd2(:d`S|'`'H 7't''! !@ @jE'l p''!@ @j9'x! @ @j1`܀ ' @ s@j#' 'h' @!Ð  "`H  %@f % @ !ȁ㿘 :"0 @`: )   "  ?="R 8  Ȁ`2 À  ? @€㿘P㿘  "  @  %` ?"`* "@    2 p %!'R8 !` ؀` ` @tؐ@v!)  %"  L?`&  @  b* $b @  $ 0bb`?"``b * $b@ΐ  %"  L?`&  @  b* $b @  $ b`?"``b * $b@ 㿐Q iR 8`!` ؀` ` @r[@! >' % 6􀥀` ? "`* $@f   􀥀   %" `?`$``@ * $@G 2 `?"`‒ * $@1 㿘! `    ؀` !`2 `M% %` E >` ,?"``* $@ , `( c ` ?"`* $@  ` ?"``* $@Ԑ   P ``2` `?"` * $@ 㿘<@ %@ I0?(@ 0@+ I07`?"``@ /9 /`?"``3 |, | %`?"``% @ @ %`?"`` = = %`?"`` *‒ ** "@[  㷐 %V 8!􀢠'2  H D@$  P D@$@g(#@u@@K %"ؒbX@ea. @М"h@(a @A"p㿐 ܠ`@AG?"@}0!@v㿘N 1% &#Ñ*`: ?  J   2N`쀢  ?N %"`?"`` "* #"@̐  N  㿘   %b@eH"@h 㿘@KD   @x㿈@  @dJ?`d   "# "- ) # ' !+ $`<!ؓ*` € %# $c $c  %  $  "c @@>?ܒ?c\#*`@&  c@ېc   "c 㰐@ /   @*  #`` * @*?㰀   @V  @S @9 @"@2  @ڐ"  @ʒ @ 6   c(@0@ ?7'@'耢 " # c(@H@o  `@ @ !#@f " `@ #(@ch@U @ @  ' c(@t@B =##` `, "@`L 2@`6 #* $, @n, ?@n  @ʮ`@ʨ@>~ (@;c0 @>@єā 㿘@6  c@ O?@h`  c@ 0 @`' X   c @ @`K4? X@c  $ @̐@V "   $ @e$ ( (`$  <$ @  $ ,2 $ ,@Cc 2$"c @`?@`㿘#   @`  T @`@``$`"  `2@ `2` 㿘@    `@P @   @_& P    `@@ ?*@& T*`*`*`*`*`*`*` `@c  㿈 @Ȑ c  c'쀦 ' @@ D@ f @4d @ #`  ,`А @M  ,`Q"̓*` €@H    D& ,2 @& ,>& , @ & ` @&  & ,  ` $ 8"@`& $ & $& , ` #`@0 & , 0@0` @ & 0& ,@_ @耢   D쀢@&'  6' D' 2 @ 쀢  `@@ѐ 4 @ @ À@ Ò! "`"! #@ " a "a  # А"@# &!  #` !  ! `X@ ! 㿐 8@  ,4"* € 4  && 4 <& 8& 4-  #`  ##& 8 & <@c!@"@@l"@& 8"@@蟐& <  0   & 8  ap @Z 08c 8c <@& @& Dap @E 0#@  8Дb? <& @ & D?/a & @& D #`  <ap 8Ȑ @" 㿘 ! %@aJ?`d ! %a@a""@ab0 b(@a""@abP@Ґ 㻐 # %a'P 'T'X'P # 4a! % @ꍐ""@abp ax$@Ґ@'a @"㿐! #Ĥ?' ? $#Ģc*`@^ #Đ??$# "$@]$$@% z  P) `F`2E`2B @"> `29  Ā .  @E  2  `2(Ā  #`$@"`@]*` 2 b@b @&$Ā *`" b@V Đ $ 2 Ā`"`@]*` b@A $* "@ c İ  !.   @U"Ā@&p c䀢   @]D @ $cb c耢  @]5 @  $bȔ ? "cȔ c*cȖ *  " " " " " " ! @}#  bȔ(#  ~?  @ :1Ā &#@P?@;&bȔ@ 0i'Ԓ ) @aؘ  6#@;@; b̔P@ 'Ԓ ) @a˜  6 @%@: bh@  ??`@??'# : @a ?"!Ð!($#<cc\# Đ @"  @"#<%#`"" #L""" "" " @?@:bȔx p  Đ"c '#c #'' % a '' ''' T "  P" ` 8   $ )## # #  """   "  ?  @      # # ##   ,% (c @s  P@" 0@ƀ`2 #`$ 0@u@:Kؖ  0 & 0 @E#P %!'!Đ#@M     @M@:#`F#`  `)%  )   )`$ )` ) ` ``"` ? @   `2   H !p !# @ Ĕ .cd@dא `@^z   .cd@dƐ `@^in c! Ĕ .cd@d `@^RW L!`1#d? ? #d  .@d `@^5`  .#d@d `@^#H) !#d .@do  , x  L , ` $ L``!$ ,s$ 0! @N! x p %!' @Ő#cx0a@PH @M?@9#aސ J􀊠2!7cx a@P. <?@3@9 a.  !@T  !   !8   !H    !X ? @א"pH %!  Т '???? @M)#x0a@OД 6@@8b,  A A29  ( 4????? @'#x0 a6@O @İ`"& (@Ī@8b 9?a` Đ  `   a @l"؁ G  㿘 .@ G.` ` .` * * * *  * b@Ɛ H   ?''''   @_ǚ H @Y C  @_ @Z7 @@%  2  T@`" ` 2 @]^ 2 @3ڒ * @Y @\ @@Y0 㿀   )'''''  @_k ?㿀   )'''''H' H@_T  ?h %!'  @g @@7 c S0@! @!@̀ @ð@7 c AH@ `K)+@\`@\ې2=@`@\Ր@3U 23@`  2.@ ? ? 2'@ ! @\ @ @@\A0HaI@Nf  @k@7A # cX@̐ @"[@fǐ `@"R@f? @0#x : `" @ ``@ "` 㿘 c쀢  @Xې @  &#c 6?  @ ;Ā`"#@?@6c 0  @ #Đ#|   @" " " " "   @?@6c 8 %!  '` @}  @@6cȔi Ua !(@[cؔ @@R0JaJ@M @º@6cȔK 04`( 1  /-"" 2  @ 2`@ ` `@  .@aw  & `@@ `  ؀@ea @W @0' %`|'  `  ? ? ?  `"|//'''''#@`"``  ` #` $ )#@#`#``"`"`"`"` @  ?@``@      #`#@#`#` .@a  @Z3`P` c @ @Z@@5`Px  @ 㿘@?\llllLllll,llllll<lllllllllllll llllLllll,llllll<T((((T(((АР((( (((((((((˼̐l(||((Ϩ0@(`Ѐ(P(t0Dh\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\  4H\p\$Lppppppppppppppp@pppppppppppppppppppppppppppppppppppppp` %!E'" "``"'''''''"" " " " "  Ъ ')MX '''ЖВ('7%M-M/M''''8 /* @€!* h%!L  * :  2* @€ 4 4 4  4 4 @4@ L  k@G"Ȓ$'$@Q @>'`J` $J`O`@jg Ȓ$@ M  "a,J`$J`: `@jP ! @/%!@v  !@ "a@j?  %`%!@. '!@Ȕ @$ " J $J`a(@j !a@@j !@Ȗ'%!'@Ē$ȍ J !$J`aX@i "`9F@v1?  @3 ax@i Fbh "'" …DB'$` aX@iѐ  !! #@!@;a#$`! %!@u " @| "a@i $@.  'J`$J` a@i ~'!@*@y%!!;!@ %!o! j%!b@i   ? ???   :'''' @[X  X@Kb8@if Ma8@WXE @M"! :%!Ȓ$@Д   " J`$J`" bX@i> #Ѐ bx@i6 !* !!%!!* !* @ %!@_@ࠀ?U? $c\* & @ @N  ? @J͒ 2'b@i !@ . @@    @4 . ?  ?  ???  :??@ʖX " X@K7b@hՐ   M" M" X `2 b@hĐ M@WOX @ %(b@ !@E  M@(8 b@  4  ??x??   :'|''@| "  @Jb@h  `!!@c  )` (@X` c@@ @_ !! '( ) @X  (c`@  ) @X  c@ @t@@t@! ` c@h@ @(   M"TM"!T!! )0 `!0M "T")0@S 'c@k !   /  @ ?c MEa0"*a0 *******@X$  ! `@ '?(c @XG M  @`'( ) @X; ?c@( 䀢`!  '( ) *@X& ?!c@ ؐ   ?p?X?`?hh  'hh 'h @V ( :ؔ @X !`@ ! '( ) @W  `8@ݐ 쀢(' `?'@R  `" `P@gs E"  " 쀢 `%`'"`"`"` "` %` )%` $E%@``8` `(   @p 耢 "``p@gB   %` )E%`%`%@``(` `   J@H  `@g  +'%#, @ @ " @Il@g    ` @g @H  `@f @ ޓ, @H "@`@f E`Ȑ  ?@ @ !@L '  @8 Ea@ MM`8` ` u` " ``* " " " " 2  )@W   Ma@ M@_8 6Ma8@ 8@ aH@ @_`#  @aX(!?##`@Vۘ  (a@Ȑ #`@VϘ   a@  @@ڐX0?'(c@V  '( ) @V  (@-a( ) @V  @"@@ (?@1Ma8@  @)M@  @!  '@ ??'@G @G !`M @G  ``''Ĕ ''@Zi M$`M@M"E"`E  "E䀢 M@E" Ea E@ M"E耢 !@E" E ?@ ( '7@^   @`E$b(E 'D̒ $'<'8'L?('@'H(?0'(',@] @``E0@u@U E@ E!!@|8E@M,`EM @M @`?  E   M0 E0  0 0 㿈@; M! `   B"pąB' ' 'ct'''@F  @Y M2 2  (   xM!,`M$  ? $ |"$*!E  . . . . . . . @ڊ: @چMa    ,* &,M a0a0  .   . M `  - .  . . . . . . 6  . . . . @SX  "` M a0a0  .   .     6  - . . . . . . . #. . . o. *M!M 00 `* `2.  ` . ` `2 ` `- . M. `. . . . . . . 6  . . @S   "`D M a0a0  .   .   6  - .  . . . . . .  . . . #. E MT*`,2`2  - 2`2 . . . . ` .  @ ''ܐ@   `Ma(ME  ?#ȒȖ "` '? "`"` '@Δ a 6M@"xM! "@a    ` @v   E (`Ą`?㿘M a2@F `?㻀 %@!' .S-   `?$  '$ @-l K`M @2J &@@`+=`) &'7  @J   Ⱄ⸐@$$ې@-?Ր  * ` `@@-':  ` ``2  %@ @"@ %!' '@  `?@ M` M   M!as@"p %M!ai @"@a %@@#W %@& 2@#8M % 2  M M *`  aT  /"  @ ''@)a   ȅ   ?` HD LL? : H:`:   -: / , |E2`  @j: L@e <  M ! `?"'! @U: |@Q   *@ , M!`ܸ` ` @ ! @w6`@#h@#!a  ?Д  ??'//  '' ' ' @S'@y#MaT #@p @k# '`Т '``:q! @  #@Ug! SM_ M'M , 2  # E `|$ @֐: M`|@ѐ <   M!`"!$ `|@: @׽   *@ -M!`I @#@  "     @ !@  ! 8@ !  * @`"``  `  @ݐ X!@%@!@.%@!   `?!' M'% &#! " @J  b"@ `  '4! 3/-)`p @ p@P  p@P?, 'p`x @ Ȓ $ ٤@y`h!!@s    %@   @c %@ ` %`?Q"``N0Q @N x     @A` @<` `"@3 x  ؀ '`@( x @$` 뀢  `@ x  @ %`?"``‒ )* "@ )!M!a) @͐@#@!  % % b`?"`" * $"@b !!@@8^" %! @y!㿘     0'%#  )2  " (    @@ @a8@%   ?  @   2 㿘 %`?"`‒ * "@ 㿘 %`?"`‒ * "@~ 㿘 ) % # @@]!H    " 6 6   " 6  6  `6 `6 ``$    *2 2@P@/@@6`ƀ 㿈!X@  Ma !    "@!x@@!@c#   &? % @ h0S Q O @/ `/ `/* ` B/.*2  * @  6` .@, ?#5 @*`  '`,`,`` ,X` 5 , O  ` * @* `M! %a '        @  @   @! % b`?"`b * $b@} `4@r!@F  " `9/-+)  @T  . @} .@PȀ !@Iab@Eb` ?"`b* $b@} `Р  @ڐ!   )   `   2?   )  $ `   2   `  " Є@"" @ "㿘@  @@M @B@K @ 㿀M! !M@"!$@" M  @"@M a`@"X!$ a @$'@"p %'""…F? @  % b`?"`" * $"@| a /M!T`+ '  ` ƅƍ"?#FD @3 ? @-~      #\;`"@D@5͐"@5ː"P %!`'*`# € `!#*` €@"#@p @#`k @#f @#a @#\ @ #X   * * *` @  H    "  @ @< @ X8  x@ `3 @   "     @ΐ  @ʐ   @Ő  @   * * *` @  !@ @*a@! %a@!0 a@!@a@!Pa@!`a@!p a@!a@!a@!a@~!в  @R) . 2a@{ .@l!  @R . a@{ .!@[a@V""@Q$  *` ` *`# €@B" M@="(M@8"@M@3"P M@."`M@) M!a"a  "   050    @Q . 24 @"a@ @"za @"' $ "@fa@"aa L  @Q . D  * "p@єKa@̐"@ɐ"  *` ` *`#p €@" M@"(M@"@M@"P M@"`M@ M!aa `@"a  ȕ*` @"a@#a @.#X % %,  *  *`@ *4 #? '*@g#(  +     2`#\@Y#H  @Q . 2a@z .@G#p  @P . 2a@zr .@6"  @ݐ#x㿐Ma@ `?#\!Đ#! @H 1!#㿘&@ '@ #h K ( <?!ܓ* € # #@#2 #@ `)*` #@0@@ߐ#0< * *   @Ӑ#00 * *   @ǐ 0$ 0@’ 0 &@  &@  %`?"`‒ * "@z. 0@ H(N@ ĠȢ̂ЈԖؘܚ &H `@ ` D `P@[ H 2H#l;p#\#`#d#h;x;#`@Ŕ #" 8M @ @ `. @ ( M!`@C  @ #@;`Ȳ`@&@4 Ё %!'@.z . "@J1"`?Z@yTNx,  & % `@  `  #x*  R *J 2   ???????????@̪w/w@̵ @̱@`ؐ @  @  @O|!  @ @j 㿘 %`@IƐ"@ 㿘@㿘@S#S"a!`@$aР ?L "  $a  @. aЀ`?#S$a@3 %S@$@F@4@ @!@/aԀ @-p!@-m!@-j!@-g!!"@  @0 b`@-֐ ?@-O @J@ - +J` 2@@/# 2@@/ @/&@   ?@@ "@@`@n `?  @  @A @N0@  @G@א  @    S" aԀ "@24 @)@=|@ @< @N  @  @a 0@w @Y @S @?@S 㿘@Hߐ  @@-$㿘@>y  "@@1 @6  JJ "  " J@! J ?( J@( 2  `J@   㿘 M!`"!`S "a@   䀢 S! @@@0Z@. @<@霐P\ht`' %% ' S"@2I# a M!h@G , $a@IHbX"h#`n"Y`2"Q`"KoĀ`KJjĀ`"K`EaĀ`Da,EZ !@"Jg"@d:KĀi`"9"@6A%"@"5#@-48!@"*p"@'(%2 "                     2`S̐ Ӓ ~Ր ?'SS #""(''////Mah@G! ,!S"ܒ @c@v"$ @)"X㿀# %a'bh @+ǐ @"@ِa @"x㿘 " NJ    0 @ " 2 @%̐㿘͐ "N@ " 2?@%㿘 "N " 2 @%㿐`h @8ܔ     2 2 S"!@x" "@ S" S"!S "a耤`S""@_" "@ S" S""S P"b㿐!M?!`'2' *` """ " """""~    !,! *` 㷀/ %'@ " "!N$"@$X 4 $"+#  $"`-S@0#S#S"b$#S"b #%# $b #(S"b #0S "b"bbSSSSSSS#!"a#a" "  S""Ma'#8N`"! @* #@N "b#H"b#PN "b #H"b S"P NS!Ԁ 2b#XN"b#`N"bNb 2N#H"bNb #H"b#h˒!N $!J 2 #H  "$!#pbN`"!܀J  #H  "$!#xN "J  #  ""#+N %aJ 2S#HS%a"a "a)!N#N#H#\#c !@a!aNN#\#@c%!aNN##\@!aNN#@#\K#N "b#H"b#Ѐ N#8#N "bJ #"b#)좒 "#HaJ@  #H @$A N @)"@EN @'@qN"a#좒 a#HJ@ S#H! @$ N @)t"@E$ @'@GN"a ؒ좒 #H ϒ젒 #H N "!@(HN"aN!J   "` @挐 N 㿘S!!N@${$""㿘N  N@ *`  "`*` "N@  ސې6㿘\t &&&k &#d& #H&㿘S"  SNS4"@$-aS" 2  NS4"@$!a  "`㿘!  S"  SNS4" @$ aS" 2 $ NS4"@#a$ 㿘N4!Ĕ@# 㿘NS4!Ȕ@#a㿘N4!̔@# 㿘N!Д@# 4@#Ԓ 㿘N"J S!4 @#Ɣ㿘@, 㿘S"H 㿘NS4!Ԕ@#a㿘N4!ؔ@# 㿘S" N4!ܔ@# 0N4!ؔ@# 㿘 !    0 @(@P@9@)8@J@: @[@K㿘N!4 @#W  "a㿘N!4@#K  "!㿘N!4 @#@  "a㿘N!4@#4  "!㿘N!4 @#)  "a㿘N!4@#  "!㿘N!4 @#  "a㿘N!4@#  "!㿘N4"@" 㿘 ?@,?@  "! ( @@K ? p@c   " X@,M 0 #   @ ?@$?쀢 @,. 㿐N" d$` ?, @  "   @"  $@ " ( @EN   " N  @ !S`?"x`?N"x  $   !`N" $ N@} 2$"xN" ,    "`   "` & > @ & & @ " #@ %N  * 2@  * @ @B ? 4 2?@(? d2d d@ d 2d ?@-  ?  2 :$ @+ bs?:$ ! ? ! `  ?*#!   N " $" @) ?倣  N @+q = N"  d;  B;d   & S", ;d0  @0a' @+@C/  S"؀ 2+?N @, `"` @ "@@& &@" #@  "`   "` & &  " # $( @[%N  㿘?  ! ? @+  "! N" `?( " "  "   2 㿘@ W? 4^ @ 8Y  c @ F%N* 2  $ 1: $$@) %  d45 d8/  d@?S"؀  d2 d@   8  +  c @ F+ 3` @* @ ( 㿘1N" d @d" :0@D?  "؀  @L?S 㿘 q N$ " 2 N@4  2 @( " 2N"  "(: S,?N 0?N $ ( 0 $(( @B 㿘!N"  @$@ ( ?" ?(#@`"( "(`B : 㿘1N" d( ? "d(d 4" 21?d$  " d  " d ̐B? "  ? B?"(: N"  @$@ (@     ?  8   㿘N"  2??0:0  !N??:" 2?!N" @$"  ;$0$0 $4;$ ;$@#$($ ?? ?#$ ;$0"  $ @*ݖ ? @)k 㿘` @5ߐ  N" ?d? "d;`#@``#`` "`"`#`#` `" "`   N *   ?㿘!N" @ b ` @"`@@<"b @2`" "$㿘  @* ?  㿘# `@j!N $$" $8@5~   ???:$ "$:$0"$ $" " ""$:$"$(` `Ӑ `" d ?"d `@G" N" d?""d:㿘!N" $  "  " d 2   2" @Id" ?"d` @O0!O@"0@> 4@$ 4㿘N@>"0㿘%O8@&@>`08@$`0$8%O8J "8#O@>t`0S@@ 8@8㿘!O#O 0`4@ O 0`4? $ 0O <N"0@O" 8㿘)S'O4+O"%N" 2  `<0:  @ J 0L@>1 @4""@2`@:`@ 0L 0$O`8%`<㿘)S'O4+O"%N" 2  `<0:  @@ N?L@>@4""@2`@:`@ N08?N"0$O`8%`<^㿘%O8J , #O@=ܰ`0!S"@@ 8@=ϐ"`0@@  88J  "y8`@%$8@=`0 @$`0㿘#O`8N"0@JP!O@= 4!O 0@ `8`8@=$`8 0"@$ 05N   㿘!N@="0!h 0@="0O8"0 @ 8 @*`@ : @8 *8㿘1O 8!N"0@  8*@`J@ 2 ` 8O D   8"0@ L"0   㿘O 8J V 㿘!O 81N"0@J "0 8"0@J 0  8"0@J  㿘1O 8J   8J 0  8J   㿘NJ"0  O" <O`8*``8O D   O  D㿘 @ Z?`dp "@*` hd1O 8J  1O 8J N !O 81N 8"0@(!OJ !O 81N 8"0@(4 J . O," <O 8 0%1O 8J  >- [O "`@ 㿘O`@ "`@@C  z  㿘NH0  06.@.@H@(0?д(`? H@F26N"0HXI I I I HlI I I I HXI I I I I I I I I I I I I I I I I I I HII I I I I I I I I I HKK K<K<K<K<K(K<K<K8K<K<K<K0K<K<K<K<K<K<K<K<K<K<K<K<K<K<K8K<K<K<K<K<K<K<K<KK<K<K<K<K<K<K<K<K<K<K<K<K<K<K<K<K<K<K<K<K<K IK`K`K`K`JITK`K`K`K`K`K`K`K`JK`K`K`K`K`K`IK`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`ISRVYQ]L`H^`]dVS`R@VXWW,]Z[Wx`[XW]^`XtT<TX^`RR^x^x^`\ZU^_pYdYYZ4]0`H`HUX8\^`^``H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`H`HPD㿘@*>@#㿘Os" z7O @ 㿘!O O  W"` @Z!  !T!0 N!@ H!P "B!` ";!p7!x! 㿘O Ģ? @!!O /"` `!``   !  ! ɒ 㿘}}O``*:" *` O @0.L@ +"` "`!  ؀ "L@@7%L@ $ $ O !OL @ , O  L`L@0O  L@L`㿐!O `/#*` ?Ѐ @֒  d} O:o$  #OL`  S SO`Ā ! ? +   @S S " Y"`k  !MS!쀦IL` G !O Đ ? ,`@ɐ   @aK @ɐ  -/// / ٖ : d  ?`; "̓*`   ! " @O`  "`0  o    ?݀   3  㿘@$ Sa? a?a  @d 0a@`0 S"0 !S"p @$"p$"p㿘 !$`O H@G@#1?SPO:S"X SS"4   @ ܀ S S""X#O`؀ @' @!` :$`@!qS" `؀  @9VSb ( @!_!$`؁㿐 b'!@"n㿘 $`O H@"$J"$ @# O   g   0 @-㿘! !$ !$O H$!$!$O @ !@"2 q !$* $!$㿘@8? Lݠ?:L㿘@!O !! @g @j  @Ɛ0+  >$ @  @  ` !O @+  `$ `瀊``"@!ޒ @㿀S!O 2  :  S"" eO" #SbO  O:฀  *@,S!܀ ?Ib؀ O eb;b؀ 2O e- e!O "/ "O  "/ O O)/@'쀢`H ??`c |*` b   bO` ` !O  ` S""!O   ` @: < S" O@ А   @ ; dOO` ` !O  ` S""!O   ` @: <    @ g <O!O    `   < S" O   O` (OO@ O !O    `   < y  !O    `   < gS" O   O` (OO@R O l !O    `   < B  q !O   ` @ : < ,S" 2 O@! А  ; !S@Abؒ S$",  "4  @ u b؀  S"؀ $", " 2OO` `  ` S"!S" 2SO@  S! @ I rOO` `  ` S"!S! @  ZOl x@#@&@=IO!O    `   < @  6OO   :  ` d  d:O@ OO`  ` @  O@ `OuO฀ S  :@(DOf@$'" ^>O쀢 J OOO ฀ "`     :\OO ฀ "`     :Jl!O   `O`!O    "`    < -   G O%O  ?  ? #O``"%O  ?  ? "@#O` `$`     <``  `$@%^]OS" a@"(@  MO!O    ` 8   <  @  9OS"P   S"4 `5  ` 2   ("H!'&"P!O    `   <  @p` O  ` "H!'"`@OO   ` 8  :@O  "Od"x  @  @ @_O@ uOO O" "0OO" "`0a  / 0b  (  Sa OS!쀤O  @Ob    Sa OS!쀤O  @|O"0@? vOb  0O฀  S` S S""" S"2  :  ::S@O : @   O` (O@ :; O S@S %" O฀  S` S S""" S"2  :  ::O S@S  "@#"0O / b  =0#S" "O"`vO㿘:L ` , L   @4w$ L@"L@,`L@  @L  ,,  L  L  *L㿘 !(@ ! "@* Ɓ㿘  @)  @&$ $$  ?㿘 # "@M 㿘 #֔ #@? 㿘ɔ #(@2 "@ >J@H  @3` @ "` g .`"+ ? & +`J`g+` f`J@`J@J@"`J@?`J@2`?`@ Ɔ d㿘 d  f   d f" d㿘 #㿘 #㿐 #ؔ @3 'N   #ǔ  pS!) %!'@ S7 !쀤@ 1  +, ,԰ ` ` 6 d` d Ԁ!?3L ?! !C! @ِ#h㿘@ @3/i@3)&@@  0&  & @   @  ?@   J!N@ "    J!N@@`  ".@ `@ Հ㿘`@2@ @*N@  N@ "`@ `@ J"?8J?   ?J?8?㿈# `܀ "@*耢?`쀢?`@!@! #Ā "  @`O`@#@/7#$# " ܁㿘   @0 @㿈+ `܀" @a`܀   @^ @ܐ'@ @ V cx@  # L'@ΐ '#@q@.耤@Z@.ڐ@I@.֐@.Ԑ@)q @'  '@'#@P@.S"  @ @ #'@耢 y Y@<-Ā@. " @ O"#"`@v%``S@maS "a   ؀ !  䀠@`?S! $ @@ @!! S" #'@@.b 㿈@  @ |     @ ܦ @.9 ! @~  @ ܀ @{@m 㿘 " @2 㿘 " @: 㿘 S"؀  @@퀤 А 耤  㿘ݔ 㿘  ܒՔ 㿘Δ?㿘  ܒƔ?㿘 @R "  @㿘1  ܀ " @  ܁㿘 @?㿘@-@8}    ` Z 㿘 @# " #@  K J#x㿘0@?@㿘@0Ȑ   J!N " N`6 J!@2N  2/,  ,N`&  J!@2N  " ,@@0N ",`@ " ,N  ,㿘#耢 #㿘1 #Ȁ 2 #Ӑ &# &##ȁ㿘. @> @ 㿘٠@0WL    *`J!:`@ J!@ L 2  L   `/ @0, U    J!Ja(@hN*`:  @"@Y ,N  ,㿘 - L@ )@/@/ @%   0 8@.@%; @,v @9@,p㿘/ @˒  㿘L@) *`: `#`%2 @(L`L "L`L@ `%`#2     ܀ "@ `@/`L@  @漒 L@1*: `#`%2',@(L`L " ,L`L@  @`%`#2     ܀ ",@٢`?" @@/` `L@  @,P% %'a !  @ߖ ?   @ @   @    @ǐ H㿘  @ ??? 㿘 d9  d@ ,,-@I@+@., ? $@ސ  $` ܒ$,㿘@ X )L &x  @.͐@.ʐ  @h@ @+Y``@@@+R0@9``hS!Ѐ KאȮ( @MȤ  ؑ,@6 "@.`@+(Ȥؐ孒 Ȥ 6ؑ,@ "@.p@.m%@x@ϵ@+Ȥؐ@Q!,@*@*㿐S"| Y S!Ѐ 2h Z? L/@ "Z L |  @.6@.3\   2 L %2 J  s2 @@. ,@. 倥`.@*  V @i  @ O&&@ ߐ@L@  㿘S!Ѐ K"@< A@-Ң @-ϐ@-̐ " 4 L %2 @J  s2   @Q@L@-`.`@-@ ݀ @*: @(ǐ@   <  `?@*!(  @-u  䞐@ cД@0$@Ւ S@L" <  @-Q * z@ c@@)(@G 6  㿘S"H  㿘S", S"؀ @??  S@ Sb4 "b4㿘Sb8 @U"b8㿘    S!?4 S"t  S!? 2?3SbpS` ""<S!?@ @ @bp    `@Y? @ @ "d?@ @ibp  CS?   2N?@ I? @  @   S! @ߒ SS@<.    ?S"pS"p  S  쀢 SS "b8S"p Q@S" S"Ȁ "?D? ` Ţ @Β?  @Ր ? S", S""4 S"؀ Sb4 "b4  " @d " @ %?㿘@   S!?S S""4@Β`@G? @? `@#@ ?㿘S"P S"4  w  E$ 0A@X??5 3` S! @ )S", @   @9     @1??  SSb4  "b4| 㿘@ ?  `@ ?@1U  ST  SpS #?㿘 @j     " 2 㿘`2@  @ && @" `&@&  `H "`H㿘? " " `H?"`H㿘 0- & ??> . & & Ȑ㿘 @ !  ܀@'$ ΐ@' @'} 2    2     㿘 2ސ   H㿘#  `@ 2`2  㿘  "   @: `: ( :@ (:` * J   "   " 㿘?S-"   X*  :S@ ,F?  @F茒 @@聒P? @?`? 0#S- 4B? @ S" S"@ , ?S "XB? #Sb؀ ǀ ?  @?S"\  0b؀   ? 㿘 S`"   X*` :  @ @ f   @?F? xS"\ '-S  -S0S"؀ a  ?0U`B -S؀ K ?2-S 紒 9 @-@>稒0%kB? @ S" SS"@ S!""X@ ۤD@R?؀ @? ?D  @y㿘?" b 0`F +?   : !`F ?   : 㿘  @* 0 ?   S!  @0S!  @㿐@r?    S" S"D@0`8?  S@nD @ޒ 0?! @ْ㿈@@@[㿘?  !@@ 9?  !`@ 0@   2@ 8SD?S"D @ 㿘榒 S ? h[ S" #@㿘@ݐ@t &@ߐ?     8 wS@Ґ     ! kS] !@F 0@  @??   W @8R(S@8!"?   0S ? ܀@ BSSSS!"b4"8"0%? И 054@  S" $@ 0 %S? =? ߀@ S""0@{?  㿘!O "aJ 2 !"a ޭ$ "`P ި$  $"T"X㿘% X' * P@$. )    T@$&  XX@$  $P @U   $@'9@X $@'4% T$P$X S`OOOOOO " "`*#  # O x# %!Sa "l'  @  S"` 5  PO   *`耢``?   `  @ 2       T  *  T *@OO `"""l 5Oؐ@2 @&ߐ $  !O   P`X "@ @   O   `T*@OOO @`"# #`OO`@a  PO + `T* `` #`쀢 "a @7!Ё㿘L   N  `@  "NN `4N&J 2 J `JJ"  㿘%O#O`" 4!O " 4 !   Pѐ   P  耣@4"  O`  P@ @  * `T@ @  *  " `OS"@ "<""$#"<  S    0   0  SSS  S    0   0  SSS㿘 !  "* %?l   !O 耢`    T@J?` ` 耢`  T@J?㿘O  `P?T"J@!OK "@$ 㿘O 谂?,   PJ   @  2 ?  㿘O. !@ :`@ 㿘` " `B @W O`  "`5S   {  ZO`S@@@ 4Y   X5O?@ ` J ``  P@J? 27 T@J?    TO *??"耢`  T@J?   2 `2   O` ?"`  PO  *@ OT *@"㿘O S  Ob<   $@ ?\* @@?? *` \  $@@\$ *@@  \* @& `\* @" > 2  O` `"` 㿘%OL  Oa @2a ",+   S" O,:! @SS"<@@S"O2  : @   PO`*@"<"@㿘 S"      0QS  O 耢 O3O` + ?`(&` %!O 耢 # `P. J?:`@`P J@  Y  $  a&` -  ` ( $!O 耢# `P. J?:`@TR`P J@  +  $ O 2"` ,#O`耢(  O " !  P. J?:`@$ P`J@R  ` $`O "` !O 耢`    T@J?  耦 ِ ~  !O .  P: J@  _   䀢`j _  _ /`_  `     T"@ @  * 耢  P" J@   !O P J  0 "   O    O   O "` i  ̐ $S [  Y  c$ 耦  S" \ F 2X S㪐 8S" A  ">㩐 a@"O`S@@@@42 N -*`: l O `"  N       M O` "` 㿘OJ!  O !SOa Aa!SS"@"<@6OG" O SbS"$  S"  S" O  PO + `T*@ "O  P S*@`T* `  O  P **@`T *@ 2$"<O􀠠 "@Sd H T H"@PO S ""<㿘??y  ?E?  ?&? P;*  ? '  X?   B? `P*`P&㿘 42 ?` 7O&8"!  > && > O @b:㿘O a2 Oa O 4 8 8 O8  @"8P#"#:`:`"@"`$  $@P #O@    4 2   8   2 P# " "㿘!@    "`㿘!P#   d$#@$#Pc` ?$#㿘S"l ?   O2 `a  aa 4 @8 @OaP " b@ f4; 9 2M P"# Sؠ= ?"9 D@ " 47@50D 2 P"# Sؠ ?  SD@8 " ߒ㿘  O2 `a ~ aa 4@8OOf!" b@ f4- +s 2=?B@@ Sؤ) 2`#`D (@%K 2? Sؤ 2??D?@U㿘@ ֢ ? ? ? 3S@ v?   ?a耦& ?@B? 㿘N -  ۽@"@@" @uI @ @! @) " @ 6@ "0 ) L@ &N ֑ @i@f  ֎.8@@ N 2"Hi@;@@)k @ @)g@3  ` @G@D"P@H@) @ڕS "b0@   4P#  ??:㿘? . 1N* "? "h@0  . 1P*  㿘 '"1R . $0,! ^)P  ܰ  > & 1"݇ '"S P#> & ##!P#@ A   $#   ?  ?"@  㿘`?㿈  @  > &> 㿈@ 耢? 쀢?   P#"$:$:$㿈 (R 2?2 ?2   S"D#   :" ??܀@"ِ 㿘[     "@r ??  4P  ?? ;`LLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLLLLL,LLLLLLLLLLLL<㿐 b'@  2` "@  0 "`ߐ㿘    " ՐҐ#㿐 6S  "@098@?Ñ* : `:.!*` S"`S"`S"` "t ` "x` "|`S"@7Դ &"S"̓*` '#@㿘    S0S"h㿘   @㿘   d "@m# @j"@g#@d#@@a#@^#@[#Զ ' % 'C  0  p@А  *`, @@*`ВБ:  @  \@. $@ QN@ ,`  T?* @?*`@   " "`I"ܒ`(0@G % ܀ .0  `80@ 0@@ \.   "@@)@ܰ 瀦 0@Ӑ@А "@@H0@ǐ@Đ  "@@ X'(#@( @R h㿈 +   "N@00/N@ @  *!&*aN`   N`  p@ 0 *!N` ` *! *!  ! a//' /@㿘S"     @ 0 յ@  "` S4S@@@T,ȝ㿈 'D+R`"J@   2%`€ %`@JD@ ``"@%`%`  DJ ?`03'D0!*` DJ@ +`? `}'D  D"`@| +@ 'DJ@ + ` ' d"`Ð aDD z?'D @]? @ @< 2 '!'@Ғ '  "    5( D/ )%`? !@ J  D 'DJ  D@U 'DDJ uD@ "@€ DJ lD㿈@'H@ @'!0 ` @@' !H2``!" `@ސ'!h@\0ɐ `   HJ " `@  "{``  "&   o`L Ci`"_`"```" ` \` `?V"``?Q"@"H`?I`?E` ` &       &     ` @f`)"@4(`$!"` ``H@Δ쀢 2 `` "` "@!@̒ 09`  €H `  @  `  "`  `` * @'@`` S "b0` @  ` 㿘1R @  㿘@א    S@ 㿘@ː  ` 2`R@ 㿐'!@U㿘R J㿘L@ 2&@с &@+*`: `$ "$ @K 2 N $". -  & &.   &@@I@*N 㿐 L -2    ?А  &%?`'"@/  А  * .  @*`: В@ Ѐ$&`2 㿘 J `, S!Ԁ " L d2 Sb8X $ $ $ $ $ $ $ $  `"  "@ "  €  $L S HJ@   `  %|*`P  $J2J ? ?* 8-`? 㿘@ @S",    b, "b,"", ",  Д  @? "?㿐@ﲐ㿘@Ѥ@@ @   2p@L㿘6`.  .`@B2`* @ *`B2*@* @ d  @ d  d@ @ 㿘 ( >@ s @ؖ2 @2  @͖ d @Ɩ d @ V 㿐S"؀ S v"b0 M >    0           Կ  Ԝ  `@D 2    S"" S""Ԛ Sԭ SSwS""ȁ㿘% 0R @  䀢    @G}S "b0$0㿘SbĀ "b! "0S @ "0"0* $"0㿘N*` : N x% % ' & ``/ @ `0?, @  ` -?,@ @V#xx% % ' & ``/ @M `0?, @  ` -?,@Ք @##㿀% %6 '`2 /@  0?,@"  ` -?,@ @#㿀# %a'Д [@Ha @#x# %a' B@/a @ɐ#㿘N2 *`:  % (`N n   s dN2N@L`  *`:  L`   N@@@@`N 㿘@ p q P   ?㿘S"# ``""  S!  S"`䀢`S!   0"8 S!bS"S "b0㿘ұr "PnS "bā㿘!  䀢 S! ҔW@  䀢 S! f 0 $S" S "b0@?S??  p S S2 8 p* 㿘7S  p.8  p(8S   p* @: p8S   p*??@; 㿈#S%Sa@"! "p ?@d@"pa??a a$"p$耢?쀢?"p*  :? bp4!?S 8?! 6?bp*42 ! !bp?㿘S! @ 4  p* 2      S ? p*@@" @  ??: S $ S耢6?X<Xt tttttttttttt ttt4tttttttttttttHXt0tt<ttPtttttttDxld00000㿘˵#!S$""˯#$ ˫ @$ ˧  "btˢ! "bx!P˜! $"|㿘@w#SSa!@ "  @Ca@$a*@㿐//x# %a'p ؐa @!hx# %a' a @Ր!p㿀# %a' a @!㿘!㿘? ? ? #S?   ?a耤& ? 㿘?. > `6p7!H*` S!S e@ Ð?P LSW"@SX"4 9 @1aMSM"lS"l H Ұ?2C /  $< 0:S8!? 0Ҙ 4+ )`'% @  ҈ `o@ x ?2    ܀@  㿘?`67"$*` T? 0S+"@0s  `S!耢 F?:: B 8 `   |`zS!蒆?: F?@B`ߐB 0    $5 ^͞ B 8 Q`O   H`FF?0gFŞސ ? 20 * !    ̐ѹ  ^ 0'SS @ J ? "J? 0&!0   ܀ x  J:" ?." \ J2 02 0?㿘?* : ` &7#̓*`  ?* : `27#*` &@?&@? &@? &@S"D&@&@?㿐#S`%S$N 2N1N!`:&`?`%%`.2* 0 `\* Ñ: *  N%  N '( 2  N  ?'  N 2N`` @&`㿘 "t 㿘S"SSbSS!"̒"@ *"@  S"a؁㿘S"SS!"@ "@ |㿘N@= ` & @   @ %$ #x* R  N@ ?"@N@ 2 @N`  `N@ "N``, `N@ @(,L? "?,S S2 S" 2 S2 S" J &   J  S2  @ 㿘S"8 'Sz ሀ0 $S!䀢 )Sl&$! ? !  @  拒̽W! ?$ሁ㿘  耢? `?ES !?? :; -S"8 +S&a* n?  ae 4?2a耥? 42 a耢@( a;ma ?㿘f S! 0  `?d"㿘b!  ǰ @@   # @ ! ?b "$b@K$b! " @ ǃS$""a 㿘! " " @K $"""㿈S!"  "@ "@  @pY耠`? &@ & 㿘# b "?@  ??SS:$b:ᘁS`%S `耠`"S 2S S`耢"; 1`S+S-  S2'  "" 42 2" 4 2 ( 2 㿘  `@ 42 ` @   " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@ 0&@#㿐)  S`   ` `>    2 J@ 2J@> J@ 5 2``'D J`  `'D 鵐 J@ `D` D 'J '`J@D  J` ` 㿀'P>'T ;'PT  0 PT "@@ 8 F :`@ F :`:`5T(N  PT  Pj '"`2@㿘S! S"LS"!h㿈7耢?쀢? Z? @? 㿘~S"S`"!㿘 ` V ͊?P M2F S"  ` ? 9 S "D` ) ?* '#Sa "? a 0?? ? ?㿈\! S"؀ ? 4 d d 2+:v4 ̔ `D  D?? S "ld 2:M"l  @, $Pv# @ 2 `  "S  S`SS"  `` 2: 㿀`N@ 'e 2S]!! "@U!3Sb  \ b  SSa S"aS1"!(!S"L   SU?`"!"L S"!"LS"!!S"  ( S""!" ??? ?+!c &??#\#`#d?  S"   02SS"DS"    x#Sa-S?耢 Ā ?? 굔 ? ?@ @a aa`@ B X*  : 9Fa"Sa2`(   X*  : FS!@!2S S  X*` :  X*   * @ :`@ f ! 4 (S(&:!#\#`#d ! S!!?"    S @?S:!S:J@+`H8 2 H "H`HK@2 `2"2" J@ @ S؄ S؄ S؄ ؝㿘  @bL@o @b`@k @bt@g 0 @d  @a  @^  @[ 㿘S"؀ Q """ؒ @N  gÒ  @C  @@ @sL@tU @b`@8  3S "b0 #S%Sbb耢 S 2  : S ""0 Ǐ `耢 Sl "`S "b0"l"ƒ x'''@؀ ?؁㿘 @"(S "bܐ "b܁㿐S"ܒ4 ? ?Oؐ O   /S㿘@K                               0              T    @  P  d        X  % !!S$# 'cX''@  X5 1 !' FA* X@€  a@ &##Ā "`a@ې   =&t$` @O J@ 6` Ȓa@@Đ @$`8]$` 㰐 X"` T$``(P$` Ȓ@+ J@ 4` ȒaX@ @$`(9$`` @5$``@ 0$` Ȁ ,'/@-)+ ' 8@h"p`4" `"P``@`"D```; > "S``` < M{ @"V`@"M`40@Bj @)e @"N`@@C[ J@OU 㰐 O$㰐 L$``(H$` @E$` "A&#Ēap@! #Ā "`ap@ & =3$`0$` -"# *$`  "c%$`  "2 $`$`H$`L$`P$`T`$`$`H$`$`L` $`$`P` $`$`T \~ Ȓ@X J@ S Ȓa@͐ i" Ȓ@D J@ 4` Ȓa@ $`$ S$`` O$` $`   I"# Ȓ@$ J@ 4` Ȓa@ $`, 3$` Ȓ@ J@ 4` Ȓa@ $`  $` Ȓ@ J@ 4` Ȓa@m $`0 $` "c@@H?i? $c\* &@ @@`@u@ @b@7 @  @k @ @o`-b @, bH@7v @R h?'S#@@m [ ZbX@ @[ @  @U : @7|"p  *#S@"b䀢  @N 2@7h" b@|  #` ' ` Ԑ =$c&`'   'ش S#7S'c `&9S"-a+  ; #  o-  5`   ؐ@b,    c 2tc@1"oc#"2`''` 2  ܘ @e  "''@ܰ  c 2Jc@"Ec@Dk& $''$'' #\@DD#   2c؀` #Ā`wb@ @6ɐbHc 2cb@@6bH c @ @$cc? #$c1 #  ?@&#  ?c@6x @T @@O @M @K @##`&#@ ' <c N   #`@5 @nɰ "@#@6r0S"2  &`&`&` S@&`D&` 㿘'HH@$㿐@J J @ "`E    >  &` `@Z 6@` "1 `  ?+@L` &@  ! @@ `@"` `2  ` P`  P&@ 㿘   %c(@"@ 㿐@H ' @5̒ @ `@㿐 ! ~@r;#آ "L@ " n L` o `@뚒 = ", `"@  2  . @ @ @`  c@)  2 &*@ &" `@  "&&@ @ʄ # 2&@@m`"2 &@`8@ &@ 㿘@㻐# %a' @2 ?6  $@zʖ  , ( & J  &  J   2`J  &    2`J ݚ`@ ߖ@Ȝa @> P  :+  J  & `H 2J  & ` 2J   *  㿘 S#`@$0#x$@@ @>&& @d & @ 㿘!S$@#@ #& @x &   &@& & @Ȑ 㿘  "   `4 z @  㿘   @h  @x `@ 㿘  `@ 0@Y 0@ @ 0 0 0 0 0 0 0 0 0 0$$$$$$$  !P$!" "0"T$t$$"h$$$"$""$$P"$$$$$$$$$$$"#$##8$#`#x$$#$##$#"#$$$$$ #x$$$$$$$0$$$㿘   %`@"@ 㿈`U" %TU z"bU@ @*``!U""@*`$"@J? "U"@ KU" G@N ^J`$`?#U b`?   `@@U*`" ܀ * #H#Pb #X#`b&@"#\#h#p#`#x#P#d@d(T@`!U"*`" ܒ"* @"* @*Tcܐ "c܁㿐c@   c@39 m @R " J ``U "b @c@3 @h㿐  %U$4J fU g e     Ub  "bb "bUb, "b,  9 `S-F#<*` `T? &    T "##33 ̀@Tc@ TT*` * ?А""! Ȓ@  Ȁ@"J@ 2 #Ac@^ TT"#"#! Ȁ  TT"c"@ǔ  Ȁ@"J@ 2 #Tc@5 T"#"cUU U""b,"UU U""b,"U,U U","b"UbP "bP UUU""H""aUb0 "b0Ua "aUTА `"" %"ؒc @ @ U t"b U p"a!@ Ȓc i $@ `Ȣ$@4$`^$4TU "bX"TU` "$P" UUU"""HH"aU D"b UT "c>"U :"aU 6"bDT 2"cU ."b@T *"c! @ "  "  @#    "` @"    "` c@} U "b( $#\@@     @C  $#\U"4& *`` @@b`@ 2@  5TT#܀ ܀ 2 U@F@@?`U" Tc "c!U*` * " @ؑ* $"<@ԑ*`/U 9%L   U"  !UU"U"<@@""U"<@@ "TL- @@35঒ "L!T#@@ +"c@ ܨ ΪdU"(   %@kX"  T#Ѐ  U "b 2U@ @`?!쀢 "?@Ґ ?  @@??`@`? @e @ ?%$@f?  @Ė $ #\   @  $   $ $ @̔ @ @2 㿘 @1 @ @'  T"H "   "J  2㰄 "@㰄"TT  㴝㿘@㿘@  $   $  $ <  @T `$ $T""#Tc""cTTcȐ  "@T`T  @ "T  㿘0@ -  㿘0 㿘U"PUb0@   U! 2  ` @LȔ  @01   0  `!@n`#@ϐ @ `@M 2`:㿀  #`X `u U"D 2  @m     /T /T+T???耢'''%c.# `@J? 'U b'@x 2Ȁ  2c %c  U" U! T B?P 'T#Ȁ F[%U U" 2@l4  (@l0#Ub   0@l&!U"H   0@l  2b 2"H 2  2 U! 2 8@k㿈U" T#LE 'Tܰ ?  U"< @U"L      ?,`@? @` T#؀ 쀒@2   2     ܢ`@Ơ$T#Ԁ `?    23U`A3Ub`U 9! 5U! 1 )!U"8 `TT#T#@ T#̀ `"T@kt PT#TcȐ $"8`&b]T"#@i :0@e -b?&b㿘@dU"@!U"$& &$ &$&$ &$@  &N@   % |* R *  &N@  *@& *  "    "  "$* `#   %#x* R  *`" #   &㿘@& &$&$ &$&$@J? $  ??  & &$ N@ ^U  ?& &$U"@  U"    *?"   $@`X@\  2 $ @ ?``@P    ?& &$ @i $@ @ @F&  *@ ^U  & @   2"U  & @   U _ , ^ $ = - : / .U"$ "'    % |* R +  2  :  `&   `   @ &a? &U" 2% U! 2  2 2  `   ?"6   `&$"@"@?@   "* "    6 $U " b$*  `#   %#x* R  *`" #   &$ "  @ 㿘??>>    $$ "$  &   2@@ ?2}< >   :>$ "p @  ? & @   _ ? _Z    @  & @   C@ _? 4 ; @6@  & @   2 @ _$  ? & @   2  ? _   @@"@ ?2p  $  < ; >>$ " @  ? & @   2R  ? _"M     @  & @   26 @ _1 4 2.  @() @  & @   2 @ _2   ? & @   2  ? _"   $  ? * @$ 6  @@ ?2r < >   :>$ "r @  ? & @   2T  ? _"O     @  & @   28 @ _3 4 20  @(+ @  & @   2 @ _2   ? & @   2  ? _2      @* @&  (㿘@ɐ `h@+ 㿘@ `p@+  :#? @ @ UU`." $   %|*P@"    * ?2`@ 8  @ @ 8+ *㿘U"    %@vb U"   %`? "`` .`:  * "@,\ @gѐ x U"   %`? "`` .`:  * "@,;   @g   %`? "`` .`:  * "@,3 %  @bb`?"`b * &b@,  㿘@5AB$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$B$AB$B$B$B$AB$AB$B$B$B$B$B$B$B$B$B$B$AB$B㿘@cѠ %U#,' $`0'P *` €" U "bdU"b` Ƞ $\ "Ā``@ * @` U "bX@@@;`?ђ?\* @   \@*\   "Ā` @ "@@   @:@ 2 `@ 㿐@  2 @*- " ,`* * * %Ȑ T@V Z @M D @  T 2 >X %!'@h @` h< @   @ݔФ   )@ #Ъ @˒  2! @Ĕ   @ 2 @   @) 2@  `@  !U@ߟ @  ,@@ @,@ߓ :  @@, :, @! U"X`!@f+U"d`2f !U"`@O !0@gY  @Ѧ  2S O"`@L ,  ? ?/7  @ ?H'D'H'Xab'\'L @D @x!8( @6$ 'H'P'T'L R#\1"  @aH   @ @  @i!X㿐@y   @f!h7 @64  ``@ ` `D@,  T2`@ T 2` `D@  @Ҡ! 㿘 "Ā  bT`?  #U@    2bT@ 㿘 N  nax@ R  UN  oUU "bT ""T %   @ޅ , ` @*  $Đ @( $@ , `$@  @n , 2*@, $@㿘 U"\ "- @ "( @V . " *"\@ 2  @ " @B . "  *"\@   "\ 㿘'HH@ $㿘 %a@"@ 㿘@㿘   %b@ѐ"@ 㻈 %!'')'%+ $ - Ȓ@.@99? oc\* & @ @`@f'耢 `c@' (@@耢 c0@'א @ 㿐@F ' @'ʒ @ `@㿐 ! ~@d9#@ "L@ " n L` o `@ݘ = ", `"@ 2  . @ @ @`#h#pcH@ '  2 &*@ &" c@   "&&@ @ # 2&@@_`"2 &@c@  &@ 㿘@?R(R(R(R(R(R(R(R(R(R(R(R(R(R(R(R(R(R(R(R(R(QR(R(R(R(R(R(R(R(R(R(R(R(R(Q`R(QR(Q@R(R(R(R(R(QR(Q@R(Q0R(R(R(QR(QR(R(Q@x @    @8u #????@2  6  -@dd# -@d_ ( -//Vp" "pV"h""h"` #T+ $`:OS#4*` € c G"c c B"c c "c! #/@F 6$# ``@^܀?! `h@& # @3$#@!@` "c  J`"@p !`x@ % @  @c@7`Pc\*  @  c  TU@`R??"N795-+/@@΀   @@W +@@@ 2@}@ 2 2@@ @ݐ  @F   @@   @:`耢 @@Ő @@ @, ??`㿘   @`؀  @`   @`耢 "   @ 2㷀 %!'@a0@  !8 d'@Ӑ!'@$'@Ɩ *`"  ` '쀤`  @T `@@e *`"`*`'" ! !`!h!H@b1  6#,   @b%ap쀤 &@b!x@?  0I@b!n @j  " @Z #'9%መ$@S@a@]` `!@bӔ @bΒ  2@]``!@b0!@b@  @u "'@a @b!  `:  a0 `  @Z !@%#  a @J!㿘V"p # @  2 c`? 2c@ 㿘V"h "1@  2   21!h㿘@ڶ : 2 ,@a@h @V $ V"h  `@  "   2h@㿘@ @Ð$@$ $   $  "& 㿘 'DJ  na@-   J o   "c'D"#D!"pϔh!@` V㿐 N  a@? `h@$L @y ' "@㿐@'")@ 2@I, N  -,`$@ = `,` .$`b,`$$ `@`! 2ܐ?&@&&㿘   %b@"@    $ , $ (㿘 %'H'L'P'T'X"ؒ@~H@Ȑ 㿘   #,` #$@`"@ג  #,` @`z"   $@`s"@ 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘@\@"㿘 'H'L'P'T'XH@t (@d / @{ <   L` r`@3 `@В㿘@d / 1U$"h@m, /,b$@Ϲ"h"h @ϵ$"h H "#(!"@{x  "@_#0M@{j   #@_>'< @@#0@#( %#(@{M  v@_ǐ#!  @_#(@ `wâ @c `2 㿘 cH@" @ cH@" 㿘`cX@" @W  @.cX@"Ր 㿘@D ch@"ʐ 㿐V" "Vbx" "bx   5/ %-@(  `0; 7Q`@_L   `2     0  `2 @9  @E@ À Ϧ``@`) #4#4@4V  "x@R eu"x`` 2@`@"i 0e  :  ` `     @^ ` `  % " `8 @ ` "`$`  "@$b $  "" @b @` @^ c0` $`?"c0#4?%#4 @ Q#4V"bx " 2@C2V 2b 2   # %``@b؀  bب %#    Ț`А@m 20 #@!͒c @B 㿘@Q %V J? &`   ` " x@4x  @ɯ 2 J` 2 o & *&  & & &x& "@" c4 "c4㿘V"x`)'`@] `  % @] 2 @]@`2`㿘` % @I 2@!H0 2 # H$ E$ B$ $ $`$ `"@$`㿘` % @Ð  `  @  0   c0 "c0㿘@㿘a@ʸ  ` @a`? '%+ $ m@Ȣ 2a(@z @2!@@@1 ?倢 ?c\* @ @&@ `  `J`p   &``@`"!@/  @a@k@@f㿐`J c b a@@) `@ `@"J@ a`@ ` @ ` @"J@ a@ ?# * * 2 `@ ? 2`  a@ @@= @a@ 2  㿘@  !@@1 6`@@]! `@ 㿘  !    %"@ʒa0 # % a@Ðb b@b @ސ 㿘@"lm,m,m,mm,m,lm,m,m,m,m,lm,m,m,m,lm,m,l㿘 %bp@"@ 㿈!^+^7^)^#% $5^-^'^%/` [ *` € $#4 %c( &┐ %"@`  "`@` "`@0b؀?ؒ?\& \\* @& % #4`#$∐   ''1^'" @w ?b@~   "b@ǰ  ""$#4" @\#@\#@\ #(#4@\#8#4@| #4%c(@tb #4@ncP  %c(cX@ @Q蠒 @  @N −cx@1 @ @ @─`2"@c@͐  @- −cx@  "@X 2bc@ @X6@ 耢 c@ @ѐ (  @c # ` " `  " `` `#@ 0@ #x@\X @ )  @\N0HaB + cB + 3`  *`  @    @̒01@v: Ā@\& (0@o^c(      ! !?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?#" @!  ?"  ?c@ ! @  @!  #? "? ?c@ ! @  "@! @#@" ^    @   ^^##,"#0"c8 8 `   @[@ʐ@P2 ^ ^b"#$ @Z  #(`"  @Z @Y c$!@Y&@#(@a &&  `  㿘. >@ق 2@a@@, @uGaX@! 㽀@/ cx@ @l  ap@ ` F ^#8"" ^`" c0 * "c0^$ a@ ^"`!@Y c0 @)^'`, * #,"@ ␀ @Yvc0 @`␀ @Yj!0$a@   a@  aД@^ @ a@ @  `@ @tVb" Q@ 0 b@7  @@ @ * @   @T@u x `*  d 0"8, &@T x^c8*  0" 0 ; `@ C@8 ^#$ @ ^a@ #0^"@  "@@X`(`(  `5^3 d,,*"@ ␀ @X̐a   `2 d␀ `@X!`>␀ "X@X`X 0"xĒ t-^+ d,,,"@ ␀ @Xa t `2 d␀ `@X!`a@  㿘@                                    ````````````````````````````@P` `0\XX@,XXD,t$4X,ht,T,,,X,( ,l8lllDlllllllPlllllllllllllll`㿘 " @ H  ! %``@쨐""@줒`@Đ 㿐 ' -_+`)`'`#`%`!7 $9_5`;/` * l@€ %`  %   $ $` $Ð @+ Ѐ??\* @ @Sݰ&@,<'#``& `@Ồ %  @ %?2@`@   @ ?`*_*` €& @B'& @0 @@0|@@Px`  ` `@ `c @+ ) %`@J@ - @ ` `  `0  `0 "   "``  "` "`B@@@   ?''''  ܘ @ a@!  "`@B a0@  ܘ @ a8@ @W!!@V0r``  @V!``` @!@V`` [  " @ǐ ,K` ` L` 2D` ?`#`2< . @& ` `+  @$ !Ѐ`@ @  @VN@ `? @`@ ǐ @V@a@V=!  @㿐`%'_!*` €` t" ` x ` | `  `  `  `   @`  a@ ``c  "`Ȁ ``p "`pȀ 2"@&@㿐` b ( '`@ @M g"?`c@* ? #`+`5`7``@J@ -`@v``,*`_"P €`   ` `    `   $`   ""`Đ $`Ҡ 7Р$` "`` "c `l %`l   !"(?2`@Ր @ ?2`@̐ @  ?2`@Ð @ @ ??2`@ @ @ @?2`@ @ @ה@|?2`@ @@s??2`@ @ @ H d&H?2`@ @@ZWS,N ?2`@p @ܒ D?@h  D    @6  @0?@ ? @@db  "(b0@TH > $`Ā   2$`@TԐ"`@Tѐ"$`@ @Z ? 4``l 2 H 2  ` D`b@   `Ā "  +`#_ 2-ML (`"&M`  "`c`@( @PZ"M@: "M@PP`3`@PJ``M g@ @P> J##8"@TbL` "@TZ` ` ` _#Đ@'@TG"Ѐ  @TA"؀  "  7 "0 "0 ""#@ΐ@T'#@ 㿘   `@J@ -@ǐ` "    0   0 b@`@@ `D  D '  ? ( ?* ??* ? *  ? ??? "``L"`(L*``H 8 *@㿀 %!  ' 2  2   2    2    2 "    ?? @ܐ   # c(@ ` D`@_"D a @$#0``    #!"``D? "`D_#`* €`#$_#`#L`  ` H  _#cH@L ! ,cX, @̳  ",   0   0 `H "H   ,`_#*` €  ??  ??''%'ܐ @Ā  'ؐ@Ā c`@ ` "`c`@  "`cp@  @x@ ? ? ? ?     $ 4 ؀ 2       #^#^ `2L LD2` 2` *L*`$D*`*`*`2`2`2` 2` 2`*`#@@) Ȱ , , , , , , , , , , ,  `,  ][ @nȒV  $,@O 2& + ` l`' @'N  怢  @5 " `  R* `#H`c@J  @  @,ؐ  2&  @ $ c@1 c@, 㿘@ݐ`  `   c@ ``D` "`D@c`@ <`  ` @- "@?`* "L L*L" * " " " " " " " ` *LL`*`"`& &  &  @Ĕ?#:,@`?x   ?''''  ܘ @ a@  &@& a0@  ܘ @ c@  @ː*@3㷈 %!`c` "'+`@ )'c@l(? @M2`"c @ @ '@@QW (@c㿘`@M!" @<"L a c  g  ` H    /`D  %D *+ H/``pp^``c@ `$ D ` `" ` " `" `* `" `" $` " (" ," 0" 4" 8" <" @" D" H* #c@" ``#$cL@ D %`` #$ ?   c$@偔``  @`PD _ # ?   c@e`@`XD ` #L ?   cL@K`@m``D ` ?   ` @1`@S`hD ` H ?   `H@`@9`xD _ #耢 ?   c@`@`D$` ?   `@`@`̠% 6̐@x`#`23 `c @ ` `&?@Q !?  %_@k"L  #@`@`䀢@?@P  @ޒ  @@*@ J "*@`D , (4 @& @0 @   ( @? * @  @? *㿀`  %a ' `" @0# * @O#@  "    &a 4 "@[ @O#P`` 2   @ #`@O    #p#x@Ow#  % "@Ɣ @ T;@Oi#  % "@  @s - #@OZ    "  @OO# @OK# @OF#@OC" #@O<  %  "@ @1 @ې 㿘`@#$@O"       ` @#0@ 8@  "  @ @ p0 L 5/ %7 9;63  ."#  "  @" " ` @"  @  2 @ ` 2  @ @ ?` @` р  ,  @=@N  !`  $ @1@N $     @#@N   @N`@@N @N  @ڐ@N"؀!@N}0@Nya( $`  L 4@Nqa $`  L 8@Nia $`   L <@Naa @#@! $ @  L@NUa D#@! $   L@NIa $`  L ,@NAa $`  L (@N9a 0`" $@ِ  0"@& 0 $   L 0@N'` `" @0?H@N!  @j‒`?"`‒ * %@ 㿘@N! $! %# a@P"@M! "@Ia @ L㿘`.# %@M! b@8b`?"`b * $b@\  %"@R@Mː ?  @ b`?"`b * $b@8 @:b㿘`Y ?N>@ 6  , < ?`&  @  * & @N !  ?`&  @  * & @N 4 N 4N  ?`&  @ >* &@ِ >㿘   " @ƿ 2  x %  a􀢠'" @ % %0:@iܐ!ؐ@' !  @˖!!@M" %  / / / / / / / / / / /@W/"@L %@|"! @"㿘@@ @Ԓ    `А *`: ?А *`: ? *`: ?ɀ`2    _#,  €* ,`  *  **".@㿘` " * *@ `b @ `D$"`DtDpdppppppppppppppp4pppp$tx   ?''''  ܘ @㋚   b@ ܀ "@ݱ  @  ܘ @q 6b@x @@L"`@  L 2@| @ݳ㿀`# @K ?  ` `  " ` `  "  ` `   ` ` cX`#hcpx#\#`#d#h#l#p#H@K0##\#cHc@K  :  `" @`` "` P %!' L  P "  "P@x   ֔ c   ` `"  " @   ` `"  @w  @c H @KU  (`@KO  $ @KH`  $   L % b`?"`` "* $"@  @߃@K' ("`?"`" * $"@ a @ 0㿘?`k d*` € @  P  ` h p `@J 0 @J㿘   ? ?  ? ? & 2@S `@K@-` @J 0 ` @J0 #@J h %0! '0瀣@" +    +@J! @/ p %! T' _"T"@y! 2," .@ù" "`@ü!,"  !_`!@ï!\!  `Kk ؓ*` €@Y M  ???ؠВ'@ѐ  /Ѐ/؀``ِ ` ِ   耢 /'/@_!@֐@c " !^ #H@a #H@ `!_!@U!! @ ȁ㿐 'D  ` `D @%ٔ  @' . _b@I  ". D'@e1_!@!!㿐`  `  1_#\!! @x `ؐ!@ ߔ!!㿐 ` `` `  @Œ  2   " @J !"@`!_!@ؔ!7!` `!_ 6 !@̒!*! `6 !_ 6   6 6 !_#\6  `!@!!6 6 !_#\#`6  `!@!!h  %!' '  '  ' `' ' ''T @`8 `@ A ؀`@ + 3 "$` "` ` "``"` " ` ` 2 `````2+ +  IJ` * (* ` `؀ ܀    䀢 $ @ =!` `2 #\Д! @| ؐ@!!_0!@~!! @I!8㿘     ;@:@ @ 1_!H@~ƒ!! ^h Q(h ?_W:* aX0  .*  ?** *chp ? / / // 7  / / / / / / // ////2 2 2얓21_1Y!x X@~`!2R X #^@   ,` !#X@  2  ,`!1_#_$%!_ #d  % #\#` @~4!L!,``0!1_ #_   K 0 *  2a@~ ,a Xa@~!2 X㿘 ``  2   1_!@}! !  @dK@ 㿘@.V㿘 !!s@!@ܕb( l"8`l! @܈b@ `"Hs!@"P$t   s!tbX@qt6"!԰#l`"@` 2  2  s!`@Zbt?"aԀ J  @6"  @1"  t @" kk"#"b㿘!k # %k4q ,  `"$# #l#l` "2  "@ {0t!J! @" @" "$$#㿘 "c"`U 㿘 " c"`K 㿘 !c"`A 㿘s!jb@Ӕ@t?"aԁ㿘s!kc@Ɣt?"aԁ㿘s!oc8@۹8t?"aԁ㿘 'D'H  'D` &`D  `D@5H D  DpD@5H D $ HHs!@ۈc t``@7` Ht?F"a`"H`""`H@J a j!` ###  r <  @ `H"`  s!x H@  H"`H` `"` `@`H @X %!'H' 'DD@5CH HHs!@ct?|"aHor "Xt# \`x@͊ 's@Y!s! H o"#X#X H@61 t!؀ ?JJ &    "J ) *` !/K &    " K  %#x* R +  *` +r < s@  s!x j@ g j!` ##  k"    @o!o#X Hs! 1k" &"#@5c #X $#X&"H @4̔ 2nLD  k#$ Mo#X H@5 r < H@ s!x j@  j!` ##H  k"  @ !o#X Ds!  1k"&"#@5Xc #X $#Xp&"  ,@H, @ H 2 H@@l @WD QL#X DH@5+ >r < "@ $s!x j@  j!` ##@  k"  @ #ocX 2 s! !k" $"#@4c cX $cX$"  o@gD?@ o"#X %! @{3 㿘@ 㿘 !8!8`  @ 㻐' % 'D''H   'D` &`D  pD@3}H D  D`D@3rH D $ HHs!@J`( t``@4` Ht?"a G t!؀ B  J  &    "`-   *` "/K  &     +`:   %#x* R +  *` +H"   r < H@ ' H"`  s!x H@  H"`#H@_C   (H`@D P*@ :8HH @4  H H` `"` `` `@u   :8@@: @z5 h㿘@8ѐ !s!?`" * " @ !@)o#X s! r!k#r \ "`D$"#@3$`D $"s$`D!@ʒ $`Ds%#X!@Ē 㷈 %!'H' 'DpD@2nH HHs!@I`t?"aHro "\"X@E$ t`@x `x@ʬ 's@{!s o~"#X#X {s@4 2 Hs!`@ms@3J gst!؀ 'N     &      % #x* R  +K@`*r < s@  s!x @@  @ k"     ` @ 3ocX ss! 1k" &"#@2`Ѐ "&"cX &cX&"s! @1H 2yN@ o"#X %! @y0 ؁ 㿘!r X`s!!"o\`@t ss!@ݐ!s! j@%ܐ  X  os!a(@\\0s!@Ɛ!P@%ʐ j!l'ss!tJ !k# @Aahk"@9ajtkoa@"@-c8k#r 4k"k#$a@j!`r Pb@ jv! @b@tn!ؠtj!bh@r <  tjḒb@(s@R"s!x  sqḒb@֖0q@@"q (<'sr x7!s!Ḓb@r h,Ḕ@ַc k$#s!p #h"@֦c@%k @#  t jpḔ@ @֑c  `t"!ԁ㿘  `? & `@1`   & s`@%`耢 s &!@@cc?" !s!c@U㿘r4Ėt"aԁ㿘kts"a"p㿘kt"aԁ㿐  q ( `?:" (s!@)c`@ϒ` 2`q ("`(@Œ`耢 2`q" (@w #@J  ss!`` @t?"aq "!"(3q`(V1s!@`@`( s!!@ؒ`X!@D p`(t"!ԁ㿘kAxt"aԁ㿘rh5t"aԁ㿘rx)t"aԁ㿘kt"aԁ㿘  s!@@Ֆ`t?e"aԀ  j!l `?1"!l `@;`  j $"al `@.`耢  j"!l2 `@$`k "c  @ `!`#p@!#psj "at"l!j!l s!t "sJ  !ls!@H`$!l!lsas!tJ k! ah@3 j!lt"!ԁ㿘k$0t"aԁ㿘j @t"aԁ㿐 s!@'a`+q`@` 2`q $"`,@`耢 2`q" ,@f J qs!`a@t?!"a , `?" ,1q , r`8 `8 ?"`8 ,?!s! ,@ɒa ,   t"!ԁ㿘'H  'DȐD@.ђH HD  Hs!@ԩat?."aH`@"`t!Ԁ!`k# Hs!@"H`@t"8` `t!Ԁ"&`s"!s "a㻐# %a '  #h &`  s!@@db@t`@/` t?("a@!`  `@@% Pt?"aԐ@A$  s!b`@At`@@"xt"!`a@a @uǐ"㿘'H  'DpD@.:H HD  Hs!@bt?"aH`@"㿐'H 'DpD@.H HHs!@`t?I"aHor "Xt# \`x@_ 's@.!-H !oo&"#X#X "H@/  "@#X Hs! 1k" &"#@.b #X $#X&"H @.  2N@% o"#X㿘'H  'DD@-H HD  ȐD@-H D  HHs!@Ӄbt? "a`@f" H`@_"㿘   &`  #&`   s!@@]ct@@c0 #8#@`!@# " `@.֐` 2`t?1"aԒ#@ "``J |"`@.` `@.e#H 2`t? "a`  @ s@!`@Ϯ@ϩ㿈'H  'DpD@-H HD `D@-H  DHs!@c`!tH*  ?c''"?@F HJ |H@.g @. #H Ht?P"aor "Xt# \`x@; 's@ !o#X+  a w/H,`@#@ @u 3ocX os! 1k" H&"@@-ѐ#耢 cX &cX&"o#X` D?@Ҁ`@ o"#X耢@@ 㻈' % '@  @ @ W @܈   @ܐ  @ِ @ِ# L@ #@A / " -/ @#@c  +/q ,  !s!@ף!@ @!  r l@; @; #@=?t"a@s7 @Ҽ쀢@ć @Ą ?t@=ؐ#t"!"! @s#@# %a'H' 'D ȐD@,HD?  Hs!@ܒct?V"aH`@  7 D  H@ H"`D 'DH`@ # D H!s!@# (@)! %( O@v@Ѣ?,H" D 'DH` @ 8  s!@ @a  rD 2 ?H` @r 8r?"`Xa @s P㿘!k# $#@] X 2$#t!Ԁ!2 $#s!@Ր `@M $#㻐# %a'@>$  s!`@Oa@= at"a@rܐ 㿘'H  'DD@+OH HD  Hs!@'`t?"aH`@  t!Ԁ!k# Hs!@~ H`@!(㿘'H  'DD@+H HD  Hs!@`t?"aH`@Ґ!0 t!Ԁ!k# Hs!@G!8H`@!h㿘'H 'DpD@*H Hs!@мat?"aD"@#H㿘'H 'DD@*’H Hs!@Нat?"aD!@H㻐# %a'@ϔ$`@}  $" @ @r    *@ . #/@P a@ a @q!ȁ㿘'H  'DАD@*eH HD  ؐD@*YH D  HHs!@1at?"a`"@`㿘!k#  $#" "0@`$#㿘!k#  $#"@"P@`$#㿘!k#  $#"`"h@`$#㿘!r X  @  @_  X  @ @q 㿘#r`X @Đ"p!u#8 "s@bs! ?"a($#8$`Xk"# 㿘  s!@@ϼbxt? "a2`@뢐"@ 8㿘@/ s! r@ r X t "bt""@  k"@ 㿐'H 'DD@)H  HHs!@~bOtH@# ? '!s!@"@!th"! !s!@Ґ"@!1tJ`  k!s!@Ő"@!$t@"䀢 t}`$@Ð @ J r X 3o!s!@ԧ!@!@ @ t?)"a3oc@5ΐc`  !o#a@c`"c`@ѵDH? €`r X t "bt""@~ @ 㿘tut"aԁ㿘ti(t"aԁ㿘  rs!!r#H@P$ < <t"!<t "<"at`!@  j*!(`!(@ ja( Ja&`pJ!$J tJ@` J2`@  a( @* 2  * J *`p㿘'H  'Ds!!s#X@$!x!xtC"!Ԁ  DhD@(H D   Hs!@ncpt?*"at1rs"a l @"xsa`  L " & l@ ,r l#s@q! L " q 0@g# s!   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   qK +`" qJ`01b  p. p`0J [  \ $"J+2+J  +J $7 J &    * J 02?L  @`+J@  l +` f @ "`  +@  W  *`G: :  \ $?27JJ &    ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J d  J2J 2J  ]`\J BKsJ ,V ]":R &    ")+J 02?L ! @`+J@  +`  @ "  +@   J  +N p  p0s!@9#㿘k# # k2t"aԁ㿘j`&t"aԁ㿘rPt"aԁ㿘@ #``t!Ԁ!`k# "s!@#@ m `s "a㿐 s!@ 0 `@⹔ # sJ s!@ː @0 !``@T :!8㿘@ 7 㿘!k# 'H 'Ds!  DD@&QH D  kHs!@)`t" s!@я!# #j*`H * ap@Z # k #("@ s!@v!Htz"!" " `t$# q"ԑ*` *  @* *  "@# ap* * ` @'%o(`? "`@Ȑ (  "(?̑. :  .@# ap*` *   @ƐN "Ė.@`(@ %3 %b(`? "`@ b(  &b( ?23 %?b(`?  "`@  s3 %b(  ` &b(s!!p@t?"aԁ㿘'H  'DD@%H HD  Hs!@rat?"aH @'% ?  tHs!a@Zt"!ԁ㿐'H  'DD@%gH HD  Hs!@?at?"aH @'6 ?'H@@l?s!a@( t"!ԁ㿘 !!@ `㿘 ? s!a`@`㿐'H  'DD@%H HD  Hs!@a tH @&x  t?;"a@]"( J "0b8@ِ?% b@@ 8 'q)k  <8(#$(H%#  ` @ @M< H<8$(%# @A5 %'H' 'D   D@$H   Hs!a0  1k#  Hjap  @ 2 # (Hs!aH@ot?"aoc`@$-jp,`* ` @ NN  &    2  o`k#`*`:  $ \"Y XN    &    .   ** :` ?а N  &    , D?.?H,  o`&@ $Ȕ" @JH *:  i2D  H,o`&@ $Ȕ" @2H@@.@`N 2 N @.@#ta@U `s!@;!`tS"!2N` s! !x r X  ks!!@$t?;"ak#  !s!o@#`!@g a!r` € tr 4 oN`  s!`?"``@* "@@ o$@Đ#`@/ ta'D@'Hp* `@2 2ND&-j @j!㽠 %!?''!''@''   ' b@9 b(@   b0@   `b8@    b@@ `@U /  L 2, 2%"` L  2}"'0@Ϲ'  J  ` f"@Pt ;`@' b@ΐ b(@    b0@    L  /#@"F ,@ / "L 2,`@ '?# @4r+ @B(?2`r??r:H@c8   %&@ݔ!' 6tR"'t"8'@ a@ sa  r ':``; @%]?@ V'cP@R r`@ B :` " '   q@̀` q ( 6r x 2r ` + `2s @&s! #`?"``@* "@@ #s! :r`@ F `s@(ss@!@Nk ' q ( Fr x 2C r `` `2<   (8 s!r ` :`  `2s ss!?`"@  #* "@C #s!?`" * " @3 s@4! @3#D @$ kL [@7 ] " J ``:2* @7 : q,  ,  s!c@Nj @f  ! ' 'o#0@mX$`o#0`  P@h@mC$  $@ #@” ?'`T` `#\! @ `@!k# s!`@6``@` '?* `@3`  ``#\  @Қ  @- @-@+@-"?'`(``2`@$  0@2˒ @`8!k#`' s!`@@ # s!`P@ٔ ``@Җx0C `@̔@ : @| `@׳ @ % 2* `@Ƴ@J  `0@ƫ  `@   `@ƞ `@Ƙxk# s!@Ə`@ ?@2\     @\ '   ?' *@ " q J? "  q , s!a0@\@  a@@Δ   aH@ǔ  c p ` " p@!P ap@  !x@ @r??:H   @ '   ?' *@   J? "  eq , s!a0@a@˔   `@c: r H: H H q  lJ h a@ k# ` s!a@Ŕ @O?@ @J@HR`T'@> Q@c8  %&@!' 6 t@1d#@ R"'t"8'@    @   a@ sa  r ':``; @"d?@@ W'cP@W r`@ B :` " '   q@р` q ( 7r x 4 r ` + `2s @&s! #`?"``@* "@@ #s! :r`@ F `s@(ss@!  @8 ' q ( Fr x 2C r `` `2<   (8 s!r ` :`  `2s ss!?`"@  #* "@F #s!?`" * " @6 s@7! @0!G @! r H H?k kr ` ` k@ k# (s!@!# # s!@#@ '@" @0T!  @0N# "H@ݒ @ ?@΅`@  @@ %! @e"h㿘@$ !s!@ɱ"p@!t"8@ 㿘@$u !s!@ɣ"@!t"8@ h %!'Ds''H'L!H'@o  r X  8  `@ a @ @È" M " @~"  M "  Ԩ H* @@   b@ݐ b(@   b8@   c" pLy?[0Wb0@  r Lh?J0F /@ :@@ @ < :8`5`*  @,@ܐ @ג @ 2  @! 0` M@  M  H*` @"0@-@*` :@@ /  * ` , @ :`N@ ր`q,@``L@  @2 /  * q ,  s!b#\#`@)r X  C   '''   L "!k'' !k`"$" @5r X  $"  @$ 2 #(@b0 k#$  ` L@ cP@A@  `L cP@5 2 `L@  #X'ؐ ''s! J"I?L kC?#  s`#xa@©c`  @c$#''܀  '` L!k"#'$" , $" " ''  t!@ d ԰ @ Ԑ 'Ԁ rD 6 rԒ :H* @ kr X ? y  %! @c#㿘 F @>@   c@ N 5 N + (, %2%,@J &   D ",J &   D `@,`,`N Р $, * : & ` : & ` "ɐ? * (:8  & ` * : 8 & ` "??ɐ?Б* : 㿘b0@  b(@~  b8@w  @cЀ   8+ %as'"ap)t  @m"Ԣ  @h !  ''''@g\'?-c/@֐ c@А  В @b OВc@  OВ @b POЀ @g- ? @ﬔ t@ @t?"a `c x@s!c x@m!c x3o&c\ Z?     #\! @Ț @Q!s!`(@  @Y 6 2 8@   @' "  (`     #\! @ `@@! P@,@' h@@'?"  `6  @, pt?@}"w " @9 @}'tb`'@0% 6 @,z xEt  '  @  @,g `@!t$"`@"1u `2k@ "# s!`@qc\@ΐ " "#8@#8 t@t?"aԐ '?c!@   oq , @, o#\@f a @aؐ 㿘@ t !s!?`" * " @ @! , a0 `",t"|@} 㿘q ,! 'H'L'P'T'X 7$!,3sa@v H!@}  a@i!a!@p  aa@\! a@Hݒa?`" * " @L @Na3uc8  @8!0t?"a& a@A c8@HHc8@-!X@3c8j "h@a`@`?!, ƀ @  㻐; %aj'b'D @x$9 @!    t"!԰  '@"`݀` `@~"!u#8ah  4!t@q"!u#8ah  @e@#8!tD  @k# !s!@!p@!t!"a ` >k#`4t5 541k# ,t"  s` !so!a@!\s!`? "`` ,`:  @* "@@  & `    tԑ*` * ?А"Ԁ  t!Ԑ?    t!Ԁ " d   & `   2   d`  `) k" d--  d`("  `- t"!Ԯ "!t,!t@"` `k# 4 !s? 5k# !s!`?"``@* "@@@! $8$t#8@ t!Ԁ`"#ٴ 1,j"!h @ْt!Ԁ!a @ !,  !쀥@`"?П@ ?a  @_ِ!@ t "a 㿘@n !s!o "X",@Ø!@!t"@  %sk'!r x:?`'T"rr  r?? @8`;`H'D'H'L'x  LJ -s!b@L`s!b @Ls! DH@ L %kkb#  ᠒ 't'l'h`'pt'\@" /j$ j!h 1 !( @?&!(l l@, h h@% p Tp@ Trt?" xJ"Ԓb@ 'l`(@ 'pH@b0  Hr %x"('|`"c"x0aJ@ |( @ H'h`@%'|| r p@)Al@ h@ p@ސ t`x ""`x"'t07H@`'|| 4H@)""8l@Ő p@ t! 't|@R  <  "sH!@0bHl@ p@ |@tr:H@ tl@ p@ h ?h@ ?t"trT"`x@T" m3 a8 a8 UD@_b` D@Ybh JLk#  ?| a8@~a< ? ?| a8a<@hR ?2 ? ?1 H@("8   :8trT G"x!8"p!<    >!8trT 7"`x  >!8'\LD" .l@ p@ hrT`" x{ p l@ p@ hrT`" xh@ t ( %t|@" %\@ 'xx @a? @ kc'h`7``@# S" ` >`B; `` qxR @묔 4&@q ( ;r x r H 3r ` `` *s`  sd !sds! #`?"``@* "@@놐 #s! :` Br?` `@}!|R @Bb$ rq ( M`r x rr H C`r `` `<`  8`s!r ` :`  `2s ss!?`"@  #* "@4 #s!?`" * " @$ s@%!`H@'{"80]q (3  ` `` 8`  sd /ds! #`?"``@* "@@ #s@!s!q :` ( B?`  r x rr H rx @;qx `?"``@* "@@꾐 r``B :`x`? "`` .`:  @* "@@ꤐr``B :`|@*` q ( Br x r H :r ` `` s` sd sds!?`"@  #* "@f #s!?`" * " @V s@W!| @H@&"8x @@! r@&"r??:`@ trT`" xt|@x@F l@, p@) h "rh@" r `` `2O %  K %@j G %l@ p@  hrT`" xh@ j!h 1 t?."a!( @ě?&!(x x@ΐ tt? "a| "rt|@r `` `2  %   %@$  %! @["㿘@ !s!o "X",@"@!t# @ s!'H :rx''Hj' '?'Dr??'Drr  : H @;`'L'P'Xb'@w`?'܀ #k#  sH X sHJ -s!bH@L`s!b @Ls!  t܀ tHD@ L0]'!'䀢 ' ܀@ t'@# +j& j!h ! !( @?$!(䀢 @. 耢 H@' Hr"`xDjt?" $"Ԓa@ '`(@ X'耢H@b0 rHJ |mH@u  [rH@( /@ 6  @ 0  H@%E"80o2,H H0"#@N   /,rH@%("80R P r@   rH@%! rH@%"80= P @ H@ 'HH 0* P  H@ 'HH ܀  k#  ޒ 0kb#  Ւ L@Ò r:H@  t@y @v t?y"a@C# %܀  8 8  8<ϐ"p cL  D"Ĕ  0 p 0@ ' X 2XH@#b0 X %"j'5"a `#HJ | @& 'H @!)`' rH p@$p`0`x ""`x"j"a H@zRP' 4H@$Z"80! 'X@(R   !c$'!c!x@1c!| @@ &!|@$7#$!x$!x`<  r`x ""`xj"! @G?k# "    8 8   8R @< @ _" ca|R @珒@?2 @  & Pr``q >` (B <;``r x r H 3r ` `Ȁ *sȀ  s̀ !ss! #`?"``@* "@@U #s! :Ȗ Br? `@L!ccR a|@>0x q ( M`r x rr H C`r `` `<`  8`s!r ` :`  `2s ss!?`"@  #* "@ #s!?`" * " @ s@!`@. @#E#r??:`AH@#8"809H@ɐ#05!8!8 @ @z    @L? "   @z  H@# "8rHjD" x"a @q` Ԑ 'l`  (3  ` `Ȁ 49rȀ  s̀ 0rs! #`?"``@* "@@p #s@q!s!q : ( B?Ȁ  r x rr H rr``B@:``` ؀ `  @< `?"``@* "@@1 `` q`? "`` .`:  @* "@@r``B :`@n` Ԁ  !s!@c(!@#`q ( Br x r H :r ` `Ȁ sȀ s̀ ss!?`"@  #* "@ʐ #s!?`" * " @庐 s@! @@ @" #r??:` @H@!"8@  rHjD"`x " @@ @  @ @h r `` `܀ ` j j@Ɛ j! s4! @mL@ ?h'L@w 'PLPH@/'T?]@OL@Vs!cH@Ϟ<rHjD"`x " @>  @; j!h  t?"@1 @. 03@1 !(t?`"!@Ȑ &!(쀢   @ "r@#r `` `  @V @ @ 㽠 %ta`  ''\ 'H ? ?@?@k@̐#k tt"` @ې  @䫔  "a(@!  8U r 8  ?c \@  t@! #tb   7 Sk# ,#sap '  taԶ@    s! @~ q , `$aps!@p 8! ` taԶ@    s! @U  hʐ!o#(  s @(?  (k""m$#(!@9 p! ```@& Dtb  2st!Ԓ @K  h s!@ ! l#\#`j"`ptx@| st  @rstw*`* k@o*{*@  ( @ 4 , *$ `h@ސ t!Ԓ @  2 t s!@א!0f! t"  ?  !tx|Xhl#\#`#d#hj#l"aXTPp@t PsT ^sP ZsX Vs  @s w* *`k o*{ * t*b 6.&x|Xhl#\#`#d#hj#l#p#t;x;;;;"axTPp@Gt s!@c ! T  sP sX s!@Q !   @*(*+ s* w {*`, @k+`o@(+(@+ @ t(, @$ @6.&$R$`@ ! t!'h@0  c s!@ ! #\j"a`ab@Ϛl sO`Oa@ sOb@sOc@s!@ސ!m! t"tbԐ@ n4 @  !o#( @+ hU!  !ta( "@Z" "  S  ( 5'\)t"tb`@ +r`h 24 # a(?" @P  @⃒   $a(@ 8H, *%`h`h " ?c \@d  "@! !    ! "!( '\a(  \@L  ! @ː!!  '\a( ) \@<  ! @" ! !("@T " r@"H!  8 !(?c \@   @# 'L!("@"=L !(@ x! @  6`h@"P`h "@/  `    :k# 3s!p 0 `"'    #\!@=  "Xhq ,s  "aps!@ސ 8 @"    9  "h #\*   "#\#`#d #h #l#p #t #x #| # ## # # ## `h? %`h'H(@ H` %`h"    '\!(  \@Z   @ِ  ! @ !(H?$!(r "`h  % @S"ȁht "`% %k'b`' '!(# a(@{̠  @"@a(?$a( @a(р $a( 'Ȑ  @  6a(@ a(@Ē @SI"㿘@`r `` `  @j @P"㿘@ϐ  a, "a,㿘' `$,@   sᄀ ec "ᄰ# s ce!c"r X%o&\@" X  @!`. `!t"$\ @ڐ! a @֔ !t"` @А!a @̐tu&!<a<k8"&!@a@k""8&!DaDj#"&!HaHjh"&!LaLr!`"h&!PaPt`P#!`&!TaTr#`P&!XaX!t<"&!\a\!"< @\!`!a`@X !j!( @S!q !(@Oaqsx!s&!a!"x$@E!!a@A$!q 0$@<%e$@8 0 @j, $, 㿘@  !s!?`" * " @G @I!to` t"##X","|@) 㿀'D'!'H'L'@ "  "r P ""`'k"  1kj!d  t! 2 1k#"a  ` s!@"0 r X  #s!@#0 t?"aԀ? j#H[b t@"| ; c<@ߐ '!D"IL @Ӑ ̐ 0@X ǐ "`'5H  ! !0 `$!0  @  s!$!0HcP@0L0@  "!0D@b  s!  !jD@}b  !js! !h !j!h 2!j 2 !j"H &0!h "s@ s!g`?!h 2#!j 2!j"H "!jU !h @Ӑ M t" t?"a@H 0B!h "s@ s!7`?!h !t" R  '7@ƒ  6t@#ht" t?"a@2  s!     t" t?"a@ 㿐t" R 7' @   cp@Lt?@"a    㿘@͒ /  1, "#@A   /,`%h@"8< s! @#x04$@@0  .* `&   d,,:   9, 0@ ,:  02 ?L? . ? 1,?`,??`"ߨ 1h 㻀% %!u#8' @f#t" t?"a@[h$   @P0#8R  @w2  "#8@#h#8c@ؔ @N#8t" R  ' 7V 7'   @א 4 6t@#ht" t?"a@C    V @5 $ 4V  t!Ԁ"(   @P-#؁|~} ~~~~~~~~~~}~~~}d~~~~~~~~~~}~~~~~~~~~~~~~~~~}0~~}@~~}p~}|~~~}}}}~~~~l~~|x %!c'Dto"##0'H'@#k  "c J   "c  kkkjkrs$3k#o%j"a#c$ " "# x&b$c(@$lt"aks"c"p@  . L * `@h 2&b$c(` @_ 2&b$c(`(@V 2$l`0@N $c(&b 8@J  @@`` 2j "al@P ps "atJ !j "at!j!l  s!tJ 2@# $!l@3 Р  L `@ `@  @`耢 2 %  %"(@{T s "ak "c XRs@o"a }`|@ Q vr s"`x`Bn *`   g"a  c"aok"#(^"br Z"`|rq8, `"8Q",kN"#kK"#$kH""r?D"`xkA"" a@ 9 %"s4"ak o""-"( t("! J &     @i!k$#a@ k  "bk "ck"#@D@H $#\jD* "@r" hHst  'D'H#ah"@#!䠒 @ӊ @@ @$$ "#h@  cL@Q D HH@  r"`|DH &<s@Ms@!H @Mݐ `@3 a @/ H'  'ؐ '`''D@͐ 1k# !r X  s!k" @!0@# X k"#s@א!H`?  `@ a @ @H 㿘@  s!H@֒ 㿘@'#r@  `X !u#8 " ! R @& @#8$#8! !( & $`X@ @v!(?$!($`XƐ `X  !u#8 " $`XR @  @#8$#8$`Xt"" @"!H㿘 ss!?`" * " @ە {sL dƀ`", s!@!P"(`? "`@ "(  &"(` v"(s@#r`t P1t!@r? s!@X!pBs2 L s!@O!9s  r X  !s!@A!+s!r"`D €`tr 4 " L  s! `?"``@* "@@!   (@s! " oj!s@!@!o#`1 %$@k`"(  ۟ @ n`@ a @   - ܚ   `"J@ KJJ@J`J2  "  " `2J@?㿘or%t#``rju"0"$##<#`#r$`t $`t@ @' `tr`0jJ@ a$!$ u< J@ `"<#`0J@!fdr"< lJ@ "` ?u<u`<  J@ "<r"< lJ@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " a$* a$ #`0u#<    "#<r"#< l 㿘 T?@%ss`!!!@a3 a1 #ܑ* `  L a@qa#ܑ*   *@ '@ 0!@? s!b s!b @_ ?!b@  @V? `㿘   %   bP@E"@Ke  / %'@#p  L " @, # @ ?#@ؒ $x@Kgc@ki  "`@ #@ @g! &/@@ . JH# 0B 4@q :'i@h (#oc\@h "c\@ . "@h c\@h$ c\$L  @ . @h}  $@h L@ 0"!@   i8 Ni@" @ ii@oR &@@`ހ @c  i @1R   ?@  i@o. &i @R   ?@  i@o &s! i)i@V  ")i ")i  'ks!@ `i `%j*` * p *    ``@-   &   ",  ,i@  is pk` #("@ p*` * ?`"-$ *`p * @ * * `" %j* @p *` #o@ Es*:  ,L?  , c(io#( s!@8 7i!@-`@?    i@4   i@#@ (ii@7  s!@ is!@  i@#@#i@ ? @J"! 㿘!i  T @|   ` `,3#i`"`02.@g . @b `"`\.,`2.@T . @O  ` ` ` `,퀢`\.L`   !` !@` "    㿘@ 2 a0@b & & @ P &a0@W 㿘  @2 *@&  &a0@B  * "  & 㿘  `  @ .` @{` @*@u@s㿘#r`X'H  'Dso!\a@ DpD@ݒHD  sH!ax@t?"a!j!l k# t!܀H !l Hs!t"J a@     !l H`o!Ȁ k# ss!a@wt kb $`X@"o",jb @!@r"Tob @#8s"|tb  @!r "p'tb( @k"kk"#"bH  @f q ,%k ?$!"0 "!t` 1t#<@i  #<@c  sL? ."? ,s!b8@#< 2,!tbX#8@}  s! t "aj "ad` s!bp@$! t"!j"!d`#8b@}e 2$s!@P"$% %'L'`'H't  HLt Ht?"aְ H L - r | 'x !!@ !@@  'H@@Ι 2"'H!@cH@Gߒ! "'L'H 2#/'H@  @û@w 2 s!c@y s!c(@q %(/ O@f5@a?.@O 2'H'HH HE#8`L 2@@#@'LL6#P``t `@0#X'tt&#h``st`#h @ԓ#p 27 r | \  s!  *oc$@X#`ð t!r tf@5k r? @ "`X jap#@^  `@   @G#㿘#o@ېc`$ s!@J#as!@Ғcc` ,@ $ %"@(@e K@ ?L@ ",@ i r t@$ $t!&@㻐o#X/ %'`k#$ ! jB"!! ? @";$!#$ - j ""`"` "" ! @#Ȱ N #@fJ? /  $d @ ?@#ذ @$?L@ / /,@ $"`@@@u  @ @X1k#?&#&#'q(`$(s!`?` 8 @  ` Ht!@ d t#8&`s!v`?`P&#$(@f%@F 2!  s!@Z X  &#i!a@d$ a@k!$!@ 2.a @Fg 㻐' %%k' E#r`D 2B !s!`@@+! %(@dy$ O/   %#x* R  n"$  p a! y!!$@   $`D!`@ @`!s  @F!(hk#$ $ Ȕ ,@H, @X 2Ȁ  @!0@  @j  & @Ґ @ 㿐#q%k`, ???$"!@ " t#8@m )  @vJ   &    2$??"$`, 2 $!s!t@y#8!@ɐ $H%q'k-t, ?$ߐ!H m`#tc8L &    " LL &    2 aP@zI  2s!@ĒaX  2 0, ,, Ĕ#\#`a@c8Ȓ  ,@?'''?Ēx''''@y?쀦`s,  s!a@c8$"$, 2 $!s!t@#8!@; $?"%ԁ㷐# %a'$@@U@Ȓa؀ # @ O!@* /2 @G@yƔ 2  N /   a @DӐ"㿐! !?@$!`w @Ք? ! `?㿘@  r x?@ @ "`7 %'!j @⧐!!  !ja8"j# :@♒ r x /rH H1r5  `8@ B `5`-  -`@B2`* @ *`B2*@ *@H  d & d4 d "@Dt"?․`@@J d@@c""@#\("8@C$@  4`  <   4  a"@, @@}bJ@"` "@#\ B#\Ȗ@Cj "@'ؔ" 'А"@''j!!j`@j"쀢" ;!j  "@ # 'j!!" `'" `'А"@@'' 8`ĉBA?ЋD.'@ @@""@@CW.@@""@@CJ.@(@@"$ <@ <@(u@C0%s `  ``  @  HH`@(@Ð@""@@C]%s H@@""@@BM%s8 @-b  `!@(?В. ȅąB'@3 @@""@@BӖ.@@~""@@BƔ.@(@q@n"$ <@ <@'@B%sR @X@ `b`@ϐ @ 0@ ?`" * " @в @ @BА (k#+ %a`' a@͒ j!!" `'x" `'|А"@@'x'|| x#r``ĉB@?pp B3? ?  @  ```` ``  ``  # xr @p#\@X;`  Ё B ;h  #pH @B d U`` ``P ` L p DrH`@H !8``@ D 49 H2H@ @b !@?hp. hąB'@.@'@v@r d$ <@  <@&@A  s!R @X@a @A 㿘   ,@@@4 *t" @В "  @{ I 6C, s!@  s! `?"`@* ("@@π %@,`s!   ?`"@ * "@c 逤Ĩ 㿐@s!`hR @?   Pt""t P"b@"㿈'''' @ 㿘@24444444444444444444444444444$\\\\\\\4\\\\H\\\PppppppppppppppppppԀ` "?    ( 񀠠"     怊 ?`       򀊀  H+ %a '@t"X@$(? @  a `  ` "P  '0^ ha0T X` }a` vaT a` Z 'ؐܒ`@w ؒ @q b, @k@!A UaT H ; @\  @X@!. ", "T X` :a`E 4a"d / ,!"T X` #a` 0` "T` X@a!@ t "T H `@ Ґ!@ 8@> a @?#! 㿐   @c   @c  ` *`   "" "b<   ""  ""@<0@ے?ݒ? $#\* & @ @+ @ \1 &"T@ !8&@ߐ "T "`H@!Hb0@Ԑ "TH"f H& 2"T@!`"T @@i  @!3 b b"T a@? @֐!  "" @n#@s"8b@  @ܐ? $ ,b@  C, 4 @"b`"T@V  ,!"T# %aȔ@b@Zb@ "Tba@ِ@O @Вa@= @ѐ "T@1   %"@’a! "@  ?"b"@"@P"(  @"0@H"` @p"h@>?@h"@ i@"b\b" @ ?b@U"@@m@"@  !"T H `@ !@ J  @ɔ ""X"T"@@"T@"?2@&"@""؀?2 @" @` @8` @`  @"` @˨` @"@œ "T`@#"T  H@"`ɐ"@"bl㿘  ! %c@""@c0@=6 㿘 H@  02  @!0@"` H"`, H@@ H  b@| "8 H" 4 H @ "8 H@6"`<㿘 H@;@ H D ", Hb@^  H "`"8 H" 4 H @ @"8㿘#@"@ H   ` ,@#X#h@ @ U $@@ @@l瀤` H`"  H "`0@a܀ ! H" b8  H""` H c@   " H   @ @ "  H@"`0  b@  H "`"8 H" 4 H&  @0# 8 HD@"",@㿀 (`H ,@ ` @.` `H       @@@Tp@L 2`H@L#0z"`#@@`H aЀ " @`H`""``H ` 6`H#"``H ` ;4`H <"``H  "@`H`"`2  : "`H  "@`H` "` 2`@ : @:@" `H 8` "``H ` 6`H#"``H 8` "``H ` 6`H#"``H 8`  "` `H ` #"` @㿀 H`< `"`, H@` H`   2 ####`@_`, H`"  H  " H@# H`@# H `@!@  H " H@0 Ha" H"  H@+  H `@א@ H@`8" @p# H @"`@ 㿘 H@ @ H`D"`, Ha䀤 2  a @  H"  b@ "8 Hb" 4 H   "8 H@c"`h * (`H",f @   @Ȧ @@W   @x@\@#0@Jh  "  0:07 X`!`   8@N@2@0#!`0 (`H",f @  @7Ȧ @1@ 2!㿀!؀  (  P`H` `,@ ` @m`   @@ `@`H&  &  0 * @ u 2& `H    2  `@=  e 2 @m 2!@m#0c 2`H 0 $ 0`H`<  @ $ ,@p#h@`H b@?  4@  @  `H $`H" `H  "84 $`H` 2"`@ 2@"@"8& &@ ,0 p@0  @;0 c@"@㿘@E(4 @֐ ~  @(4 , 0@ "@1  8Z$ 4 @A@@ 4"*@ @ O, & ` @, !Ѐ "! 2"!J , "!@ A & $1!  @@`, $* @@ $ 2 ! $@!H@ $& $!Ѐ "! "J l @ڐ & ( !`@g 0 @b@)  @ݒ`l (* 㿀 (`H ,@8 ` 3@/` .`H     #  @@@U!`H @M!0@`H"@#@>`H "`0㿐 H'48b "@  @0 5 b 0   H`< " H "`< H < 2 H`" H!@  H "@ "< H`<`@! H`<@!@x 2 H * H8  b  "8@l H2 `8@, $`8 H"f `8@$ H@Z H2 f @2`@@j<  $`88 2 H b "8 H "@884@ "@  "8?#  H2 H2 H H!`H"@2`0 '@ H`8  @a H"` 'e`@@ϐ H8b 8@/㿀 H@@"( H` 2[ H`t H'8 F! "@@@@` H@"`@ `, H@@k# H `@d!@ 2% H H8   " H@"h`@9"@  Ha @ڔ0"@-"Ő@ }@ H` 2 H@"`  H" @ 2@ "@" H` "@ H` "`  H" 2 H@"!@  H `@ !@p H "` Hf " @8c4 @@ax) % H!!'"84"@2 H b   H "`#@0D` 2 H`< 2 H@ ,` @b!@/ 2 H H`," < H ,"8 @'"@L  H@@# H `@!@ "@:  H `@!@ H "`n!8  b  "8@ H2 `8@, $`8 H"f `8@$ H@ H2 f @4  `8@< $`8 H`  "8@ `8 "  "`8 H  ??  "8 @$?' H C  7//    2?0#42H2H2H'ܠ @t@ " H'e`@ @B H"8c8@ ! @7d#㿐!"@ ' @I @#"` H'e`@@ 㷐 / (@ H %@} @ H!$  $@ & @!$ &  ` $@ ` @ %`!`$ $@ #%   2 H , "@ , $@ ` H!*!,@q H!,  @%#8 H`"% He!+4 !,"e H *`@ H *`A H *`B H@* C H "D H2 H H2 J H" L H" P H" T H" X H @ \㷐 / (@ H %@ @!$@  H $  @!$@   $  2  H!`4a $@ $  H ``2 "%` @%`!`$@$  @ 2? H , ?"@ , $ ` H!*!,@? H!,  @#h H "% He!+ !,"e H *`@ H *`A H *`B H* C H`,"`D H2 H H`? 8"`L`L`@2` H H2 J H " P H" T H" X H @# \㷐 / (@u H %@p @ H!#@ a $ !`4@#@$`!`#@$ m耢 " Hm#a -$! H!,@z!* H!,  @.# H`"% He!+4 !,"e H *`@ H  *A H *B H* C H,"D H2 H H2 J H" L H" P H" T H" X H @ \㿘 $ " (@ (  @,  4  8@   , @㿘#bP ! "@UՒcȀ  $bP"@Ր#%@|~@UbP%T H  T@   T"TH` @ @|abPbP@R   @{ bP@R p2 `0!u#@ `$#@$#@`0 5P 2! "@UcȀ &P"@#P@c`02  P@cP @`` @'@ P@` `(P@`8`$P@`P`,P`h@ . `4 ؐ`8  P @ `x@p  . @e`!`#\l#` #d "P@X@e` `l#\ #`#d "P@E@d``l#\ #`#d "P@2"P@.a@{"P㿈`'쐆`" @' '@ @'@ɐ @ܔ  @ؒ쀢`@ѐ@'@ʔ @ƒ"\@ڒ㿘#bT d H& $&@U!$&& 2@!@X!8&"@& 2&@!&" bT!ah@Ԑ!``ax@͐!`!`a@Ȕ㷸- %"T0`' @7@@a`< G `@@(`<'ؔ @"ؒ @#@@ - @@@aa 2 `( @ @#@@   @@ѐa@i`(a@b`$a@[  `H&  T `4K-  " `H M  #0K& `F@   !@,a`HȔ @`H`8& @@   !@b`H`8@`H& @@@,@  `4 `8 ؤ @y!   @ ' @   H` @3b @Ԕ @3a"(㿀`(''耢 '@'`$  @'耦 @' D@  @'' ,``4   ``'@h( "bd@C@V @R(4@N `(@I @E `$@@ @< @8@4 `8@."\@?㿈@g "bd ' '@  @1"\@)@M "\@W `@"H @"`"\@G 㿈@g bTHb   "d'@' "@쀢  "@ '@7"@˒@v㿘"T  H@f-   @gh 2 fJ =2 f "f@tX`2 @ 2 $f@hf"$f@$f$f$ff" @@@@$ f- "@f  @z"  `$``2 #@o @*Nf@@@@`@@1Ӛ㿘"T H& "$& &@&"&` 2&$& 2 H-2* _* H* 㿘"< " @   "b "@@Ѫ ?! @#H! "?@ч "@ф "@с @V"?$"㿘 4.` 8 @ m @`# ԓ.` @h  #P@ @ 2 #x@$@ #@ "㿘N .  = L .4 .`.`?? &    !$  &     _ - _2 _ 2 #@  2L 㿐  N. &    2 *:    N " @L "  㿘1u#H% `@H = `  & @J     @@2 @0(` " ' $ ` \2 ,@ \,@ `,@`` @* 4,@@: 01 H#H㿐@? 7 @ P"T!  `@`"@f "@c "@` @5"@3 7' @?? @ @ʐ p    @6  4@L XdpDl,|<L\lx LLLLLL@LL|LLLLLLLLLLLLLLLLLLL LLL`LLLLL|LLLLLL㿐"T5  H& @ "" <$" $!"" """$!, $" H$$ $ $ $ +@ $ +@ $ +@ $+@$+@$ +@ $ +@ $@O` @ &?@-@ @uw"`?㿐! @ 3""@O` @ ? !@Z @ɐ @@uT㿐!"T Hf @ ǒ>`Iy*`#  @/l0~@+?y* hv" @"?p* h l"@ @?f* h b"@ @?\* h X"@ b@ @& 0P"T@ߒ`0K!!@@ "D$@!@ @L!@09b b  bbbb@ @0$@b $@ @0@Ւ 0@ђ 0@.0@ @2@ D ;@ؐ @(㿐@ ]~ ! @ -> .@ @ ) @ E`:@ `: 'a2@ @  !(@w0 !H !@ @ߐ㿐 @  !!? (!p   ؓ,  @K 2 !.@ !@ ʒ ,"ۤ ; 0@Y!0 @T!0!@P@ 㿐@ !"!"T@p   @  { "@1@0@+"0@ ? }@ 㿐"T'@ z {@"@^0@͐(4 2 @("@ @9(4 0 * .`@$ 0@ ?Y }@e@ O `0V HS"   `  2 @  2`  H"` ``H $`H/"  H&"8 6А  @    H@"X0  H " H@"`  H"㿐@ >`:L*` 4 `0 G&`0@ ܒ!3@o!0 bT@p)   bT"x@c`@/bT+&`@  /0$`,@Q 0(@ِ%&`(@Ր!&`$@8&`@4&` @0&`@`40@5"@@  ;@+!@{h- %'@ ̠   !!?  @" ;"?@^?  ؓ, @ò 2@ "0ؐ ؐ ,* : `2! *` $@"@ D!@+̔  $̐@ @{؀ ؒܠ $@{@ !" @ #h ;"?@?̔ @  @ !̔ @і є @!̔ @  @ !!?2 @ s# ;"f?@b?@I{c @Iuc ̐ /@Ilc @Ifc /@ M#ۀ ; L@@ #0$`L@` @`AK?@L@`A ,"< ;   #c8@ %# 0#H@ @p?@ݐ@ $ @ 7# @&@ @+ 㿐@   2 @  8@@02 ,( ;@K!2@2@  @  X@& @no$$&@@-ڤ ;@ !@p' %"T' H& ؐ@a (@m  2@ Ȑ  @} b, $$ @ ,؀ ;@ !@ߐ  @+{ @  @Ӑ㿐@N @  `"3 D`  2*@`@n(  2$@`  2 D 6 X . .   @ @4` D 2@@! 2`@ o `@m & D@`2` D !@ ^ @y@t ,Ð @ʔ(@O:  L㿘"h   @ߑ, @ :!p "8 @ 4 1 "p@ cH$"cH "@ @4*`" *  * ?)"h   À#(   T 2   "@2`2`` 2 @ !8@;?@ # @ @_"8@ ݐ!h@_"8"h `   Ö#(` 4`  `T`2€#L  `~"#L8+ % !?a#'@q*@`@ccax@ ϒ`P`@?$`P  `L /a`P +@ ! $`T @"cL@@Ja1"l  '@( # @""la @**!H' % , '  @a @lÐ0a@z&  aȔ@N 5 A A21  L 2-   (@A @l0 a6@z @   a@N & L` Đ  `    @)ϐ"㿘bp   "  2 2"bp cH  "cH"@m  2$ @ Ȑ" $ $ p`$ `  $"p"  4$  2"$p "2  2  "pH" H㿘@(  "H@ "h$ ""h$ $ $㿘#bh  "$bh @8 h% % ' @ @ V"pȒ  (@f @kȐ0 a6@y+?@0 a@M @ @`    `@   @("X' %' ` 2@( @|   @ @ "`Dbl@xݐ "Ȓ@ @(" ," 0㿀 'Đ& ,bq@x 6@Ԑ#  2 ,@ɐ#( ,! "p@x䀢 6 ,@#` ,"y@x䀢 6 ,@# ,bf@x @# @D& 8 & 4 8@# b`& <& @ D"`D  ,# ''bg@xq 6 @  " #4<#@''#"< ,bw@xY 6 ,@p 8 ,bv@xN @f `p% %''ܖ@ 6  #\@ V' 0 '''@~Βఒ @w p @(  㿀  < @@2  @ , 4@  8 V  ?$ @$ < @ <"@ 8 4G$ <@ @Ҕ  <  @ @ 8$ <3` $ < 4@ V 6 < <& @  4" $ < ' @ S  <  $ <"  ' 4@@  <  ? $ <   ?$ < " < %0%%%%%%$H%%$%%%%%%$%%%%%%%%%%%%%%% %%%%t%%%%%$%%%%%%$#$%%%%@ !x!!!!!!!h!!!h!!!!!!!p!!!! !!!!!!!!!!x!!!!x!!!!!!h!!!!!!!p!P㿘  0@w( `@y{  " &  `@ !Ԁ  `l@  ! `,@ @㿘@i@``c`%@`@ !*`! #8 ؓ*` $#8 @M #<#8   & $#8@A 0G@>!0D&  4  0 @zԒ   @!H@. 0"@  @z` 2  @ߐ!p@@@@@$@.@$@@ ` @* ` & 㿘@A`?`@o     @y`* @@` ` ..@@O@  ݴ .h %a;' ? cP' !@v  ,`ؐ .  [ jؐ .   @+ @?* : `3=Ɛ#*` +;  @ ` & @J   &@  x t+?+` : *?ѐ t+ +?` ` `ؐ` @ !@N`ؐ .   J @ ؓ.  "@9`ؐ` @ @/!쀥@@  ؓ.  &@"H@ @v! أ. @m&@"`&  cP @ΐ  ?* : `6*`Ɛ"  ; "- 7 `  & @J    @@2 @%  " ' $ ` \2 - \-  -  @* "g- "- a-@S'@*̒@gz$S@M@A@$Вi?g$@@M* : @=* 2 @$T?R$+L   @$??<$0 ""@g,$0J@E"@;@8$`@  : -  @8А - ' cP@""@ %! @$"`# %`a '@.#7a (0@ސ'''В@{ 'Y'̀  " 'Ȁ  ͐ ,   " @l  , a @$c#0/l0401D2X23(33994@4d45x59678x89999Н㿘 X5739&&&b |" "bx**X'"㿘 ? & @jv  &` 2("`` x#X@ #"b"x x "# *Pbx*?bx*@ " 㿘<? &      - """bt@Ӓ0G? &      """bt@02P"""bt"*P'+    ? &      # "@\ """bt@\㿘` " "x""| #"""t  #`bx"b|  $㿘)   %'t#$`!$ g% ` """|t$ $`$t$  & 㿘? 㿘   * %%`@0#@% * `\`" %2@#X% "`*!㿘#,`   Ԑ x  &   D  ` @  "`` * %%2@#% "`*!㿘!, ! -_ &     @  "` &   D "!  * %%2@#% *"`@㿘N  %#x* R ?`ɐ#*`  c@? !Oc@? !F`@?} !6`@?u !=`@?m y!?@?e` sq!M `0@?[ g!@`@@?S _!7`H@?K W!9@?C`P QO!" `h@?9 E!`p@?1 =!`x@?) 5!*@?!` /-!I `@? #!C`@? !8`@?!  N  !: @>` !`@?  2N  !`@> ! @>ܒ`耢 !! `@>Ґ ް!a@>ʐ ְ! @>’a аΰ!4 a@> İ!a@> !@>a( !K `p@> !a0@> !%@>a8 !' aP@> !aX@>| !@>ta` !H ah@>j v!A@>bax pn!1 @>Ya ge! a@>O [!a@>a  2T a@>> J!;@>6a DB!< a@>, 8!Ba@>$ 0!a@> (!#@>a " !N a@>  !@>a !& b@= !G@=b ! b@= !b @=ސ !+b(@=֐ !,b0@=ΐ ڰ!.b8@=Ɛ Ұ!2b@@= ʰ!3bH@= °!>@=bP !J bX@= !Db`@= ! `p@= !bh@= !bp@= !b@=| !b@=t !b@=l x!/b@=d p!)b@=\ h!0@=TbȀ b`!E b@=J V! b@=B N!-@=:b HF!$ c@=J   c@=' 3!c@= +!(@=c( %#!LcH@= ! @=cP !5 @<c`   ! @<`p !㿘!'H'L'P'T'X"@$1"$H@T" cp@Ds"! " "@~""@| cx @w  @D_c" ! %c@~"@f{"@# 㿘!'H'L'P'T'X"@o$1$H"@T" cp@D=" "  @}ݐ""@F cx @A  㿘!'H'L'P'T'X"@G$1$H"@T" cp@D" "  @}""@ cx @  㿘!'H'L'P'T'X"@$1$H"@T[" cp@C" "  @}""@ cx @  㿘@>" %`N m`@X p@? :&@(. *` 2ݑ: .h%'H'L'P'T'Xʒ$"#b!$@""H$@S! #p@C1"| @C#pb P4  "t "c@C|  " '@} "|!#x '̐ ''@}'bt' c@''?? @u\  "b x# %a'@' @@|{ a 'ؐ `  @ * ؖ @|e a @t# x# %a@'  @'ؐ@|L a 6  `  @ 2@*   'ؒ@|4 a @C#ȁ 㿘@2  @p``?㿐  " c'@ "@`˔ 1"c@`Ĕ 1"     @ ?8" *@  ? @ (8"?(㿈  @{Ҕ   @|)    @{Ɣ  @| (7@@{  &x<*@ * @\@'   7///''777  @7 @{ @ *  D&@7ؕ2777ސ  |@7ސ @{p @ &@㿈@{f @{b   .. 㿘! "  ` ,`$" Rm 1"$ " i&"$@T 4i?"$ " &"$\$" `@ (` &&!"0@  @ $"01"4 ?&"4@* 4??"4 X"0$"02&"4" Ӑ  `   6  3b(  &b( 1", &",@ 4?", b(&",&b(?`6㿐@zϔ 㿐@zǔ  g( 3f+gf# g( 3f+gSf#㿐'@z 㿐'@z 3f g2`* *#3f g2`* *#㿐 8 } {` 0 ; ` ` 0?ޠ㿐 ; |"̐ 㿐ْ! l" @z@w(  2"@z  @^ϐ 2㿘 &@`  .@L 㿐!$"  !K!00  .` .@  .@.`("x0`` :@%    ;#e㿐t!#(W0 @; y㿐` #H @6( ` wJG!  ! @@ `@`@ ʐ#h 㿘L@ -  `2-L@L@ 02( L`x !` &     `#"# L@ `` ? @ /??Ѐ@=L@` *  *   ' 0"   # Ò Ð   Ò Ð @  p   p %.} 0!i 00,  p   p .[2`0G0m`s!  ;" S  @6'`!  ;" @ @5Ā'l'ܐ8'ܐI / ܐ Ȁ ;" ) 9! ̐ ;"԰ а @5Đ?'ؐ% / ! ;"  ! !@ ;"  @5'Ԑ! !` ;"  @5'А : !x ;" ϐ ߒ! r! ;"z v @5o'̐̒ : _!x ;"g c ! O! ;"W S @5L''' ;;"B ܰ. * *  ,ؑ: `  `?Ԁ`Ȓ #*`   ?. *  . "*  . "*   ?. *  . "*  . "* 㿘 @m  !@t &@tא!& 㿘   (! @w & 㿘` @ #" ` @ ?` @`@ @p" ?ϐ!耤? ?`` " ?Ð"?ڀ?"(@t@@t㿘@I ?"8??"X??@ދ @ޅ #?"x07 %'Д  b  < 7 o" @ `"``@m0  T"    @ <"``@m   0"x g@s@s@4(4(@"_(4[ hD `"``@lԐ  "@ 9    `"``@l  Ր"    `"``@l  "     " $@&@`  2 " @l^` $@"@Ҩ ''@sA@s?@s=   @s5 ' ["c'  ?; 2M!ȒH D Y>" @"؁㿘@Z0ZpZpZpZpZpZpZpZ8ZpZ@ZpZLZh` %! `'J -'Hê  "@Zb耢       %b %!3 $79;5À * L@€a   `b  @  @H@"??c\@@  @P Ôb@ @}Òc@: 0@  b@!@ "#b Ðb @  B="+㿘@oΐ   @U @ #`H N 2 #&+#+b '⼒ @6  6@Ue #H@߆!: <"%b⼐ @zH !??:"@UL Đ#@ s @o0 "<`@ $`" <B<" 㿘!@0 &,"` "& `",$ ܁㿘"@  ⠐⠀@ @  @@@ ⠀@@ 3#?㿘 b !  )"b`, : A! !`"᠀@#!7b" " /#!! "᠀@#!%b:! ! "᠀@#!b " "a  #!  `@""b? #b1 "  @ " !@/ !㿘! "#"$Ēc @V!@r!? @\sc "b?@|}@T!@ #? 㿘1" "@Y   @Tj!@ # ?&"@ލ!  :""b 㿘" @Y @y!@I㿘 %`("(@   """"`*  $* !!((  #!    * nnnnnnnnoooooooooo0oDoXolooooooooooooooooooooooooooooo0oDoXoloo㿘  #" "+##*`*`*`*`*`*`*` @sS,@  㿘# ! b "@#ؒ@$b $"" b # `$b ?㿘# b  ! #@a $"$b "  b #*@`$b  ?㿘# b  ! #ؒ @F$"$b "  b #@<  ?㿈 %!'@8 N @z  @q@  ?  a @Ȑ 㿘 @@K@ p?Ѐ6Qڄ (K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?㾘N@ 0}N` x X25N@` N@@ '%ő*` : , ?$@ 0 N@ @ *`  `,   "@` *  ` .  B  0AN` b B;` N@@ '%ő*` X: , ?$@ FH N@ @ *` ? `,   ?"@` ,     *` . ,  $@j 㿘#` "     ` 2``$  . `$ @  `㿘`0 !#Ȳ   .``$` ?@饔 ؐ p#,# ( (  (  ( ( ( %( "@ohc. !#Ȳ  .``$` ?@p  p  @v㿈 %!'  @㪖 J  / / / / /  / ?//@@ s pȔ   . $ ** * * * * * * @2  N  K ?@?A  ? ?9 а?a @ 㿘#`J  @ 9?@I `J@`$`@!\  `8# )H  $ `    @7 `?`8@ݐ `8@ 㿐  `@Ska @ ?!(Ő!H@E?0Ŧ! @ 0/+ `" ܀  @/  %"(# ?4 @'` @J?` 2 &?΀  @S'a {  @Sa@ bLO@ ) "P  = # b $b䀢% " L@kT 2b@P @!`b? $b! "  @ " C?@3 ??%"P?$L $b! "  @ " "@ bL@mbL"`L  @Q & @ ` &  @     J`@ U 㿘c%   9#1 "`&"c@j,  2"@PK @s!`"? &"! "  @ "  ?@Ő ?$?$c &"! "  @{ " @  c* "  $㿘. 6%3;cc. c cc  ! c !䀠 (#  # "#(@##쀢@ *``"㿘! "#`c$"""##@j #c"$c? $"! "  @ " @( 㿘N !Œap@ @[@/&ap 2@O!x@. 6N'? ! @R   "@T֐   @OfŐ!@?0"쀢`!! %"@m0`ܰ&㿘I`, @ #`?$ bܴ  `  ##"$W" Rb`&b䀢 b? K&b1 "  @p " z?@ v?`$``ܐ @( b? +&b1 "  @P " Z?@ V?? $3 b  @< b "@q @C 3  :?    %!@rb$  $    %!@rb$   "    %"%$bܐ`&$  " 㿘 +O- i`  ?/# b  $b" @i 2b@N @!b? $b! "  @Đ " ?@ ?%`?% $b! "  @ " @ ,*` "`$܀ " ? & @T  &  @ `  = # b $b䀢/" @h 2b@N @B!b? 4$b! "  @_ " B?@ >?%`?% $b! "  @J "  @  2 #*@ @ @M @ !? / *@ " *$`#` ?㿘N !Œb@ @@-V`2@M"@1 6N*? ! @ԁ   "@S   @MŐ"0@?0"쀢`!! %"@k_&  㿘u bܮ  `'@&-+) W ,@ ``$ # *@ @ 6@?`@܀   " 㿘"  ! #"܀  N@`  N@@\IJ` @M! @JbP?"ܰ 㿘 J "@ʒ  &?& b >+ # b  $b䀤"b@g 2b@L @!b? I$b! "  @. " Ұ @c ΰ %┐?%b $b! "  @ " @N b@jb @`* 5Ŧ?@ `*?@ &   @ J @Őh  ?%   $b"" @g 2@L @!? $! "  @Ɛ " j @ f %┐?%b $! "  @ " "b@ b @i`b@ b└  < # b $b" b@fϒ 2b@L4 @\!b? $b! "  @y "  @  %┐?%b $b! "  @d " b@ b*&b㿘) %"(  3/? %@Q"(  %"(X'0 >+! "  ` $"" @fp 2"@KՐ @!"? G$"1 "  @ " K?@O G?$0?%` $"1 "  @ " ` @: ` ,`*` "`$` 2` ` &`*@` "( @ ?@K"@" % ?6 ?6 +` *` %㿘 @7" ! %Ũ"'ŀ   `@ @n" " ^*`: \"`?"`` "@ "` \?"``"* $"@| \N``Ŵ"@M= ""@?M "`  "]* @^ ^"2  0`"@  "* $" @E " 82  0`"@  "* $" @- "  0`"@  "* $" @ ``N?"`` "* $"@ J "`?"`" * $"@  PP``````````PdTLPXp |TTTLh㿘  x@K!'('D'H@g"#PH"`@g   H J r`? ""1-'%  ! ) %+ "$ x p"0 0 %+ $"H"`@gr@ H#XD@?• s $\H*@'HD" 'DD`HJ@-D  `"""\H 'HD'D@Q) !  $" @   <      @Q @  %$"@ϒ"@ @Q  a@Y c@Y  @Y `T@Y @Y_   %#`@lzbW#hL %D  +"bHJ@%H@@ H }   "` ) %HJ@!# %H #@K  %D  %b@l<#xH@J2 # "` %  %"# 3 %! 5/+ )%';9ŀ  b bؒc@f x Ѐ @l @O ?'  "쀢`bؒ@kxא#b 2 b #А @fy xE  ?&?   J  # ? ?5 @T" ?@c & ? `ܔ@ ?" b??b0%$b b&@kx#b b  b #b@f+ x0 cАb@f# x b@kxb`o b #b@f xݐ b 㿘"`" "8    8  & $$ 8J`,`;  `;# $`@   4  &  8  8$ ?㿘 ܖ #J@ `$``J? &`   ` ```J?`U *` €` $` & J@ `$`J?   ` `J? &`   ` ``@(  @$Ő<#@y# - ^2x v& ? &`   ` ` - ^2 b?Y``@(ʔ  $Ő<#RL#G` . 4$`G܀?@@ / @`? 9`J@z `w$`+``$`J``@$` k (?` ;` $`" "`8 ,` ? ,@ Ɛ O?C 㿘   !J@ `$  J? &`   `   J `p%$ "H*` € J`n" `p`l   2  $  $  $   J ` $   `@@ `8ꀢ `ܤ @  J`n" `p`l   2  $  $  $   J ` $ ɐ  `2@`@ b8 &?@ ܀ ?`ܤ @  J`n" `p`l   2  $  $  $   J ` $   `2@l`@ 8 z`,   2q$0o ` "쀢`"g? `] 0 J? &`   ` L H@ I J`n" `p`l   2  $  $  $   J ` $ #  ,@ Đ  &?@t &?I 6L@?  ! #@G L@  @ J#` h #. &?@?  ""8""b< `ސ 0 J? &`   ` ͐ H@' "˰?L@ !  J`n" `p`l   2  $  $  $   J ` $  L@ ! #@G @ 5#@z]0 `  ,@  g G  xG V` `& J`n" `p`l   2  $  $  $   J ` $ I  `% 6  `: 0 J`n" `p`l   2  $  $  $   J ` 8$   ` 0 J`n" `p`l   2  $  $  $   J ` $    " " J`x `x %Ő"@bc0 8`ϐ  J`n" `p`l   2  $  $  $   J ` $   ``8@`8@? `@   J`n" `p`l   2  $  $  $   J ` $ s  `@X `8 h@ V  J `8 $ U  J`n" `p`l   2  $  $  $   J ` $ 0 `8@ S `@+ % J`n" `p`l   2  $  $  $   J ` $  `8@    ?`@ )  8  ``8` ,@6% ֐  %`8 ̐ Д J`n" `p`l   2  $  $  $   J ` $   `@@ @ `@  J`n" `p`l   2  $  $  $   J ` $ q `8@ e  k i?`@g a J`n" `p`l   2  $  $  $   J ` $ ; `8@ /  5 3? `) 0 J`n" `p`l   2  $  $  $   J ` $  `Ѐ  ` Ȁ 2"   " ` 0 J`n"  `p`l 2 $  J ` $ ϐ  `Ͱ? "쀢`Ȁq0 J? &`   ` 2 H ` ,"`8@  J`n" `p`l   2  $  $  $   J ` $   ` @g J##` L@ ! @D` L@  @L# c h# 8 &[?Y , U R"`#') # -J` > J`g" `p` "0+`9*`0&`r 0$  $  $ @#>  @@`% %  ?$`ƀ    `2 萌 "  J@   J` 2 !" ` ""䀌 @   ? $! "  @  " а?@ + ̰?@  @@\   "`% ? $# b  @ Ր b @   #  `@ ]` &? `` ` ?$`` $``  ?$`% J@ n" p l `2 `` ` ` "$ `@m g J`n" `p`l   2  $  $  $   J ` $ A   @'  `@ ) `@5 /)# `8 ( ` `8` ,@6%  $`8 J`n" `p`l   2  $  $  $   J ` $   `@@#ۀ  `ߐ 0 J`n" `p`l   2  $  $  $   J ` $  @  J`q`Q2J $ ? J? &`   `  H@  ` %, ," 8"`,@  &? J`n" `p`l   2  $  $  $   J ` $ ^  J##` L@ ! @BC L@  @L# F h#W!(!0  `8B 3,/"  `+ "쀢`'`q%#? ` 0 J`n" `p`l   2  $  $  $   J ` $  P "b  "@`   ?ϐ   @   @<#@  ̐# " ϰ?"  J`n" `p`l   2  $  $  $   J ` $   8  8 `,@& @  ? J`n" `p`l   2  $  $  $   J ` $ l  ` 8 ,@!80a `X 0@S U J`n" `p`l   2  $  $  $   J ` $ / ! Ő#@` @y  b쀢 "@Ƕ!@0  "@` `8 @  ?!H Ɛ ?㿘 `" "`8 `8 4 ƀ  ,   ?㿘 ܀3?1?%)`,  ?,, `钐膢  $ ` Z   @u  `܀ڀ`!X?㿐 J@ A & J@ `$`J?   ` `J`  #; $`J@ !`@r$` ' ! Ő#@`c  Ɛ!h^[ ' $ 9% 1 ""`&" @X 2"@> G!"? &"! "  @d " 6 @ 2 $$?$ &"! "  @O " `@ `'J@    @` `* '# J@   *@@   㿐 "耢`'!  `"`?  `,  =- %   $" (@XD 2@= ѐ!? $! "  @ " ܰ?@# ذ?%`,?%( $! "  @ِ " (@ ( !*@J@ f /ƨ 75J@ !T %`, < ! " ($"" @W "@=V "? $"1 "  @ " ?@ѐ ?%`,?%( $"1 "  @ "  @  ( *@ J \ %  (*@' @ I`, =! "  $"䀤"(@W "@= +"? 9$"! "  @H " 6?@} 2?%`,?%( $"! "  @3 "  @h  (  *%  3J  24!`, <%! "  $"" (@WK "@< ِ"? $"! "  @ " ?@+ ?%`,?%( $"! "  @ " @ 4  @:h   @(`*`4@@ [  Jc c@= @Z>`, <'! "  $"" (@V "@ " N?@s J?ݐ ֐Ӑϐ̐@ $@" "@ $$$8" " `b@隒b? " %b! "  @ "  @*  㿘! 䐦  `8 "@ ` U"܀ S`& "@N` E1 )"`@$&"䠒 "<$ @ "? &"! "  @ " )?@ %?" ?%  &"! "  @ " @ΐ  ܢ3  ` 㿘%  $ @B )? $! "  @j " 9?@ 5? ,`@  ? ` , ,&@?$" $` % ,"# `$! "  @6 "  @k  㿘  $? ,`@  @" #ⱐ `$`ܰ A &?@@ 㿘 &``  ` `Ɛ!?* `@ 2"`< "`<" 㿘? &`   ` ` ?`@*U@ !Ȱ? < @   << "< <``$ 㿘@R     ":@8F n! 㿘"  N \2 `?㿘' 8 9) ! ""`$" 4@R 2"@8 E!"? $"! "  @b " . @ * $8?% 4 $"! "  @M "  @  4N`\  `*  4*  4㿘@l "䀢`  ? * @"@@["㿘@U "䀢`  ? * @"@B@D"㾐 %! b'  L  ? #`,* * %"1Ɛ! !0Δ  ! Ԁ @U[   Ԕ @9ƒa @/`,!0 鲔 @H 㿘 "` @H ? *@* " @G?㿐@?  **@"`h @F۔  ` " ` " @"㿘 "耢`" N ! ƒb@9r @9E /  R! 㿘J@  2" `"J`   ! ! :!4"(5!@5  . !   `@  @Q6   $!@6 Ɛ"@ 0 "`!@ ! ! x@^ۖ!'!@QI $!㿘 L@! ` "`#Ƒ* :  [ \  L@p   _bPL Y L@ ` * `) $! =' # b  $b" @Q- 2b@6 캐"@b? 5$b! "  א " 2   . %!?$ᤀ $b# b   b ` `@S*@ $ %`Ɛ"p ᤒ ! J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] 㿘&@&#`J `" 5 @7 `0?J` @ (&` $`` @ϐ  @>  @<#@$&@"&@ ?*:  g2 `$` & 㿘` "`J % J*: @`! `%`" %``*J :` %y) ` 7 ! " 􀢢$"" @P1 2"@5 뾐""? $"1 " { ې v"% ?$ $"1 "  ̐ "   * *:`$` `J `\'` **@: $ ` `` %"(! ?6 G "  J?` 2 &L `=J@   ` # b   耢$b" @N 2b@4 ("b? $b! "  E " ?z ?%`?% 耢 $b! "  0 " $e $ $ ߟ  @Q( @Ȓ R$?` < # b $b"  @NE 2b@3 Ґ"b? $b! "   " ?$ ?%`?% 耢 $b! "  ڐ " $ $  I  @PҔ$ L ?"`  < # b $b"  @M 2b@3T |"b? 0$b! "   " C?ΐ ??%`?% 耢 $b! "   "      $@2 $`I"?$    @Pn  #@*@# @*`  㿘 ` -+/M &A \` `" , %  `耢$" @Mp  @2Ր ?$%?%`耢 $! "   " @K @ `*@ M M 0H 94G?Ѐ4C* @  "@@ + %  b$" `@M#  @2 豐?u$%?%`耢 $! "  ɐ " @ @< `*@3  )# b  $b䀤"`@L b@2L 8%?%`耢 $b! "   " `Ɛ `  *@  `% & # b $b" `@L b@2 Ɛ"=b?$b䀢 2'?! "  Y " ? ?%?%`耢 $b! "  D " `y `*㿘% # b0! 4  ",d*@  *`@Lk$b0 4$",*` * "ǐ4*",@ *` "ܾ4*",@ *` &  $4@1 ݐ#@˰ @L"",$",$b0㿈 8 `ܬ ,?  b"!` Ȕ$@-#6 ǒc(@Yǐ ?."aL?#h#`'J . ./' " `@-" `'d` "l"daL  "aLaX "aX@ސ @ܐ ǔȖX@' ?i? $#\* @ ?#p " ǐ#@&@&`ah !"ah "aP  J@ -2J`  ǐ#@#h  "h"P  !X ǀ cP@YI !P  @ !l@ ǒc@Y7 a`?!d"a` @  E  @vt ?` M "*` !X 3ǐ#@v@+ 0*  .! @{ .?#h`' @,n " ǔА$@E#8  @@b 2   @<  2 , !@"w#ؔ@vMА @<  !h !(!P !d!P "# ސ#!!d +!h  aP@ ͐ +aP Ȓ`8@+$+)()!d @Δ$ )!X Ȑ H@u}ǔА$@͘#Ȑ h@ul)!l &3p@ސa\`?  x<   @2 O   x<  3 3aL !h !H   %Ȑ"ؒ`@GA!d ##P @@   aP 8!l 5!h 1@m ,aL )Ȑ @0$ "  @Y @ aL !\ Ȑ @˒0Ȓ`@u4 @ 2 :!H   @; @㿘@uG  㿐@9   "`"  @2     2  ?cp- %'@<    !L &Ȑ @{ ?!\  @0 !L    +!L Ȑ!@t@P?a`   Ȓa(   !L Ȑ @@@P̰ !l ?&@; ?!L Ȑ @)     ?#  ?@u?!L Ȑ @  "? c!L @ @@ !0ǐ#@t}@ɰ  " ?c       !L Ȑ @tb a`  ?# " ' (' ' $' ,%a`!!P Ȓ`8@*D 2$!P @D @O    !L Ȑ @  2%!H ?#   (' @!L ?  @ @1!@㿈 \!P X!l T!h " @N 8@ a@G0E &@ "@& "Ȑ!P@; 3&@ Ȑ!`@/L` @ Ȑ!p@#!` # $@O''(#,@O''@FO耢 Ȑ!@ 㿘 %"@/T  1 a@E%?P`? "`@- ?P  $?P ? y %(`? "`@, (  "(`  % y`?㿘Ja !aL@@W  ' (  , (@)F   ?,  , `L@ 2L@ 㿘֐  @) $@ Ȓa@)" Ȓ a r.  . a@) 2.? r. 㿀!!@  !L & !@ %Ȑ!@J b@[!!@  _$!@Ȓ`8@( " !L $@Ґ J *  0*@"(@d d @3B B  @2n? @3 ,4 4@3ؒ @#`Ȓ"8?@4#\%('@ 0B 8B@C ;(<0.<8!L )`'  %"X@Ib!0a(8d@ @3D  B@3?ȅ"x'#\@㿐!l  %"@Ihb0/!h 2@3qf" B@3j? %Ȑ"ؒb?@C@!dD   %Ȑ"@CɒbЁ㿘   %b@C"@ߐ㿘 `"d N@ r w N`  !@_ "P  @9A `  L& P&  & 0& 4& 8& & & & && H @5  T& @*` X:  w.ȔX ?@< @  L@@$ & @,& "N w&@   @  @   @  㿘  2? ,  XN w r?`@z ``L`T&@ `P&` &` >` >` @ME@MA@?㿐?#@?* @ .`@2@ 6`@'@ro  ? 㿘 H ? 2 @ L"@U $  $ H ?$   ?$ @`$ 㿘ݐ ڐ * Ր * А* 㿘  ƐȒcP @ p   e`bҐ`P`L&  `&* `&`P  & ??`?`` c@.@`~`P  & `2.@``l`P  & `"  H][`P  &  H  @ ? O"p #P#P! % ` !/'/ဦ`///666///瀦/䀦 2/  / P  /'&` ''@B @&'܀`  @:d? ?! @㢐#`㿘`H$` \$`Z!` `@`L"@@R $`  $`H$``@F  6 'T`@@" $@`@ @  `$ P@~ "+?@ `$@   $`H@7  @X $@  !`H  T` 2` ! T`@@D" `$@&㿘?4`c @@c@@ ? @ ? `  ?@@`?c@? @@%c* @!G?"P![@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@ϲ`!?@#@ߒ#a L(7@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@β`" !?@@`!?@#@#. @㿘?!? @0e#   @I@x##6`6 ? @#  @& & 8& #…8& 8& .  D%  D  Ȅp    (``    00*`H``   @0@ 㿘 #@ 1!H㿘` ` #@ G8@ H* `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6 @`"8@ * aH@`6 @8`  `2`` 㿘  $ 㾘:;n # '  *`$``*xݐ`ʐ.6 > ː`.6 > ޒ9FFFFFFFF9:L::;l;<\<@@A$BlCD$DEdEFFpFxFF ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8*" <" 8 㿘 N 12:?@ 5?2 (1? $ "|$ ($ 0 , 2 ("$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 ʆ〒c  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4<  ( 2   $ * $ ($ 0$ ,  (&@@    4@>M"@  (#$ 0 0" @8 4  @>?"@@   4@>8"@ ($ 0 0 ( $ 0$ 0 , (@@$ , 㿈  $`"Ӱ?  "ϰ? 2@  2ǰ?@ 2  $@   `8`< @`g  `*` `  $@"\&  @?*` * 4 @!  :ː  6˧4 `$  . * $`   $`& 8  $@ ¤ ",&  @?*` ?c4 4*`  , $`& 8   $@`   & & & &$`<$`8P   $`& 8 $@`"& `  $4 $@"&  @?*` $`4       4     (&  $@4^ $ 4 "&  @?*`?c4  $`@   $@`@ 88 @=2`@%"$`@@&@*"&  @?*`  a$``4  $`d4  $`\4ak򀢠h $@$`h`h`\@0 "o&  @?*` `h˓*  `p*  2$`h4`\ `he0˓*  * `p2@ $`he0 $`L$`T$`l `p `l`T@Қb  & (ː (&  $@ $@$`h "(&  @?*``T * ?`L * @@7`@7 񀤀  "&  @?* `$4`h* `p2@  c$`h   "&  @?*`` $4`h ?* `p @ 4/! `"&  @?*`` $4  4"&  @?*`` $4  4`h```d@ n??" ```h`p* 2  ??$`h```d`h *o`T@ "@e0 $`L$`T$`l`lb`` `p`T@ i`` `l*``p$`P$`X`d@  @`X Xː  $@ "b&  @?*``T * ?`L * @@7`@7 * (7 7ꀥ ">&  @?*` *@ 2@  `L* @@7`7$ 4 $4$`@   $@ @ $@2ː  $`H$@`H` :`H "&  @?* ``H *@`@  $`@4$  $@ "&  @?*``X * ?`P * @@7`@7 (7 7ꀥ "&  @?*` *@ 2@  `P* @@7`7$ 4 $4 @ $`D $`H$@`H` :`H "&  @?* ``H *@`D  $`D4$`,`D"@i $@`u%`D"`0 `4`($ ""@`@8`@&8`@&@"$`@ @?.``@ 2@ $@`H  `C.$@ײ` 68  ":&  @?*` %@B > `$``&$`& 8?c4 4 *` ,` ː (&  $@   $@ ?M?& & && $`8$`<`(  @ 8     $@3?  ' %  B@B > > ``` $` `M"@$`& 8` `<@@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?   .?      ?   $? ( @ 4@:"@  ( $ , 4 "@9$ , $   " ? $ " ? "?" "`0   0    ( @#㿐 N?`$ 2`0H 2 < B?   < 8 " * %% 8% < ;*  8  <2`?% 8 % < % h h@ h```@ @B "  %`%@=` h ?` `z  =`=`  % "? $ 2 ?   <`?㿘 `"\?`$ "X?`("T?`, 2`0N? 0  2 4E?   $ * `( `0  `0`,€?01@9, @3 @9'a0 L%0@ a,@zА" ?%0@$`L P:А" ?%0@$`P l:А" ?%0@$`l $ * 4@9$`4& $ P .ж6 @ Ѕ(`@`(@ 6  +`"@ 8 `Є @ // 70 0$00$%  +"@*  .@( S(.K`2?7  .@1  @(`@((6 12`@ (`˒    ˒`}!ܖ? (?    ?%(` ?(` &/7 /(/@7 `/7 ((&1(70 ( 6 26  ?  .( 6 8 @(@( @" "&@+  (. @  ( 4` (%< ,`(('80//7 #   /1(7 (06 26  ? ވ + $% ˁ"    ˄`(㿘@@v @@q@4u 㿘@4㿘@BXYXYXXYXXYYXYXYYXY4Y4TUTUTUTTUTUTUTTUTTUTUTUTUTUTTUTUTUTUTUTUTUTUTUTUTUTUTUTTTTUTUTUTUTUTUTTUTUTTTTTUTTTx˒b@А  `J o`?#atJ g`?"|J m`?#!xJ? f`?"p? ''ܨ    '# $%37ˀ 0.*  @€ )  &  #   'ܒ ' ax c\@+ ?J`-c\J c\J ? $c\@@vޔؖɐc\&*  @@܀ ` ˒b@H9 2  p p 6ax@' @?А @"@ @ߠ`c @eb J`"'c @H  p @?,耢 c8@G  8a'耢 9@ @?А &@"@f  @ ""@`˒cP@e% J`"'˒cP@Gΐ 3 @E '˒cP@G ' at  @@ :  @@ .  @@  @, @@ @@`@w   @dߒ ? :* @€܀ ax@ ax *p0r  @ch @dpax cp  h @ @dӒ0Up Rax O`Mp   @L "L @L "L @ L@=x 4/ ax  @@D@  ؀ " ax p `  @?ɔ  0 @L  ؀` @p @ 2v :@`˒cx@dJ @&㿐N "?@\     ?@>􀢠 `?c@Fܐ  㿐N ?@N     ?@>y􀢠" ˒c@F 㿘!x !p`  #˖# %"@5c0!t ` ̖ 0@ %ː"@5c@ֹ 㿘@ 㿘@ b    "  (*  :`J "   2 㽐 %L0!􀢠'"$̐ @?  B 6+ B+ 3` @; 2* @ * < L`4@=@A   = b<9 $ @@ "(  @4$(@  @>   @4", - @ 2         @֎ 㿘 d4@=M  @  a8  4  4  (/  6+ @}@ 2$  `̒`@'E @" `@6 "@. . .  ,  ~B?< W$   4  Q   M I @ $   @ b !=< 9   3  /@/ *  ! # ""   <b$ `<  ̒`@& @`@ 6  ,`  H@"". `*41 2. 2 `)   `` ```  `J@/`  &J@J@`?㿘@㻈 %!'̒@ @t@ д$@%Ԗ` H@ ̐ @a@_@!װ <    ̐ @a̐ @ܒa @^!㿘 @8.`T >`  @ L̐a@ 0F    <  2   #H@!@  ,`T : ̔"@@y!(`  J#e`` 6 `@i @!@` @`!X` 2  @!!h  "@t4 㾈 %! ('@3T , /`  `    " 67 4   $ 쀢`4 #p , ,  ,  ,@2 a @!p㿘 (   ,@'    `$#p , ,  X %!  ???????'@u<  `?`"  @!x@]`  J#e`       2 @ !  @!` G @= ! !`D#H  ''/'@ -$@ː!  2 @ ɐ! ! #L @  $#H@Ґ     @}! @   $@q  U!@< @@ 3@"@ "0  #L @  $("@ #H@  "@@e#-c` /','`*`:``2@ J ̐"p@L P@8@j  ̐"@; @"< .  `?22 !@8" "@I@  @4 `* "Ȓ`2 @ ̒@"`.`  2    @ِ а  @"`  ? ??ȒbD?/'Đ'''???@H'@P %!' E HA`?@=  ????ؖH ???/'''''@!`  B*2 @2 2* @ * @>`@Ò  $@#f@@  @ a @ #㽐 %`L !' @  P ` 4Ӱ -` (@  ˦  @"ǰ @"l 8 `+`$$ 0  ; B> `  0 h: @& h` P*@  :`  L @LL  `0L  e<eD `L @@> ` 2r.``"@0L@/0` c.``@0"``0 % P@0v  "`0`   ,`` .`L `P*@ :`  L LL  `0L  e<eD `L  @ ` 2.` `cP@0? ̐#@Ւ `"@#( @ΐ#8  @,` .` L$$  0  :`@ c > 0 h:` " & h@"h8 ! @ #@㿘 @] `"  #h#&` &@@`L`4@ ( 3@/ ``4@ # cP@/Ք b`4 @  . @S4   3   @2+ ` @? @ː  @@`" "  *`J@   .  ,2  @  2@ @  @4 㿘@ @2 @㿘 H` @;@  ?$, @ 0?,@;.  #,㿘!  ?"@$  %!@' 2&@&`$ <>` ('7L e( :`֖ ` Ѐ`h h ɰ @` ̖b> @#@"` h @/L`0p?  ;`; @ ^@ @ [  5/̢2  t<@ :@L@ B 8T @V @ &`  8&`@`(N`0 23``&0`` @!-$@[@j㰠 2"`@` 0@7<: > @#@B"`` &``@  N`@ L  8 &`  05̑*` * p:  @ :`c /@  &`@6 "L'N`0 2L` @ Ӓ$@@㰨 LL  `t @;  d Ъ` ! @l#㷈 %!M`0'  `@ 2` %!$`@`  ! L  0@` 0` : t@J<`?  L `t @>; 8 L2  L `t@` ̖b: @lc@"`r F@B@Q `'"@** L `t6%* @@1̮  #`$@Ϛ@ В " $- *`@:59 `%`@` "M`0 2$` @̐c@)@8#`f *  ?% %! @Ϛ 㿘 m@j L `@8@6M``@6H, ` 5@6?@69, `@H#`B@6-``@6(, `͔ @  @6 @6,  `͔   (@6 @#` @6 @5,  `͒ @~ H ` `@x  㿘  H ͐ @[! )  L L `x 3# L @8@5 @8 * @5   @@8 x ` `*  ?"@-0$``x@8@5%a L x@` * 㿘 ̔ ` "  H )͐ @ ܀ E! L %`@8]$Ԓ@5s` `@8U ܔ* @5i`@ ܔ@8Fx`* dԧ, @v     А % c\! @ "!a "a㿘 d8e<`H ` 4"!"`#"Ԭ "ؒ# ̐@7P$`Ш+@7%`!* "Ā $  %`$ "! Ȁ  @) `Ѐ $ @z ̀ e  ̀`㿘! Ȁ "$ @)$ ȁ㿘d 0 ;  @ C@T8 ` 8 `,` $ (@( 2@D !@$cT* `$"$ $ $ $ $  ,`$  ($  $ $ @+̐ $ 3``耢@ 1`d#`@(,` 2&`@! &#`#`* "  $㿘!@cT*      2 ͐!@@㿘cT   `*`   @(c`?@(T@(c`$c`$T * 㿘g <  2!`!h͐!X@@O 3` @!p ` @!x<?"<cx @+?`  *㿘 (  2   ,@++ 㿘 ( "  ,@  2   H 8 &   㿐͐!@r 8 H 4@e!@Sh p "@\! p@W!@S!` "  @:@H!  @C! @'͔`!@9`㿘͐!@U@-!`J@ "     4  0   *@*@ J@"㿐     J@   H  J`" H HJ@ 2H L `@6=`@3R``@3M. ` ` @ `@"U@   LԀ " L͐"@ L @2 @"U@"\  L @  *@ , < @ ?@ $ (@ 0C@  0?ࠒ *  $ *@ ` * @  $ (  #*4@$ d L$ $ $ `4 :< `4 <: $ h`# < `#p6` `*`  -???Ȗ???? /''А cx@)АY  *<?"<<\ltȝ㿐@+ * '%;9)75 /#!J-̀ +B"* @€` >%`͒", b@o "@Ր0, cc(@a ''#h# #%#!,Ȓ@ m@T p&L@#H@` `D, 8  ,`D 8,`D , 8  @#@i9耢?? $#\*@  & @%  >@ ` ? @ ?@    ?@@ `  @F ?`䀢  '@ʣ㿐@"J ͐#Ȓ@O㿘 @ ̒c "   @ Œc耢 2  @ c "   @ c 2     x %!` ' ?`@  @ c    @I @9?v     p@0 m    " *X+`L Β`@ 0@ "@ H@ `@pcl    J#e`"@ @ِ @  @ѐ @a  @ɐ @ 6  @!@   @!@@ q`L`!`'`Ķ`8@1$ <@ؐ!`. `* (@3J* `. ("2`*@ *:@3= @( Β!@``H <"@" `$<@x!' /39P;`L #,@0ߒ"  @4@ &@3 8@0&`"@" `&@J!l @D!l  %# @<b 2 @6P @0"P  %# @(bH 2 @"$P%l!%` `L @  , ch &`LL  #  `,6%@0w```@0r. ``d , @ `,&` 2.X@NX@$ `@$' `@$'`` 9"`  @ϐ"P` NX @Đ"x@ "!ΐ"@BrH  H`@@ ͐#"'''@=f؀     @"@-  %  %! @D"㿘 d!,@0!ΐ@ߔ   ` L`, -:1  ``@/``@/, `  @/֐`  @/В,  @@ @ ``:`*$@ +@`@* ``,&`L 4?@1ߐ @@  ``:`*$@ +@`@*   '??⨔ /'?????"O"<L%`, < &  %    @ `L %@` @   `,& l& 㿐 %!'@<@1c`(@͔ 0 cА`X@Ŕ  @ ` ` ΐ#(@ ޒ@#H  @cx@&D   * L0` ;  B`B #`` `#`s9`#P@` m`  <L@#` 2LL` 4  ;`a<`4@L`0`? ;`@  E@O;  `#`<9ΐ#p @N5π((n9 `=L`` 7 86L2`h`;1L`h ,#L` ?d#`(`c\* @p "@ ##` ` , `#` @ ` @%`($$`hL e(`:` `` `9`h `B*2@  9    d`t@.Q?   4`(Α, `  "@Đ#Ϡ  , 􀤠   d`t@0_   `XΑ, `  "@#Ϡ  , @ < `"<`. 3T``@"  2@ #@  2@- ϐ (@ j`0#P""#P" `` @   *@ *@#p5 * `"`?"ސ<c``$`p$`t4`g4`"!"a&`L` 4`$@-:` &`$`h 1ϐ 8@ _ @' h0@Z x "`$>" hϐ @ ;  *@F#H  *@cx@$ $ @Ʃ 㿘     ' `a  "a @   `@ؐ  @    @ ϐ (@ `0 `$)'+-/57π Ӓ   r    :`K *$:@ `2     %  * @ +  Ycጒ ` $ @  `@` K @5 (@ t0@   2@  @` 9 @# (@ b0 `" "#l"@""@l@ `  @@ `2@@2 $`2  $  & $` 㿘 d!,@,!ϐ@ņP   `  (? ? 'ĄL/?????l(`, !  "a" +  `@6+)L %a   'J@  3 ` @  `,&& 㿘  3 3  2 a- )+Ϥ    ah $ " $   2  @ Ң`x0<<hh㿘!a@   㿘!aȒ@Ԑ  @# % ' ?* : `l*`)  €@ !@"   @ ϐ"@ Ab ݔ!퀢 X @ 8" @ f"@@t"X    Ȕ!퀢 C @ #" @c"h 2; @ڐ ϐ"@ b@ E"x@S"X ǐ   !퀢 " @ " @B"  @ ϐ"@ b  o@ 2   J@ "  #!*`c`, @s3   c` **)# ?c:8?  "/' ?????؀r$a+Ϩ0531  `a%`a "$ @" ? 7    : 6 3 $@ J#e`  bؒc@ "# #c@ "#` @#8 `! >`$ @#H       :   @"]70  $  ?8 @!X ' '*#`) x&ࠀK%ᠬ+)#1/  :%  "7  2?0   #P?$ @eb %#` v  `*` ?2  -h@Sb #` `*  3  `* ?3    =$ *`&#`* @  `"   " ِ $  $ " *l  %! @Í#x  %  ( `'" $  H #p  @ , $ 2 $ (!ϒ#@1 2#    ϐ c $@ߐ" "  `"e $  ` c T, 홒c  `' // /#@۔!  ?  ϒc`@ ϐ#@2 $ 6, @ ( $ "7@ ϒ7@  $`& $  * ?2 @!94@x" "  $ 4!  ' // /+ϐc`@! $  ?   ` `@@v"@74 $ & $  * ?2 @ 4 c`@u 2 U$  Q `H ,@" "F E ϒc@U   PА `@?  ֔P@ ?$ $ ɔP7@ L@" "  $ & $` *` ?2  "  `( $L .2%!`2L  씒`$@" "Ҩ Ӱ  .2 섒`$@" "¨ ð & $`H  В   @ * : ` ) *` € $  [@! $ `J `2 ! ` J#e`}Д!  >@c!`s`< @ @  *   *`2  ) $ , ؖ @$ @$А!8H@' `@!p5 @ !`0` $  $ `!#p J @   ޔ#p" @ , "  *` ?2 *А!@:``2$   @Z!@$$"@㿘!`@   㿘 `*` , #  V"- % H? ) J `@` J@ :?  J@ 2 a@  D` `   J `@$  X  `*$ $  ?3 & $  $ "    *鹐`& lx㿘!`@vX   `   -- ?!?   /'#`@????V? "a' * : `?-!ؓ*` €` ,`R `75`#P`02#P`"  @z##PВbp bpQ  @ 2bxВbܔ `*А":`@@$ࠁ㿘  `B '+   4   `:  J* $:@`$ l  2l & @!$l `  : * $  * *+ `%``Ġxlllx㿘!a@耢   ?b % L``'?#`ࠒ @'?ch#("຀5`X $ !  @M#  2 %$@ K# "X%$ ,`"`@X $   #8  Ь#@ $ %$P@&e*  ณ, @,: ଢ@@&W|@( , $:`0@@&G*`@(x, , :`@!  @!А#H@H%$  @ #` ?  А#x@ےP@&*  ณ,@: ଢ@ @&|@(? , $:`@*@%`@(0, , :`@@L % L* "@L? ". ?#4? T#0#"`"@"U%c?P#(?# :`?" ,?%Pa#$"![#%`Tഡ,  %`XP@%഑* %`\ฐ`,`: %``?ଐ#$$@"@%@'| , :`@%`d?$ "@ " %`h$ * @%`l@%|`@'* , `l:` %`d@`\"U`d?`T%`#,?"@ c0?#" @#4#@ "L@ܐ#?#8  @Ԑ?   "  , 0$? 8?#  ? #?$8 @  6,   :`*% +@ * ,."!a,  #`@ Y"!@%"@% /@  ࠒ @ ɐ @"U@ " #Ԁ А#@༒@$$@4 %` %`,?@2@5`5`&%`$ $%`8@'  %`p%`%`$%`%`  (`@6%`(%`( ,`@6%`,%`,U` 0@6%`0%`0`@"U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@?#0 ?#,@"@ L2@"U%cฒ@$?c?`@c #@`@/`@"@ @* : `).!*` €` %`` ? %`  `@"U@:@`\@   ? % *@  *( ณ*А#ؓ:`@Дศ Ĭ`%@"U    ` :`b@`\@   ? %*@*`  ? %` @Ȩ @"U8 3 @"U @ :`J *`" : 28 `:`c@``@   ? "+@@* 8ז@8d ``%`@#|@&`@-T@`T@ `"|@#В@@%@#@#Đ@@@#@ܐP@#@%* `-  @`X@ @#*  4$`$>88@%А &``l:`@8@%ǐ &` ?"@  *@ &,$`$ %`$ `:`c@``@  8 " %  : :@ `4@  8@@>$ 4 `l `p@`h @@  @  $4*   #  (  `p 瀋@ %?$4*  # %?`$  ' ` @ ' `   @ ' ` 'P@@ 8А@ c  `$@` L$ `  $ `$$ *`@ @! ?4@j ?`@"U@`T`T@ @"U@ T T?#0 @Q +?c8 ѐ p@ ޒ` "?c4@@@ِ @"U@ T T`@"U@`T`T@?0 @  *`J#e` ?c$@@ F?@"U`"@`\@ " \ $ @"U  "3ѣ- ."   \ : 2  @"_@`8   ?#$&`?c @@ 6F`@"U# `` @#@``@ $ @"U  "3ѣ- ."   \ : 2  @"@ʐ``   ?  €`@"U@b`\@@"U" \?, @ u $?c8 ѐ 8@ ` @ "U@" \`@"U@b`\@?#, @` *`?c@,@@&L ?"?(%P!?##@ 5  #8А@ Ēc  #= `L=--Ґ *` %! @ʐ       㿘 %'H'L'P'T'X"ؒ@ H@6 㿘   #` #@ @E  #` @    @ @ 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘@@cѐ!(㿘 'H'L'P'T'XH@ (@% / @! <   L` r`@ `@>㿘@ / 1$!@, /,ђa0$@'!! @#$! H "#!Ѥ!8@  !8@a!@0M@ؒ   ѐ!X@R>'< @@#0@# %#@  vђ@5!X!  ђ@+!h@ `wâ @ѐ `2 㿘 ђa@Fb @ ђa@FZ 㿘`ђa@FP @Ő  @ђa@FC 㿘@ݲ ђa@F8 㹰 %!J`?*#d" '@M   @~@lђ@Đ#` <   ѐ#xޒ@# "  @   "c\@~t@Jђ@# `  ѐ#@J D` @    &`?`&`#@# #@z##!"`" `? L$`$ , $ ,`$`@$ @  $``c\M#@Ȑ "" ("`"@U  H` A  2> c\@ 6@n  1 @D@@,@  ,$@* "`@҄#\ 8`Px @ ` Ґ! 6 #`L J@!HL  `р !Ғ!!X? 2L!L  $1 ,5"` @M  0*@ *` t  :` :"H  @<` @ E L  `ڐ!@!`2L " , L  <`cȐ!@֐!L  "`<, L` `$ @" ` "`@"@ 2 @! 2L* ,`L   @ ґ*@"P  "@`"@   @! 2L * , L `0`H Ғ x"x `0 "`H@="@   @l" 2L * , L `4`L Ғ U" `4 "`L@"@   @I" 2L * , L , $H0204"L04*" `:%0@"@   @ " 2L * , L %(`< # < `"(@Ґ"@   @" 2L * , L  H8%8: @ %< "!L%<#0  H8  :;%8@"@   @֐" 2L * , L  L8%@: @ %D "! %D#X  L8  :;%@@|"@   @"   * ,   & 8  ::8 L8  ::@& h 2L e,.h 2 @# H z# L` "  ",` <:%0` "(`H8  ; 88` L8: ;%@*`+`h ]L eLY 2 @R#  F#@L  "@ "L  "P #\"eT %`"X P@v*  , @,: @@i @ | , %$:`@ *@Z  ` |@*@ , :`@L L%@  $ * (L`  ` LL `@V`h`@L  @ j  "cP cP 2``@ 0 4 3/57 ``0"4cP`8@  ``dc\@ޕ* 2 `P@㘀  @0 hoX  0  ժ` ` &`:   ? @  "`Ӑ p@`0X H @   "` H   H @   "cp HӐ @F`0> H @    "` HӒ` @7*`0/L  #"`" @ $a!$#`a@ ْ #``"#TaӐ!@*`0@ Ӏ` *ce*#e @   %! @!8㿘-   :` @  Lc\ @6 2 ! % % \F!T@Ӑxa@, 4ӐpaX`Ӑiap@: ఀ  `,`@1?` &`hӐVa!ӐOa @`d`4 @M-@ $ @I`B% ,%@   ,  @*@  @ h@@  2-  @  $#`+@~u!  h ?'  $ @~d:`  b@  *#d 㿘  `" 9@~G"@Ӑ"Hh㿘 @?" J ? (J? &`   ` ӒE"` @L? &`   ` "L`* :@ `` #*` є"hӒ"e %h@  &4 &8 &&$`0&`,&`8&@@`(&|``4@78? @2 @I8?&`&?<``* &@"* &|?@c8?@^@(&@"@T&$@P?@L&,`&d <`` &d`( " 㿘e!`e@K! 6!  @yK@!"Ӑ"j` 2v `  2q ` 2l ` 2g ` 2b ` 2] `, ,2X `0 02S `4 42N `8 82I `H H2D `L L2? `P P2: `T T25 `` `20 `d d2+ `h h2& `t t2! `x x2 ` 2 ` 2 ` 2  ` 2 e\%\  㿘< @@"%  (@" 4 0@" 0 @#@  #`" @|ϐ#8 㿘 `#PӒcp@7Ӭ`?@|# J D` ` Ӓ@|#U*cXJ 8`2 Ӏ   %J D` %Ӓ@|#D "+) %@|c@`$@  $ "((  ` "(     %(`? "`@c 2 y Y n NΒ@|X y€ Y*#X 㿘 L`0"`@ " 2`3# ?" " " * `l$ "`l 0@($  /Ӧ ?㸢`$ $ $" $ $l, $ @6 l@  @ `0  l` l" 㿘 l l % d`d.  " 2 `l` `l  2 `lԐ#@`l  $" "$ `l$`l"`$`l  $ 㿘 d`d .@ `@`"\ @& & & 㿘N` A`  @M` 2  `#``.`` @]&` L@# `  '`#P@@ 8   0"@ d * @>` 0  㿘 `2@{_#Ԑ 0#p F H㿘   @zc\0 `LJ#d`')`L  :`:  @Z@ " `2[ `   : @E $ ,k!g   @ 7 l +`)5@"lS`@ `@  l @"% Ԓ"@ސ  %``L  `р `     " `L` * *` !!#*` *  a@g* ! @za@\@㿘  >:`@b @@ 6Ԑ 0 Ԓ@W # @' 6Ԑ  @l@zv! : )9/#@# * <` D @ :C  @ # `@ɐ#@@@zG!0 @@z@@ #@@Ͳ@@z7#㿘 _  >:`@ @Ė 6Ԑ  Ԓ@> <"`!H@ 6Ԑ @y!P $'+ऐ@>kऀ @ < D @ :C  @  @@yܐa@ @@yԐ#㿘    L`8 4 ` "   ``8   L!-@   : * J& : 2` 6` @ : * H" : @6`e`@0@``@, ` ` U " `Ԁ Ԑ!`@ .#U% ` `:*"@ +@ * `; c` ` ` ? #@+*@*`` 8@ $`?$$"$$` `8"o ` 8 "@ &^` `?m`  `Ԑa`     `` Ԑa@K0L  ?? $`/'?????# .#'̠!̐ ''Ȑ 'd' "@ ڐ&@@ ` / @ .@Ȁ! DԒa'''F !$` ?.@|@ =" 㿘 `N @ϐ 㻐# %a'Ԕ$@@ @=  "` @ a @+!㿘@  @  @ 㿘 '   !#N 0 c " ` @xP" & "   & &3" p %!'@t  '€$ !Ԑ"@@    '@ , 'Ԑ ԒbP'''@ #'Ӓc '' @r@?@s" @"X㿘 8 /  +-.`Ԕ̀  '; ) @@2  8&/@/ 8 /`/  8܀ 㿘 8>0#  @ `?>@ *  @ *  *@  `?>@ *` @ `?ސ"h㿘 8 >  0 .@>@ *` @ *` * * .@ >@+ * .@"x㿘 8 >  0 Ԑ .@>@ * @ * * @ .@ >@+  .@"㿘 8 ">  0 @`?>@*` @*` *   `?>@>   \"㿘@X@)N  @楐  %Ր"@ `@/ @s} "  %Ր"@ a@# ! @c @ 6@ѐ! @"0!@ @Ȑ!H s B   "ax  "at!h@Ք`@KY逤f $#\"A@!A" @P   A#\#`#d"    @C E  #  @; F" @6      #\#l;p#x #`'#d#h#|    @B  @    ?''' @  @ @ @ @  @!x@ 㿀  ?''L'P'T'X'H'`L?`' '' @ɔ  ?`?㿐'L'P'T'X'H L?`(@q " **@& ?㿘 'H'L'P'T'X@щH@љ@ - 㿘'H'L'P'T'X @yH@щxՒa 'H'L'P'T'X@  @юH㿘 !| `"!|@㿘@%ܐ!@  @0㿈   ?'  @  ? @q?@j!Ё㿐'DD  ?   D@  ? @qv@LD!㿘㿘  @Ɛ Ւb0@% 㿘@b@  @ ?Ր"8_@Ӑ @?Ր"PU@ɐ 㷀) %!'%Ւ$@'Ւ∔$@  @ 'Ɛ"' @  '' b@q"@tf#Րb;''@t\b2@ K @ % )#? @u   ?BB$x ( ?@u ?@? @p %#@〢  #x@r ?x !x 2!   ڐ#@  @< #B   B"!t@! @#p@f 4?  ?ؐ ''' @A  @= ," !t1֐  '耢'  '' @ !Ւ@sŐ"֐ "{ @ ?֐ @b? @t  ?@  \1B@t{ ?@c?@pC ֐ `b]B1B׀ ֐ bN@q ?Ԑ?Ԑ     !xF!؀@?'@(0͐ : 21B "t!a@Ô01D" 㿘1!$ "  @ "  @o@!    @ &!$  @oӰ @!0㿈 D!$ '''' 'D  @oD@ !P㿐 !$ ''   @o@s Ȑ!`㿀D!$ '' 'D  @L 㿘@ 2  @'* #֐@ǒap $   ap@ . $  㿘@=   " @7@5   @/@- @+㿘 ) /  +@ , @] , & &ax@z ?֒a@6 @    & ("!& $& $$ (㿘  @@ `a@@O ?֒a@6 }   $  ! @ϰ %$ ` !   @@` $ ! [  $  ! @ $  㿘%    " (U ([ 2 $  1B `d 2@ @1E#x㿐@f?  Ő!0' @ @ 6 "( @q@ @"H @ 㿈@N ` `? @L??@0? `"xs? o@@  @?0b@O 1`  Z$`  W$` "1`@` @ה!?@n0 @n* @n$  ֒b@6ʔ @@ ֒b@6” @{@y@[ ` $ 4 ``'"@N ` `@F ' @m `@qJ@`@"`@s 㿘#a 4M /t   @࣐ ( $  $` ("`($a (` $"`$c0H?2$ F D "ax@ݍ $  G   F  "F  Dx$F  x x㿘! $!x  !@\ &  ( "1   2 (?2& F D$!x 1  @q ?"!x!x ? !x㿘' D  ?&  ( 2 0;  ( 2 @` 2 (  &  #V& "     ?&   B!   @n& 0Β@U @! "1E `2 (`&  @nĒ  ( 2 1E#x E  (2 E#x  㿀!       @n$  ( 2 @E #Ր!0@ⓒcH1֐ @ ?"> @?8 )  ? ''' @ f  @ b Q" @ !֘ ` cH@oZ"֐#X" cH@ @p 䀊   :  2  ֐#<,  @nF??#@l| %$a @0 ? @p ?"a a @lf ?@l`    $y#x@ W1B 㿘@E` !` `  "` `(`2` Ր!cH@0 ֐#.  @m??!@l- "%1B$! @ ? @pO ?"! 8! @l ?@l   $+#x1B 㿘@ (   @*`2 㿐@ ' @3n @ `@㿐 ! ~@oݒ# "L@ " n L` o `@< = ", `"@ì 2  . @ @ @`##֒c@ː  2 &*@ &" c@  "&&@ @& # 2&@@k\`"2 &@ג`@ &@  (` (` (` (` (` (` (` (` (` (` (` (` (` (` (` # # (H (` (` # # (` (` (` (` (` (` (` (` (` (` (` (` # $ $8 $p $ $ $ %, %\ (` % % % &( &X & '( '8 'h ' ' (` (` ( (` ' %! `'@ڭ ? ??c @"@  ""#"@ א @b̀  ר ?d? `#?  `?"#?"Xl?#c? 0@|?"@c?"X@#x?#@h?"^#p?"t#!;9 %7 5/ @Cd?G? ;?H* @€ 8"ؐ 4#"@w Ȁ /'b @a0*` % @h   "cp @{H`@\ Ȁ '#` @pp`@Q  #" @daĐ $@C    t @V`@7  " @J!逤`@+ Ȁ &\ @?aހ`@     | @3Ҁ`@   " @'"(ƀ`@  #b @H`@   "cX @h`@  " @"`@   #cd c` @`@   "cx @`̀     Ȓ"c{` @t؀ א   "clm"h @h   ##hb#cl@_`@   X"cP @(S`  N"@  H#" @cHC`@ Ȁ =& @h8`@z  1"b @,` ג@$ 2# "`@d Ȁ % @x#`@Y   #cT @l `? Ȑ#"@~` $#\`*`@ & ̐& ?@l?㈖@    ?#( @ ? b̀ 3@@Ȓ +ג@͐ &ז$@%ؖ$%@@@lbؔ$@@lXؒ` @0 b̀ 2ؒ`0@某 -? @!" '/ @??' $ .##l77''7?c?@"@''''7@qs / !ؖ @ؔ8$@Ec?@a? ؐؔH$@2`@b؀ ??T"@5 ?#  #@h@bؐ`P@?#@ z   @h{@Qؐ X@ؐ@@4    & rؐ`@ @$  ,  @ `@ 2 ؐpT@Y!'"̀ c  @a @A  @ΐ?c@  "@@h%@ؐP@-??#c@@@ 6 8@h@ؐP@8<   b̀ 2 @ ؐ @l-@@z ?"J?``?d@ ? & `@ `  ?@@ ?c@@@M  & `@ `  `M* :@ 2 ` @ @M ` @! @M܀ @&@  b̀  M!P@@쀢  H "."Ѐ  0 "@@!  b, %@@!b   ( 'b@@v! #X?L##XbԀ  \J #bԐ #b\  #`` &\((*(&\#`   ` @`  '#`\*  4 '#` p  #`@ @? &  "cp  \* "d   #h  cl?  %ؒa@X %ؒb@R   "h #P? @##PcP T@"#B T@ T8"  #" %ؐؒb@X@("b 2@#`2 "b@'`'`'` b'!!"Ȓ@ ""'b@ %@ ##b@  @ &@@ A#$@" `&a:` "'b@L%c@G"@A#"@<&@@8$@b@ gܒ`$    @ 4 "b"@j"̀  !?#`@ 6#`b@- X#?# ?#  #?c@"@?㔖?c#\@?@?㤖?@["Ȁa b@ "@@ $@`&a@@ :` $@b؀ ?|@G  ?㠖@"؀ ??c@@ k@?@ f"̀`?` @ tb'\@b #?'`' '@ ? ?ג`@-a @f?b@Y$0ic@"@$@Q?c'%)@ե ?x`@ ?`@-: X?h#@S %?cp@`@@a Z ?t@? 2?㜖?#`@a@ @i ?@-  ؑ:  @Ր @A`#@ c @ @\@Ɛ @Đ @ @h#8? c  '?c@@` ?#cא ?㌘#``@* @e6@@ 㿘 e`e@ ( 6!(3c  `@^" c@' 0 @j1#H #@!(㿘#`6 6 e`g@ @j#Xؐ#h@㿘'H'L'P'T'XH @]    ` @ď @Ă @Ē@,@A 㿘b̀     ! %ْb@"   ! %ْb@ "آْc @b cРcЀ %̀ "    2 b@8  @  㿐@ j` 0%ْc@@,   @ ْcH@, @gސ "<?ْcP@,   P@^ @,( &'@4  @0 `2!ؐ@h ?ؒc@+ `:  'ِ#X@,@ @  (@ ْch@+Ɛ <   <ْcx@i <  `?㾨 %!'ِ#ٖ㘒c' '''''ʐ   @ᔔ Z;٠ Z@  ? ??(?0?8?@?H?P?X?`?h?p?xא#''  @ז ` @ ِ#@h@: ِ#@hْcؔ @+Xْc( @# ِ#@hؒ` @ݐ ِ#@h͒ @  ِ#@h’ْc @ ݔ c @ "cא @ 6ڒ@h @ ِ#@h@  @] 0 %a 8ڦ '@3 @ L Hڠ HH@K Hؒb@*  "@> ؒb@*א c8@ ڒ`P@ ~ @˔ / ڒ`h@ s @࿔ ڒ`@ h J?`/ؒc8@ڒ`@ ڒ`@ U @ 2 ڒ`@*  @ ȁ% %'@bc#,pcؒ @~@.@+ @b" @  %!'D''H'T'X@  '"c@@  "c@@   "c@@  "cڒa@*> @ҋb̀ , :`: @앐   @b "ڒa@*# #\   @?""ڒa@*  @ ""c"#c?"e,"e(c  <"%("%,"܀a@  @ cКcc""`"`ڒa0@    ڔaH@   | "d"dڒa`@ }   ڔa@ u #` \"`4"`0ڒa@ i ڒa @ `  ږb@ V @ڒbH @ O ږbx@ G 6@ڒb@ A `0#`P`4? 8; 88 #`H#`L;e8 ;e@#`P> "`Pc 4 " T > "`Tc0"`T:  "8  > "``c 8 $  0 0  4b; @   #x22 4$%P$ t@$ xc$ |`|"`d > "`d  cc4?@{8?@v@@&@n?@j@4|&@^& ?@Z@$?& &?>* "`c@c* "c  0 *` * ?: ;%0 `t:`@B<  e0@B:  "cX"cXc@``x7 ?@@͒`0*` @?@@cX @x?@ @xc x `@:   |@  @8  @Ґ @͒@ p$ `$  4 $%$c'| %P@*   ,`@,:  @xc@ | , %$:` 0 *@h  ` |@*@ , :`@? VcR? "bЀ 22 : :`"9"=? @jc?0# @'|*`"0>X-* "X@\@&c"`c8`*` "``"8c 4 02 8ڒc(@  * `: |* # |# 8# `# 4c %P@*   ,`@,: @ @c@% | , :`%$ 0 *@  ` |@*@ , :`@c@Ӑ= @ @ > 8@sb cx3ښ?  ;`@ ; B @e@$'x'x`8 "x@c"`0= @Α* c?`x@Ȑc@x@ږ cp#P@dc ` 0 8::$ `$ 0$ 8@@xc$ P@q,`c*  @`,`: @@dc@ | , %$:` 0@ *@T  ` |@*@ , :`@ @c`0* 0"`0@~=@ > 8@ߐb x?  ;`@ ; B @Ԗ@g$ 㨒 `0@M,`x?@H@c x 9c 0@;* c?`x@5c@x@c"`0 @'* c?`x@!c@x@ @cl#||` |@ca#ڐ#@c]| c@cU#ڐ#@cQx !|#  0c` ې @c>`8#  4c\ ې X@c3`@f c @~" %c c cĀ " В ې @cc ?@@Ā $ #"cഔ @轑; > @ 8@b x?  ;`@ ; B @@襖$## ; @$@ 8@b x?  ;`@ ; B @@脔$ถ 'xc 0@i* x?@d@.฀@4ഠ %P@%*   ,`@,: ନ@c@I | , %$:` 0 *@  ` |@8*@ , :`@"Ѐ 22 : :`#" #%c@Qcഖ# ; @&ച@ b @~<x?  ;`@ ; B @s@&ฐ '| %P@*   , @,: @ @c@ | , %$:` 0¢@ *@  ` |@˓*@ , :`@8c  @ |@$ @ `@}, ے`@  ےa @ bĀ 2.| |x ےaX@  x@aސ!xc| "@aՐ!c@aѐ!c@a̐!Ā`c@ cP@7*  , @,: @@*c@[ | , %$:`@ *@  ` |@K*@ , :`@cL@  $d|<$$@@2@$ఠ@$ఘ 'cےa@x "Ԛ  D#XehL @ #@ L h hc` "cXePcX@ǒ`* @Ð`|``@*   hc#\%`$eX$eTc%``"%X"%T!cL8@@ B ;  @ 2|@ |`* * $Dc"#\  ےbH"0x@a "c"cX X  h *# %P  - #\?#L?, TP@]* 2c%P ccXܠc@I8 ~cc|@A@r@:@|Y@i@3@/@|N@|L@)@|GP@#@U`,L?> - #\ T@* T?ceL?2eX`@@*,eL?2eX`@@@cL?,- #\ TP@ *  ",@cL?2T- #\P@Ԡ * 4c`8cc@@{$, $,c x ` @:  @ $  ,8 ? 4  @c@. ༠ @$&( ,@@.  @@8$8@ے@`c#@_P@/ ?@m $ "@ a  @d  @_, c@X $M2c8* @|@J ۔ch@א @B'@<,  @68$@f@bې@_c@%|ے@_c ,$ , @{;  c"@$ `@`c@D|c$`$`d`$*  㐀 c b̀ 2 ,c`d`|@:@?$`ܒ"@@_r (c ,# p%D*  0  L2  # #  # l  > "`pc @  ##ܒ``@"  #t #dF #pT" <c$%\$ @$ <$ X@$ \ ch, $ Dc$ $"$ $ $ $ * c *`c@"c`/"|@$c`#\`` H@_pc4!P$ #`' '"H$ H#\',?@^ 㐀 @^ 0b̀  @ܐ Pa@m H"c@ c , @ 9153 %"#@ 㐀 2+c@6@0- ``d ,  d@ ! c8 c@^!( @^0@'bc `, # 2@^!("؀`̀ @ TX@e\ ܒa8@  c$ @$%\ @cF`!T "e\c`T`>``0"`d * 㴒 @uc 0  cc `,@```@- ` `d #,@U `,&@ @GcD *` c %4"` ;D* c 2 @!H㿘# @{ $4@r.@j@༴ @d@`@@ &%@4?@ @#!.@ࠒ #@Į@#"U$ $ $ ,?2@yZ4 4 &4 $ $`@^8$ p $T`,  $XeP@`* $\``,`: $`e$``@`@?| , `:` '$d@`@2 | , `:`㤐 ?$h`h` $`h%$ * @$`l @ `|@*@ , :`$`ddࠀ@$ܒaX@e %  '" @"U  㤕: ` "`\@@  ? $+@*㤤 ?"  ') 0'  @,  "l0 2  #@```@. ` `d`0,@0# 8 # x ` @: Ԁ @"U@`8㤠`"``cؒ@@%$`㤀   l;  +  $  * * 㤐``$`@F |@x * `"`T`T@@ `" |@2 @xP @`@* @&@xE@xC@  @x>@%P@M 㤥* " X@@A* 㤐  @@@5 @%P* @@@ 4@`8`("`(㤐 (" 8 @x$ ( 1$@*`4  "  8@ %@'@"U ``㤕: ` "``@@ `` ? %@+@*㤪`$@ "$`8@"U@`8㤠`"``cؒ@@Ԕ%$`㤀   l;  +  $  * * 㤐``$`@} |@ * `"`T`T@@ `" |@i @w @@a @]@w|@wz@W @wu@R%P@ 㤥* " X@G@x* 㤐  @@;@l @6%P* @@@ 4@#`86/㤒'*`4 @ U"    #: ` "``@@   ? %(@*# $  "$%$`9  l  p  h  `!     %$4+    "  ( @ `㤤`p怊  %$4+   " ` $`$`̐ $``Đ $` `Ȕ$`'@'` '`$'` @```@. `  `d`0@@,㿘"c  $ $ $ @$ t4c  $ p!@/4c @[$ p$ t"c  `4   "   @)1: < #c `4@Ic $ (#  `Le@ @; B @ * 2`  $ hc`d+@`4@V 0 㿘 # "  `` `6` @O`?$ @ a, @*` `2` @="㿘# !d*#@#@`"U-!x` 2`&! !ܬ c`#c``@8@@ #c 8` &`ܐ!@Za 0#@``Uc@ >`@Ք#%$`c   l: * $  * +* c` #?#` 㴒# @ ? "` #` `#  "#@ |@ c* @"U@"TT "# |@ @u @@w @s@u@u@m @u@h%P@ c* @"U@" X@[@* c  @@O#@ @J%P* @@@?4@#`0E`4@p #`8 "@ " `8`̘#c@ #`$4 "$`8"@*`   `8 '#@"U , : `"``@@   ?" +@@*# 8 # d*@c?c@6'!& l d*@g##@ "U " ܒa@k )6` \? #  `  * @*c d#@r*c#"?",@@ ܒb@D  @@ @ * @  @@ @T@ x `?*  dc @,@  0@㨐@Tx*  @㨐0@-㿘"̀` "@u@@폐0 ; @ޯ>  c@ܒb@@8 "㿘"̀` "@Mb@g0"؀` ; @ނ>  c@ܒb`@  $㿘 8>># 8 2 8@  `?>@ *  @ *  *@ `?@ *` @ `? %ܐ"@퓒b 㿘 8 >   %  %.@>@ *` @ *` * *.@ >@+ * .@ 8"@db㿘 8 >   %  % .@>@ * @ * * @.@ >@+  .@ 8"@5b㿐`h @۔?   @좐"؀  @ " P㿘@1                                      X 㿘ܒb@  "cЪ )_'#!%/ $57 "* "@€ $Đ $c $#̐ $# $c %c @@,;耢??\* & @ c @@B@  @ք &@0@@ԝ㿘#`  #̀`#Ȁ @   @7U  @ ?` K_#*` € ``s`!ܠ"@ @˒f`!`@"@K 2 ``U`!ܠ"@א @H F``@^`@ ?@9D  9$` `   2 `:``@J`@ +`:  @` #Ѐ``@ @X\`  " `@R` `@Wѐ" "c@7Ɛ 2|`:@R`ܒc@/ ( Q 3/) -<+5ܐ@  3c  c#Ā`c@30%#Ԁ  #@ "' @ #Ѐ`@ "@W "c @RX`@Wo%#  x %!' ` ?ؐ@ n`<  "` p  `@ݐ#(g  @Ɣ "T@H?NP$*$@ɐ 2`8ܒc`@  @R :@ 5ܐ  @Ֆ @-`8 @< $@s ܐ  @տ @`8 @& @]  @=@糐 ܒ@V"@3 "c@禐  @#p㿘@ݔ 2    @Qﶦf4 8  x# %a '! %ܒc@ΐ"0,#Ȁ`Y< ( S@  "O @G@I @v O逢 "ܖ#! %#\c@ꢐ"@" % b(`? "`@Ҁ "(  &"( `  %"( ? $ @l"(  &"(` 2 `y `Ya a @#㿘 @ %#@YŒ ? (J /"*@Y / J .2 J  .2 J 2    @c $ `&   &  㿘   %c@"@9 㿘@P@@Yu / `"#`@"@b`   !ݔ `"#L  ݤ`@l ; !ݢ !+ $' !7 !5 !/ !  t  @@)V? fc\cL*@`&  @ `  `@ `? `@`@@ : $H@ :,@H@` cL@ cL @H '@鈲`%`@{ @ 2    "H @ @† 6 @P"`  !#H`ݐ @U1 @|  =H @`7 @ ' J` H@`@6  'H  W@  H0  a@ܔ 'H !#L`ݒ`Д@e `@`  @@Ha@ڽ ݒ`@M @ H @@! 㿘 !R#P#PT`"V@2 V  @Sڐ!XV  @,!x V @'! %`? "`‒ * "V@S!80@D   !  @S $ 4!  ( ,@S 0㿘  N  ݐ!@Sݐ!@Su`sN o % b`?"``" <* H$"@ <EN * @:`"` ,?"``"* $"@ ,* : %  %" :?`&  @  "* $" @̒* : 4 NN 4N`"`?"``" >* $"@ >㿘 !#L` # %"@'a0# %"@ a@@ 㿘@ @䂐! $#ܒ@Wd$#db@څ @#ذ86 㿘@h"@> 㿘ݒb@ 㿐 !#t`' !ݐ"8@7b@ %#tݒbH@ڐ @@ $xݒbh@ϐ cܤ @ @  ,@A 2 @ $x#tx @"x@C  ?"c@֐ ,'%?#<'$ #ؒ`@  #?c@ $'#ؒ  @ 㿘N # &ݑ*`: ` @ `  2  _ - @ْ   N  㾐# %a'ݖ!@ ! "cp@Ra @"㿘! !#p ݐ"@=b$#p㿘 !#p` ݒb@/"  c@{`,`7 #㾐 %!'  ?ݔВ!@Yݐ"@ a @"㿘@@a@@p %!'@E OЀ E F AА@;$ݐ"@AOЀ F? !"#p@Ő@J@ "*@ݐ"@*@hѰa @O#0㿐cؔ @m OO㿘`* :`` ,, ` ݐ#@@,ݒ@#h㿘@㿘ݒc@ @#E 8 a` %'- $) p @vȠ 2Ȓc@U @ !@@@%֔㈀?• m\* @@`2@@@ 5 @@U @?` @`J /"*` @@   @@  a( @@Rr?2@@Q# @ @/(ݤ#)+ݐ@N:@LL `?,@la @L``@  /@L`@Q#?<    /@c @9c? /`, 㿘   %c@徐"@ސ 㿘@ @  T  X  l l l l l l l l l l l l l l l l  l l l l l l `㿘!@"""@ @#"ܑ*` @ * $bԒ`*`@ !$"؁㿐 +` @0(  '-ޒ`(@  0(`J@   & J@?   `   'J   (J@  J #"ϐ` ̐` @ s &`* * $`Jސ H@g v @ `  @$` ' ) "J@   & J@?   `   'J   (J@J ,2M$` 'J   & J@?   `   'J   (J@@   @$`  #'J   & J?   ` `'J`  J$`$`) "J`ޒ`X@ %  @,`M , ,J@" L  L`"LJ@2 L 2  J`p@    J` @ `  ` g *` € 'J   & J@?   `   'J   (J@` 2  * * @$`' `J   & J@?   `   'J   (J@$@J`` `  $`ޒ`@ " 'J   & J@?   `   'J   (J@J`;`~` L``@e w`  'J   & J@?   `   'J   (J@J`\L`a@:  'J   & J@?   `   'J   (J@J`L`a(@ @# $` ' !%J   & J@?   `   'J   (J@J`!xޒa`@ !x@ ̀`$` ?$`& @خ!?$`@J@ޖa@Ɛ ؐ` ' J   & J@?   `   'J   (J@@F $`  'J   & J@?   `   'J   (J@J  8$` ޒa@2$` ' J   & J@?   `   'J   (J@@@$` ޒa@B @pJ@ ;O` `X'`'J`  \ޒa@+ @ $`@@` 'ޒb@ ?'@k`'@` 'J@   & J@?   `   'J   (J@J@ ;` ,`` @' 'J@   & J@?   `   'J   (J@J`;` 'Ր` ޒb @ ϐ` 㿘'D @. `:  h'D \ ޒbP@  DD] Dޒbx@ DJ Q . : !J [ @JD @D @";D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J& `(8]*@ 2J 2Jn*@J` ]*@J]2 "` 㷈 %! '%  @R &@@  &@@t " @@@ޔb@ @` *"a @ϐ"؁㿘 `  y ,@`$@ @n p&`"`&`&`@S N I/`:  \97ޑ*`:  \-"  N` -?@4"耢 "N,@N``   @e`&&` & \2,@ ` 2ޒc@O ,@` N $@%@h-`@  (@{( 2NޒcH@0 㷈 %!'D' ?&@&` &`&` #D`DJ@   & J@?   `  D 'DJ   (J@DJ g  p 9 ; 1  D|Dx w$Drހ  @ޒcx n&@ k&` @ԒcxDD@Ŕ #?@ ޒc@Ő &@'D !J   & J@?   `  D 'DJ   (J@DJ*'DJ  2 *ޒc@ @Đ"̀`&`& @]!? &` @F@ޖa@u  DJc@o D M'D @  %!'N  \ߒ` @Q  2?4``c? 2N*`  ? & *`: ?   `  ? N  (*`?#@ߗ@ߔߒ`@  @̐! +@  (+@?O#`  +@J &@ @ 㷈! %! '@ A O耢   & J?   ` " JJ  ?J `\2 J " J "  *J  " $@(,`@`@(  ,@f @ *㿐N 9 \ 06  $ /a ߰ ` 2&@ߒa@o &@ &@ &@@ &`a @^  㿘$ N< 9;8  & + : ?   `  N& #;2+  N ". & + : ?   `  N 2+ . ߒa@@ &`&@ǐ@Δ㿘. ?* : `#g 0*` €bܐ "b & @I &  aX@ߐ @  2 㿘    `,` `*` ,@ @' 2  @ 2  @p 2 @f $$ $ $ $㿘 ` ,`  `,` ` ,*` "   2  @h 2 $ 2  㿘 , *` `'   @b @{`2 `*` 㿘 +n)#!'%/ $57 %#9߀ /8 %* cp@€ %"̐  @$b Ȭ @    $ %ߐ"@}a@~ @?ڐ?\bȑ* ` @ @`@ `@  @@`@ 0@ @<@͒ @ݐ   @D@"H@ @~b 㿘% " K!  g0#"\#b\`2` ""!5"0`@bX  "b0@Cb\@ߖ b`@ b\  "$`!ߔh"8@~J  ߐ"Pbp@A b\"8  "b""4$"0@ b  "bN #2Q N  nM ""I b\"0@c"b\$b  "4J`# J  n "bД *b"4J  "4 @"\$`s@#"\*b #b**"4b` #"4#b`*#"4Ք㿐"X`?)'@X``$`` "M  ! %ߔ(bx""$Xߐ bX@1$"Ā  $X"#@Cb`@@ݐ X`? "`@A @  "@X@R " X& f @X `@@B"`"  @B%"Q  M%"@ߖb`@ @ %`߬("x"#31 '@áXb`` $b``!$X&bĐ $"@Œ"X  $X@B"@ @s`X`? "`@א @  "@X@Q  㿘@  "" " ""@"㿘@   "" "@" "㿘@.  @Bw@Mߔb@6 㿘  @g  @B_@5ߔb@ 㿘#bh @/ߒ@帖 ɠ @$bhbh㿘 %'L'P'T'XbдL@x"؀    ""Ēb@k"ؒ@d]"ߐ"@cb耦 @|  nj  t $ ɸ D | d Ș Ȱ Ʉ 4 ʀ  < ̐ 㿀""'3/b@ΐ "@ `?Ƒ* : `Cq!d*` €`%!"  +*@ b;*`"%bԓ*`$"*`bԐ * $‒ " " ``O"`aK` ‐ _"`  [ —@z ‐ M$   ?% " @S$ Ab"l"l@ 8@!"l "lߒc8 @ "l@ &@    @"l@` @Ex#0@@@Ѐ  `  %`‖@᎒ @  @{ " @ْ 2@"Ѐ` `  %`‖@l @{v ` 2@` %‖@_ @  2@  —@  ?%$  % @C  2$ @"Ѐ` b b %@/ @@{7 %  +**@ b"S*`%b *`bԐ * $` $ @` $ `~$@@w"b "s@`p"b `2k@`?` & @2!? $`@@@bߖ` c@J `@ -   "M@@@y@Oߖ` c@7 A@%l lߒc8 @  `'`'` '`''l $l $ "` "`"`$ "` $ $ $ ` 2@` ? ` @- @"@Df#H@`iЀ  `  %`‖@~ @ ‐Ԓ  2O$ 㿀 `""   "ߒcP   @ ܰ ""   @  c-P? -  @q = @   ؠ" @k  `@ؒ@`` `   @ "@S ؐ" @M ئ ` $@-"@> ("ؐ`  $ @  @ ?2ؖ "—$@ @#  "`@ؐ"  $ @@ "   ' " $  '' "%" $  $ " $ " %"  ''`  %@ߨ  `"1   2- ` ?‐ & @ڔ! ? "` @?3 @ ߖ c@  `  @  "  @? @ߖ c@ݐ  ?c %!b  '7' %?#/-ߑ, ԑ* @  #b@  @Mb@`@p  @?† @L @bґ,  `@!@>`" @>@ߔcx !"b%b@y#㿐 ""@l# @$`h @ɑ  < 2$ <$N p! %ߨ#&N@B# N`' & `@ J` ` `*: \"`?"`` "* $"@ 8"ߔ?c \"& "* $"@ \N@Ȑ ""@?M " `  "* $" @ @BZ#Ȥ N "`?"``" $* $"@ɐ $"`?"`" * $"@ " `@@=`" @=@ߔcx 㿘,` w@: & \ ?N? &`   ` "?N?Ѐ $),`:  \2  N \ &2      $ @ &  & &,  3& "إ* ?2 (?2 ?"!  $@    $  &  & &"ؐ@ @U @& ,`    $  &  & &,㿘    $ && & "&  @% @& * 㿘@%ߢ?N  w""  { s" 1", - ?" @   @= @ ܒ@ " ?"& @w "& @=  @ Ȓ@& 2N 㿘 `""  2 y  `"]  2  "( @  `— `@l  2 _  "` "  U "`"Q  * $  &"@  `— `@F  2 9  "` "  / "`"+  @2  "` * &" $   — `@   "@ `?" 2  `?㿘  "` ߒc%  "" J?` "?ؚ    ;; ""`b@5  "  0  "ߔc 㿘@de 㿘 "&@  &㿘@ǐ  2@`@I @& & "&@ 㿘 ??`@   `@I  "&$ `2$@ 㿘 ?`? "` &@ `"@@ѳ X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X  @ H , ` p 4 x x x x x x x x x x x x x x x x x x x x x h x x x x x x x x x x x x x x < x x x x x x x x x x x H x T x \ x x x t㿀`J   !#"   P ? h  h@nE` ? L hJ`* l (@s H@o P`@h X@b "b8@ 2[S `  2 `@ L@K "b8@ C < 8aJ  0 @c '  @"@@ @@@@ `@h @@c@@@@] @Ggs !@$' 'k$' '@ @/' `@oǘ@@pN@p   @G/; @:P @&!@G$00@9M J@ @, J@ /  @p 쀤   "@p~@ `@pv"8쀦`  !@G 㿘J #%"   P ?`h `h@mA ? L`h* `@Fѐ - !J` @pg @  &  @o  @9԰ @@F! 0@G=! 㿀 J`e3    L - L    L  n e  E`2L  k   f L -b L   \ !H6%`63w"t*` €`!P) '`%  @H䨒  h@FK!X  `h L`  @Gt䨒 6 h!`@F4 h@l?ƒ?  `h*   @`  h h?$hh*  '@  ' '' {`h ?" @gl`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *`* ؔ ` "`@C6   쀣 "@A` ` @1 6&`@J@8y`2 @`ꀦ @#` @4 㿘 J@  w`?  !p!x!"  v ? V  h     h@kx?耢 p h *  `2 ?`2ͮ ̀   ` ! @}@}  ` ! @}@}  " @6'   `!@E_ ?`w#P*` €|@EP!x `!! ""8@E? !@E7@k ]Z@E.! @E(! @E"! 2 @E! `@E"@E" :7@"H ""8@E"0* @D"X   ! ""8@D"` @D! @Dߐ"x "@Dْ " "@DА"H22`/ 㿘㿐Jb      r7 s e  h t   h" "$  h  `"  5`9' w#l*` € h % h % % h %@  h " %  $ %  h ` +,- - h@j'?Ȓ?`'@gs " `'@gj "  h `` h* `J`-`+ `J  ` $ h ?#@@C"s  h* `, ,P @  - "* h* `C `" h* `64`"%@@@{@4* ` ! "*" h#0""  @@  `@\ "=`@ Ѐ` `8@  @|@ "`- +1)-- 0(b"   @ @@C!@ `Lװ 0@B#԰ @ ϰ @|@ Ģ`"  `` @ "`    "@0"+-5  " U`R`@CB# "@C<#0 @C6#8$@C0#@ @C*#H@  @C"P @ @C#X@@@C#`@@C #h@@C#p@@B#x!@B ? 07 "##@B#  #@B -@Bے - " " "@ِ@Bΐ# "@Bǐ "@it "@B"H "@  2i@ BL5 㿈h`  "`  ' ''   #  - +`9x T*` €   '  !( ' h@hJc2 h * ` "J`-`+2 J    !(`?` @BS# h@h @ސ#ڰ 8@{S`/`;9  =5 "@ 2"쀢 ' `@p<#00`@p8+ `2 @o =0$ * $ @h` @BH`ڤ "5)97  =@ @$@@b͔`@y`<`2:`27@z` ) $쀢 '  @o00 @o+ "`2`@o =0$` =*@`$`@hz  "@AƐ"HP  @A H'@zZ`  `$ `" `2(`$ 2"`` $ E `  # @3|  `" @bM $ `$ ?$+ $8 @@`$@`  2l㿐   !%" t ? a h  h   !(F  h@g8?〢 d h* ` %@y?@y 2  `" $ Ԓ ?$  2@z    $` ?$@z 2㿐   @@i @0  `?   @6k   㿘   %'"  p ? l h z h  ?% h@fP?• nh* `2 @G 2 @G 2   㿘@ޒ`X `J``? #@@ `(  "8@f^`h ?`h * ` @E `  x@E  J `" 㿐#p`+     #\#`@n0   #` #\@nސ㿈  1 L -.# !p* 2 *: ? &`   `  @yג  2  $ @T` ) ' #%"  s ?`h" `h@y  2 `h  @?cް `h@e?ဢ l`h   ,`    `@ne#` "@?D"8    *#t '%@b  '?  *`" @?  @?    J ǀ` "#tb8 ' "%,`@?(``@ "@?"Hu  ' `'@  #p  ' ? @D@4'@=@4 ?   #0Ȗ  @f] >   6+'L % @Dr 2& %`@bJ쀢 @>a0 ?  @a  `@3 6 `@1 @@>``,` 2L㿘 J ǀ`  !@dӐ!P!P$!P" 㿐! "8@dϒ h ? h * ` I!h B!L  @АJ`!@>G !@`L`2a@>p u  2``?@&  '*`2P@  P  *`@@ʁ @P!@> 0M$ @dr  `? `   +// /` ?///`?PP" !@" {b&" " @ P `@, 0@ @|@ J``?    @ ` 㿘   !#"  m ?  h +  h@db?쀢 l h* `2  @ @A = "*@`@ 2   2 x               d        p   H   X  P Hf`?㿐!@#` "8@c`h ?"* `h*   @3T   6 @=;#x   +   "   @ " $ $ @=(# x %! '!#퀢 S"  h@cyc? ? h*  2:@C @A-#c8  =   , *.  .   + " @ . . .?#@=s #@=m !p* А   * - ВБ:  @N #@ @N8`y +ဢ g  o a" I N u"@NN`@<#؀ 2N" Ic*`@1<` P  ?* : `  #*` €  4 4I"N N`@ #耢 2 @+<``- `=`+"  N,N-"-N`,  @c "NN 2+N #@ < . @7 2 < " @+ & <  @ެ  < (  @  < 0 @   (@   $@   "@ @   4 Ā ڰ  @Xv ' $ @'@Ē    @ @  @J@ `? @XT @[< @XG 3@N5@I2 @D  $ 0 @*w    @*p   r$`-#`*` €  d`?  ^@  @Y W   ˀ@ @M K  @F D @F > @F @@44 @F , @F @@  @Fْ  @FӒ @  `?   㿘@F(@8  ``@F  <  I?㿘@  2  €  2  8   `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@㿘 2m  €   2_  €  2X XP  €    2  <p/   2  + €    2    2     @? 㿘   ``? `"   !ԕ*` @`?   $  ` "㿘"㿘 .`   ` &@2"0" @2 㿀J""耢`    - H-b S*( a*` ( * * f"  a ?' H" " h@Xb耢?퀢 S"("(` "L2  hcȔ@2p  *  @ 5  #@2( 0 @c 2!# ? @(' 䀢 !p*` 2 @2  @ѐ : 5b( xb(#-+' 2 @q耍  2@2z2 2@2r`  : @ @2g0 2I  ,@E 2?耍 2? @ǿ @$` 8@$Ͱ @@1 P0! 2 #2 2@2%   : @Ґ @2 0 㿘? #"" """ """c@ml ! cpc "c "b@ @/  㿐 4!L`"- "cH@b`h %    ""bT `   @xc "@v   h   @xT @v㿘@v `J` J` @ J` @}?@] 㿐 !`  @O @k @K  @Y   @$ `ꀦ ?㿘 @]9#`㿘 #``2@_( 0"* "㿘N  #`   ?*:  @_ N$  *@`$  N H % a@'x p"#`! '`("` "'` '` '`'`'` '`$'' "' ' ' ' #''` ~Ә >w$"& & & ԔH& &  ''///@/"耢`2 ?$"  2 ?&  2 ?&   2 ?&   2 ?&   ?& @  " @ s  "cH@ؒ  @^( p㿘@+ / 2 "`x ,`,  @ڐ  @R4 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @ a  @@-  @ ,`@  @$$`@M,`` %@  J?`/2 @`撑*`'' @' @$< , 撔, @''',`@@"`@' @$< , w, @'''" 'r p @$!@z` @21 N@   5N@ \@ 2.@  .@   N@  \.@ @  @D`"" & @< !& `@/8 U @  ` '''a<$ @ @$< ,  , @'''"@`'@"@     . `2  @@ @Ax J`2@@( @` "&&㿘 @@`@v  `"@㿈`ذ @#@[ a@ʒ`a@ 啒` '''@0 @+@&a@    @ L   #@C@q @r ""8@5">   &a@儒` Aa@. * J`    $@@ $`2 @  "$`$`` ?p@    a@,  &@  a@C`*t@S?  @  .&@a@&` ,`@.. &@ @' a@$< , , @'''"@`'a@"@ &㿘&' !p \ *`*:  ' " ` = :24J!p! : \2  &  *` *:  ' " `倢 = 4$ N ? &`   ` 2  N @ ` `N / N /2`?'&㿐\`o '    " @@  `$  $@$'@㿘` A !@`@N[.N '%L \2LL  "L `*`[`?`$"LL  (2L@~  L /"  L  \L  N ~ *`.@*`㿘 $ @@ @*` @`@K@J    K@ K @" @*`㿘 #, @ " a@Ē` , a@㼒`㿘`@ڐ" (NN / ?N /"?N /2?N /2& *&㿐@eΐ @P  @` a@`$< , Y, @&`&`&@a@@M`@"@`&@@e #㿀@~ a@  ''' '耦r@ : @@d@ `-" @Mg @ 2 @,  @`,@   /,  " @MK@ $@ơ< ": 6%,",'@ @䀢 6@䀢 a@@,  $@ @@`?`,&M@`㿘 @oӐ @p)  ) ' ƀ ƀ &@? @`N@ Ȁ N@ ƀ 〦`?`ƀ㿐""c" #c ##"#.1!D ""T%  ! "cD # (P##@#cL $c,@D$ c,  " "@" #0#c4##$ (@C !#H` !D`#" :  *@#?$#H ` 1$@  6MI   %  #T*`@  @  `* @*`@`  cP 6"#8"c<* *   * @&  "  0 0 `".cP0 "@eT  @J 㿐 2/@  0/1#8?? @C#8 㿘 @ i 0cX>  *  *` "J "" 㿘#c#@ !# "@w#@s#c@$#$c@ : ?㿘#'(@֐ ?@ "#@1c#  `?"$@ϐ(  # @Lc8? %#$ 㿘  㿘#c !@   #8 4$#8#8 @B"#8@ 㿘@@ݐ 08 4"88@  㿘 _L % @ ""L"L`@c?" "c  )L@M@ "@Ԕ@U%#$#0,`" `4@  @  "c@@ t%#$ ?@L?㿘@  㿘@ 㿘@d c@㿘@[  㿘 #  @J 0I8??B#8 &    :  _ $ -8J?   ` *8 c J?   ` 2 *:  _ $8  8??#8@W 㿘#  @ 0G8??B#8 &    :  _ $ -8J?   ` *8 cJ?   ` 2 *:  _ $8  8??#8㿘# c4 @_"#0c  #$#@J# #0  #J@`@Z$###㿘@??@z ??㿘N  * @ : N`   &    㿘#(@ @N`c    @: N   c(*㿘 ?@_ 0 &`   `  ` @ ^  ? @@@㿘#c @   c8 4"c8c8 S"㿘c @   8 4"88 =@㿘#c @*#c8??$c8%  @   c8 @ c8@ 0??$c8  㿘@##8??##8  c2J@ 0  #8 ??##8 㿘@ @ Ѱ # *@`"#㿘 bI Ȑ Ɛ 㿘`@6 㿘aD@/ 㿘c8D* @%"@ 㿘c8D* @@ 㿘#<`@`0  c8!D*@ * @"@ 㿘 !D !@+ 0!# "cD# @"# @"c# @!"#$#@ "@#@@`#㿘 aD#D`" :"@ `n H㿘#c  #<`m0㾈 %!'?/@ )1  "J??..?# %耦*.@ #` `.!# @n  # &O`^ B?` @*@{ ``@ː @ɐ@q  #T  `@? @T ( 㿘#D`?`  %@# @a * @L@`^ D?0 `?:@M !D?$D㿘J@ ^`@͐@M   ?@+ ?"㿘%#*c ' $ c @$c  "@" $##+@"#L@ 㿘c] 㿘c V 㿘@? 㿘?"#$@ 0@ 8%#c    !!  @>ѐ ! @>֒ $00 , "@"4@"@)c @2 c,##  c, 8/## @  "& /@  c,0?@# @  c @  > *c @8 <@?" # @ ??# L8? &c$㿘1# # @p 03# J `" J#J#,J#)J# ? ?*?#*J#J@#J# ?*?#*#J@#  ?        㿘#c#  <" #@ #8@ @ "#8#8@ < e ;  㿘c%@F1 c* @ " `  * $@ @8  & 㿘  "`"  ?c* @  # #"cL 0@ 8֐? 㿘 #P 0  1 *`@  `  & @ P?" @< c"Ԓ   ?& & * ` *` Z   "#@"c""## ( 㿘@z  㿘F#  "@"###c *@n?  㿘!@@Eے`N *:  ^2*@ N>  ?`  +*@`?` N *@   &     ^*@` `@ ?(*@`*@㿘   "b@$̐ h  "b@$Ð hː@$ pcT.  ` *`   * @$ x0 cX.  .` @$ 㿘#T` @# Ȱ #   *` *   `2 @$}`x :   ,  T@     2T   5T,  @     ` 2N@iq . %   : . *  "@a 2 ; . `*   T @#|G @D̒c T, @ 1` .#X@ ڣcT@*#X@ "@@ #`` :`*"  *@* + @#` :   ?"  *@ +  㿘!.#?"cH#8#  "cT !#T* #T   + cT@* cT   #6  ` T*  ` @ G* ` ,$#X +   cX*" +  @m  @` @`  *`*  ` 8("8T( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $ L 㿘#L`@c 0#@"@"   $cL 㿘L#  "L0@C  㿘#%')+ c#@+cc! Ĭ" %c$c$ @$%#/p@$ $$c%#%c@?! @  㿘 @j  㿘 @d  㿘 @^  㿘 @X  㿘 @R  㿘 @L  㿘 @F  㿀#!## #\#`" "  ʚ袒 # @͐ 0* @ "'% ". @@IPT    x@ @ 0@d 㿀#'# #\#`" " 谒  @ 0H`  0;"     Ð@ @T@# ` J /` " "@ ` ¤ O ݐ㿘#42`@# :`#("  ##( "c"cc,1"@r " 㿘 "`?" ` `J@"J``""5 4 㿘  !"#0#0#, C "#0 #0   #0? $#0#$` #0`c,?@㿘N`#(*` : N c(*`㿘   % #* ? ? &`   ` `,    $c<$8k$8$c< 㿐1# %# "  '"@ #  $* # #ct##   ܐ b  㿘!D@`V 0#<`:@ސ?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' 0K N )   " '8!N    " '2  N  "  "  ""  '" 8?`"8NN     " '2 , < .. 㿘@ U㿘@  L㿘@ C㿘#c! 0#8??$#8  &# `:  _ $#  #K?   ` *#0 LK ` `@ `  ` *: ` %#x ` `@ `  ` *: ` %  |*`@ R`+ #J & % %K ` `@ `  ` U*:  _ $3#8 U*: ` `@ `  *:  |* : ` `@ `   *:  x*  R + 2K#8??e$#8c  㿘#@`'c#  #4  N  c4$  %#@  h h  h h ,  0 d ( @ d㿘'#@ `@3`$ $$`@, !"@`@ @`$`a<@L㿈 C!!@ Մ``'''@ a@ Պ '''" '`"  @g  a@$< , k, @'''"@`'a@"@ [ 㿈!!@ ?` '''@7":   ""8!@Z`㿈!!@ !` '''@" :   0 ""8@ƒ!@5`(  '`@  @fǐ   J`2J 2J 2@!!@  ''֐  '' (@  ' ''Ԧ?$@@?&"- €N  "\-  €ܨ Nٰ N հ   ڸ ظ   $,@` (,@N ``?$@@> ,@N `4 )@s2@   ' #  $,@` (,@`,@N``?$@@> ,@N ` ),@`,@`" ?/   @H@Ӓ  @aŐL m?$@@>  ,@L `[  @ ؒ@v ? @]ܐ  @,@\ ,@ 2D   !@ `" " $4$@ 444 $` ` %"  = #    ? ,@` ,@ `b"( @] ,@T T    %"  = #  H ?"0TB,@` ),@,` T@a T@' T@@א@ `z@@av @a'؀2@@ @ @!!@ N '   '~ | 'z ) 쀤@|z J  l'd   J  b'؀ W䀢 2  '܀`N' ""P  W䀢 T FW䀢 D  A   ?% `'`  ?"` `  "`@Iؐ  뀥  ? @I ?'? @G'W䀢` @!"al 2  耥  ` !p*`   !p*` p ml ,@`ҹ$@`@$@ @ @ @ B(`@M:(@`` `a@$< , ґ, @&`&`&@@" &@` `a@$< , {, @&`&`&@@ @@"@`&@(@  '@  ''H  ''쀥 { !p*` r p + 2' 쀤@2# @m=!0 2@a8@F @` `a@$< , ', @&`&`&@@" &@  R-`?߀`]O *` €G [`@ ,@?`< ,@`@6`@3 {`@0 ,@`*`(%` '  " (`'@6  @ 2  ?` ,@`@' 2,@,@``,@`ܬ 㿈N@ $`N@ #cNN` _ } `@$ [ % *O  * @ *O  ] *@e@^   @2 '$+ 2 2` @ !@`+@]@^' "b8 @@ +`J `   2&!X@ &@;l@ @;}`*$@    N :  N   N * ap@  @2?N  J  2&?&'N@ * @*  %%=#!@`` 2` ""8$@@]v$` @ +  @`$`` ``?$@$`4`  @h [ w O  * @q O  ]m  %%=#?!!@ а` '''@dϐ@]<  +  @$< , Ъ, @'''@^"@`'2" :   ""8$@O `@  @ Ц`6!p @,  ,   '''" '$`@ `$`$@O  @`?4` = @!p* @ B? ?@\ڐ@]$`$@ +!p. @2 "@@J` ""8@ += -?`J ` `J ` "@"8@!p. @2怦 +!X@͒㿐!@!`@.  ؒ"`@PC"@ $ Q V@ -``(``#`   "  @X @!p   @C 0 2$6 !@@א @C  @  " 2 @{ @4 2@ @@ 6 &  㿘@= %2#0Q@0L@8J.@ &㾸@R@2|  2   2Z @v  "  @  L / '< %@(@ @*  ?    2. @ (*L /%< @ (@2   @*f  ?    <  2 /,@`,@ %@$< , ΐ, @&&& @$@@8ʔ"@`&@ /,@`N /?$@@8Đ,@N /`@ /  ,@ @;: 2,@$ @" @8"@`@@&@;P @!@ D  9@ ` . L 1 .2LL +L .N .#@:  @N @"@@8V@˔@&@ @< 2J`@~2,㿘@i  :$@=@L`- &@)% (2  L  `@K 2  .@  "&@.@`&@: .@` L  &@ ݀.@@1㿈 !@' ' ' 'L@?"@$ `@7ِ ``*@L@` 2 *@L` /"耢 :*@ @   @'̓ N "&@?$@7 2,  ,N  &㿘N  +@Y!@Z2 NN  2 N@Y!@Z - N  @Y!@Z@  ""8" 㿘@N @O" 2 @ 2   @72`$ `$ 㿘  @x  +N {2( N   `N { }   ,?2 "N  逢` $ c$0f   a@$< , ̭, @& & &&"@`L& 0B> "& 4 N { },  ,? ,% 2# `&!@`\@:@5@@0,f  2 0 P d D ` `  @ @   L d x  D T ΰ θ L ԝX'D'H'D    H H DR` H?D@Ò { @4 !`@O DR`VDD"alD `  *`#`,V:`'H$DJ Ӏ`1`,@Xa!@Y[!  a@CӐ#`@  #`!% "# "  ` @bH@C @  @@#`` @H ;'HD` 2 !DR`"!DR` !!@ @˅`!@ @"` @ D `%D `#  %' "@c 6 '`X$c` T@P@8 D@?* : `B*` ` €DH@V'04DH`H  'HH 'H@ !!@  2!@  @R @ !@` 2DR`!!@- @ݔ DH@ג` @Ӕ @/H 'HD`'DDR@ !!@ ` @R!@ ` 2 HD@`@H`H "'0DR`DHȒ aD`'DDR@ HD a`@_ a@ 2 @\   @Q @3` @3   `   @t!@q  @ !!@  2@} !@` 2@耢  @^ @3`$  쀢`$   @P @ &`@F  $ `$ $  @ H a@ ?2'HDH@.b0ZDH %`D!F'D `D R@  `? DH H!'H07D!)`?D '`"cl'''''\0 'D` "D !@` !@' 2@!@`?  @2 @2Wa@ @  'DR` 2* `D@V` '@WDH˒ a'`0'D@Vm`@Wٔ DH a'@w '0!@ 2!@`?  @2X @2a@ @B  '0DH a'D!DR@@  `? 0D `D!s DE D Hg a0;D 8D`'DD`eDR``D '`  @6  '@ D 'DD <DR`05DH a%D`D@(HD 0D @[@'@M@2\DD`@@8`D@(@.@y"@Ӓ' "c@1 H @1T  H! J `@1E @L 㿈'H J` 'P ' J`    2 ( ""@X ?@VҔ HL ^"!l@  'HH A" @H a<   J`P 'P*H| `t < h@7  3 h@7b@ p?+  J ɀ`Ҧ = h*`   @ǒ 'HH `H ``H cX  `'H` " H Ha@T-`H H ` Hh   J 2  @ "N#  +)  M#`(2  @T!@Uz c`@@0a  耢`c` ""@ ""H  @@  ` @=Wc`  @X!  2  `  @X   ``!l'0cH J ɀ` @z /  b`@P @'HH    0A퀢 0<H@07H`LH `H ` H@w` bp@ ~ b@~ H  @.m H@@w~  b@g @I@M @  H b @Q 'H'Hh"&"!@ `" ` !!@H`"`(`` P "` P `"( ", "0 "4 "8 "< Ѩ"@ K # 'H H2 + # "'H!@"2@   H P  a "cH*H" }H@ #@ &$H` HH@H ?"@ @QH"` *` € #'0`@/ @/1@/ c@ 0TH`H ` H@v` c(@? ~ c@@9  @bH3  L `  (""@V͘ H @T P @?P L   #@Kʒ #@Kƒ H `(2`("  P""@L?'P  "#@.͐ 㿘@S #P@T L  # @ٖ  L 2 #`  "?& " @@@i@v? #h@ 㿘@G@H?! cx@a @㿘!@`    @H"  L @HB& && 㿘 @Gה  2 " ?$$, ` $ @P `2 @Hf`?@OB`$ $V``$ 㿘 # N = *! +@GU@Ga  " "" 㿘@GFJ ̒ /@P   q` !@G ` @2 /`_   @R#@S "b8  & &  @ &   ` @2  ` 2 % `0 ! !(@GU #`   @     &t` ?&  `  T P`N `   !(@GP &  H &  &  # d  @  H @/O`& &  &`@Q#@R "b8   @_ `H & "`H& 㿐a(@GU  J`/  ` $ ?$@GB 2(@   '?@ `@ <  I ?    "&㿈2&@~& / Ő 2X 0VĐ"@Q@А  !@' 'o ' '耦`:@~ : @@$" @.@1 /, "@@.@y N@ ɲ`Dz  ]㿘'@%# $X$c0 @8  ! h@3f$! @@9ac0$!$$X ?      -J $`  Ԓ  ' ' ' ''''J`#!'@Ps!@Qm0   @L|#@ E`S ؓ*` €L J" J `E&  @B`@~p x<  6`3.1"   @’ `*L@ -  L` 2 #     @ l 6 @L. lb@ ^ ?" `J ` "b`@ K ?@!!2|? ###@f?@s<c@ % 0a!@ *`R   ?@  !@` *2 "@? <@    @KĐ @0@scД@  +?@'?`@` ` !<@   @ p@   ` @7f  㿈?''D 'H`@  ?1!@  @@  ' '쀢`  `@} ' 쀢 2##@@r` `@ 쀢 R?@74 ؐ '@+-!@ @0   H@+5"`@?09 !@1`@  D" "& @$!`8@  a<& 4 @:  @: D@+ @7n?0@?@x@rN` @ 7`H㿘 +怢 )'% , `2 #瀦` @N֐`p@OJ`@8@N̐ @O@ aؒ s`  @N`p@OJ@ ۲ @T( 4 "* ? ""8㿘.`@ `@: 㿈   @P@&     @   '#` ''@2f 㿘.`@9㿘   @@&    #``@2> 㿈 %!  ' `A`?J@ `J@ "`J@`? * J@   : + ``+J@   * `+Թ`   #.`  @{-`? a  $ a @8T 㿘`   "`1 " "8耢   㿘Ԣ㿘 &`@ O   ۼ   $ 4 D T   $ D T ߀ ߸ d ߜ 4  $ 4   $  ؝x"'ؒ'@&@p'Ԑ 'D'L''''@)u'a@ @w   *@"@)y  L  "4 @ "8@)@` (2Ԑ '@"`"@p @Ԓ ("D  @ " @OD0@N5 L@ND@)?  㿐`C&  .` €  ''&"  *( )"  * @N   " @//@ *` Ȗ@b b bcc0@ 5 0cX@ / @( 㿘 `Y ߀ ```#@ @|`! 86& `"` `?.& 2- (& `@c ϐ`$`y  @S@  @F c `;@ @703  *,`@ ȓ*`   @ `@  @  ` ` ` s@耢 ``    $ p  ` ؓ*` € @\  @  @s   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@g `  "   8  ?3$  @   $   ?$  %] @9   $   ?$ "  `$ @"@M@M12&   ,`ȑ* `@㿘 & `L?   ` `2 &` ( ap* @ 4  [ L * `2 [2 ` @R 2 `  !@&`@@ "`!@$@(Δ@K!@&``Z & 7 _'  _  * !p@2L #"L@ $@(@&` }"`" `"` ``@MO @ k`% '&` Ȯ J  2  @i  M ` 2&` )&`&`㿘@@L` ` & " @M @LS"& 㿘N 2@@2 .`* Ȕ A $ .`* Ȕ 6 㿘!!@ Ȓ`!@""" " " * 㿘N`  @@" @b" @L  @ "$ ` @@ @K,&@  @ *@&@$  T T T T T T T T T T d 4 < D L   8 P d | J Դ `       #'<7瀢`C9#*` €h c@v )@oa@ @'ic@m `h  @54# `uh@,Eh* K   2 耦`2耥"X ` J@ `@vh =  !@@'`$@  , `  ` 2 `6 2瀥  @ה @& `'@h7 耦`  8 ` 2 `2`2  #@o   X @ @  @   ` @ @ ݀`@ @̐  `?=` ` h@ ,) @)753+|#0D":@42# @$#0@4+`p@u 2 #0@4 `x"`@ @|@1U#0 a@ @ @ `  @  @k`@ 0@ @!@@3 x"`@ @(@@0ِ? @ @k@ 0d @I `@IȔ #` @# $`R`  @/ 2 `@ D @   |'`$ ' 'x'| "  x|$" @%xx"@@1 x&  $@0{,|@,`$@| @k] `@[!@0j㿘@ #+)' @t   |, L "  |   @# @x ,? `@"%`؁㿈`!@@%y`0V@@  !@' '   ''$@"  @%v@@@f  〦$ @!( @F "@$@%M@”$u㿐@'a /  |` "D* @D*@  `+@K/!D `!@)%"  !XL ?   1aD  " : ?@i '!@@{  * @㿘 aD  2 D  @c!p D?㿘`!D@R!p 㿘!!D` #`|% "  "{``|!D`?$!D$ pD਀`": @*` p p 㿘!D` "`< ? @r ``. @@ #D@!?- @@eߔ  ` `@@e `&@ > `@@ D@怦?㿘!D@K" <  ?  ??4? ?㿘 )!H'%D"@< . "@@ɔ,  %!H$D$㿘 x`"! t "1@sf 1 h #@ t"l`& h `|"D$ t" @S`|㿘!  !"H`{'Д?"aD$ 㿘 `@#@s 2* h`@31aH * aD  `aH * ?:""H *` ?*"&D㿐J ` "x "|@E!@Fs" t @#f`$tt" @Д! g@ ! @>$ h h  @x  ` " l@h Gh@,B h#\   @: ?"`l ?   ?`l@@@tt`l` @)aH `l`l@I `l@wt`l@@qt`l |@`l@wh@ h  @x $`l " ,* "        2    %!aH'|'@D| &@3 !L#`t$@0&@! &# @  |@!| @֐@ `h@X @$@ǐ`t@2  @/6!@?  0  2? "  2?@" "@  㿘   H@` D* €@ 6`4 @`* / @`* ) @`* # @` @ `aD ?  @`& ` `  㿘!D`$ : &@@@ "@*  1 @! $㿈! h@ؒ  h  @w   l@ )D"@  h#\   @ۖ ?9`l  @F00! |   h#  |"@4 %`l>  > > // h///@- @  h@' h  @wL %`l h@ 0@㿘! h@ @ h$ h㿘 "b(@   @ 㿘  "c"N'H'L'P'T'X  3 @q H@/wc`c`@.r @,uc`@s 㿘'L'P'T'X@_! L@/d#` @._#`@,b#`㿘  "c"N'H'L'P'T'X 3 @B  X"a@/c`c`@/?H @.:c`@,=c`` J ǀ`" X@- 㿘'L'P'T'X@ ! a@.ߐ#`L@/#`#`@. @,#` @ 㿘 ! ؀     "  @pt    J- b#`@.a ! ؀    $  a@.#` "`㿘 'H'L'P'T` 'X! #`@.ɔH@+ʐ#`㿘!'H'L'P'T`'Xa  #0@.H(@h   <   ` `㿘 0 @*u  ` @*p   @*k  "`㿘@  @K` !㿘  @  `@3` ?א!@ @ 㿘 ` #@+P ``@{0 @s㿘@~ 6" &  & 㿘@\@Z 㿘N? &`   ` "+NN  2'NN ?А@J `+("8(  %` `  2"P"h p N  @G"&?? "   㿘! `  @@ ?$ 㿘`   `` @?$ 㿘  `  @?$   `"@?㿘  1  ` 6   @?&    @?$   @?& 㿘 ܀`"@h ,  $ $$@-@  @)# $!L$$& 10 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 10 2, 2, 2, 2, 2, 10 2, 1< 2, 2, 1d 1d 1d 1d 1d 1d 1d 1d 1d 1d 2, 2, 2, 2, 2, 1㿘 P"`8 "8@7 "ɐ!b@9 ) 'J`  *`  @( J"`J #p`#$ .  * $ @9g ?. J` "J` @l @?{ 㿘  ')<% L24  2.  2  J` "%J` 2!2   @ (  @  2  @  @ݒ  2 `@ @L@2 ! ""0 "cH@В "0@ʮ  J` @*`㿘 `J` "J` @?   "#H `'# @ $@  "`@@cc0 $਀  "@8Ô !@ @#H &0! @2 #$cp ,   *  @8?, ਀ 9 ` 0 @L #H@@ccp}  $@ﱠ#P@cs $@Q  `@@cxcc $ """0 $`਀ #HcU #H 5@rՒc01`" #$cp ,   *  @8O?,  #p`#$ , *`` 2` `@89 ?,  J `@>㿐` aL`@ @$@$`$``$` !  !LcB ` "%"`@m` `2$$ $!L $,$ $($$$ $ $"$$0$8" "`@ ` 0@; )`@J,@ @`#! `  @@S` @V  `?"$` @"aL$`  J ``   `  $@K` `  ` "cH@] `@`jb@ebI  @ @` J `` 2J #$cp ,   *  @7^?,  J ``@ܐ `! J `  @7E##В @7@ b 8@} "  @@ƒ`H" "`* @=* @6a` Q`P@x @D`7 @b   $8 " `" `"@# J `  `p@*#`0` %` #`@*x@`2`  @)C#`@'F#` @u  @{ 㿐`@r ` `@E" @e 㿐` @]```  ``  `ߐ  @D   }@3  @9 㿐` @1  &@ !L  !L@2 2' @8  !L   @ "? @ `"ȓ*`  U?@  @   &@㿐`@ِ @   @ϐ "ȓ*`   '04 `2 @ 6( @? @a   2  ``2  @ʒ  @ǒ 6  @# @`  @ 㿐`@ @   @ "ȓ*` ɐ `  ` @n ͐ Ӱ "`0`]!`0  +)' "  2$ $  a  !8F  2  "?"H @&#02$` @s `"` @J` 2>` ` `  "cH`<@  , "`h#H`h`@H  ` #H@ْ  @  `h#H`h`@쇰 @`]!Z0``  ?@ $`"` @``@   :`@i`(` $``   "cH@  ! "##H@` @I@`#Ha@`  @ @`!h 0  `` 7$`@  @ 㿘 ' !L` " J` "J` 2  2  2 " 2  !! !! !!8!  㿐` @F`     @9 㿐` @1􀦠    @O ` @  "ȓ*` y B  ``    !%  !`  @ @0 ?   "$  2   3 "@֒aР 2  @֔  㿐` @͔` '  L` "    @ @Д` ? 8 "$  2L`  % "@ؠ`2 @$]` @ 㿐` @``"` "` @ `㿘   !!2  @ka  2 4a 0B `  " 7$`)+%   "! " @6   ` a  bȐ  & @&( @ 㿘   0& ` 2ࠀ & 4aL"@[ 㿘```$``$` J `"`` @!8a  "` ? @2O$``$``"` @2* 2]`` "` ` `x$` $`J` 31 " `/#H` ,`  !@#H $`h`($`!#H@ 6` @8@^ b0#H `  #H``<#H @ms$`#H&$`4` #H` #H`$  @m`c`4  ?S$`#H @L` `2`4` ;$``4J` ` 2`(   #p * "`(@1_ `( "#`,#" `  "#`$#" `` J `! ` " @Y#`@##``  J ``@-@鶤  !L   2  2"0 2 @?vd@?  0"   2  2 0 h @E HV? ("? $ ( ,l@@ $ ,?/!@$ ($ , (" $ ( ,"@ $ ,"@ $ ($ ,p  $  $t@@ $ $?/!@$ $ $ " $  $"@ $ $"@ $ $ $ @ Hd ` $   `    $@?@M  4h@"㿘 2 0bX 0`  `  4@`2` 4&  ``" &  &   &  ? #` 2 8 n$  8`"  @2   ? $ M`  @`& L  : 8` 2L @r L  -`   '!@!  `"R``2 2  @!  @0 @!  ` ` a@`J `    ?& & `"@b8 %!' `' 2 4  @$Vb %   ?` ' ""' 2 +" - 0 З*'; "     `0>" `09b *x  `"./  b@e @#` @@$"`  2 `2  `2     2  / *x @e @`` 0  bА@#; `b@#ސ`` b@#֐`2O $` '"b8b@#Ð  '  #b8`"b8c@#   ; 7  3 )' "#8/- "+逦``  @ #\#\@#2 c8  #8@#{     ڀ` 27  "@#ebH %! @"G#@㿘 !p* &*@=I`  4 "  2 4 |`   z 2 p`:  %`m k&@L`?F!*` €  V` R`0T@=` I  J 2 @` 7  0 "  @V  `"`2.&@-    2 0`@!    0`@V 2`` 2 0`` &@ 㿘` "`` l `" & ` 2@`"& 㿘` "``} @㿘  `@2 @cH 0*" 0` ഐ @"`" ! !L @  `?"` `& # #`" 2`"`0"""" """㿘 0   "@ &? 2  E8 E E E E 9 > H D D G< E G F, I I J Gx V0 V< V< W W VL Vp V W a@ b\ a` a b\ b\ b\ b\ b\ b\ b\ b\ b\ b\ b\ a a a a a a a a b\ b\ b\ b\ b\ b\ b\ b\ _P _t b\ b\ ] b\ b\ b\ ^x b\ b\ b\ b\ b\ b\ b\ b\ b\ b\ b\ _, b\ ` a b\ b\ b\ b< b( bL b\ b\ b\ ] b\ b\ ] ^T b\ b\ ^\ b\ ^ b\ ^ b\ ^ b\ b\ b\ ^ ^ _ _ _ `$ e e e` fl f f( %!''(593?'''' @@' 'n H ''&' J   , B% ,   `J` `\ " @  `؀ " #  '  `J` `\ " @  쀦  ?' @ ̐``  ?"` J`ǀ "   !p*` ?$@_ z͐!l- €J ``  ! [J`  `\ " @  o   !@ zh`?B a &`   ` `? -? &`   ` `G`? &`   ` `?/()`J` `\ " @ b    2,@@ ,,@`@ `,@ ?A ` *` ` `@J`!`@  [ `ؐ @P$@`" " 8"" &`@  [? *`< *,@:  @  $ ,,L  ?$@, , L @F```ؐ @$`" 8" " "_&` @ + ? ! '`J` `\ " @  ( ,`,@  '"   \ ", \0:9 \`J` `\ " @  K ,, `'  @ ֐ %8  , @ ǐ %)  \ ` ` $? ,: ,J` `\ " @ ` $ڐ  \ " ? ` ͐ ?Ȑ ?$@А  , \,,J` `\ " @ ) (; {`J` `\ " @  (  @ O %  %  $ % @ Ӑ 2 @ : %  % %  W ,,@Ԑ`J` `\ " @  : # ,,`J` `\ " @  # %@   @  %P @ x  @ ߐ %A  ap* @ 1  , X,?$@ ,`J` `\ " @ m * `2, ," X ?$@ , X,,, ,, , $,@ `  @ v %  ,% J ǀ`Ѧ @ @ 2% @ 2```~ ' ?2@ X , ' " \?2@ D   ?͐!X* € ("  ) " ' .  \  (  $%  ? % %  %  % `' %  " \% 2    %  '2  % ?'   2*,$ ( )   % 2, ? % `J` `\ " @ )?2@А,%@M   $ @} , (,  % %%  } *?2@Ґ  } |?2@Ð ؀ (0ڀ ` \,2,`J` `\ " @+ $", \ " 0  ` ,  2,  \, ) (  ?M% `J` `\ " @ ) @ɐ6 '4 '  0%  \ '`J` `\ " @  Q, "  @  %  , `i' 9  % , ` " \ , %V & `J` `\ " @ $  \ " `  , \, ,,+ ) | ,?@Đ ( , * , , @ % `J` `\ " @F _?$@ǐ @3#h" < > L@ ~ `ap* @v@ 6` L`?$ >`?$`J` `\ " @ <- & >* &  >  $ 28$`J` `\ " @ - $@$ > <  $$   > $ | @$@$$ $"!<!2m,2j, )"߰ ) ; &` ( 4 %7 % | %`J` `\ " @s | ; | &!,!!!( &&!@? J ʀ``J` `\ " @? (!@ ~ %h$ q"a<@ cئ `@<@J@  ` @,@`@ `J@ ` @xo$ 2,?L? L? J!@$ @%   !  } !@<>`. * @% "$! `"!8 " `ؐ @$ `"8""!@" <&``e?! % @А#㿘!4`0   @ a4  0$a4㿀 y  '`` "`!@!' '! ''+-  $ ` `ئ L@!?$@ , `J` `\ " @T`ڀL  `` 6@%'@<㈐?$@ , `J` `\ " @!` ߀`?$@ , , C$ `& `?"`㿘 'H'L'P'T'X`?  H `8`? (`8"! ""8"L  @Q#`Ő㿘 < ""8?$`$ $ $ $ $ $ $ 8 $ $!$ 0$ 4! 0$ , $ ($ ($ ,$ 0$ 4㿘`ؤ @J  $@``t$@͐!*` € "s"8@h@`   $`$` $`^$@` ` " ""H$`$@S$`"@ $`$`M$@`  `8 $ؒ@ U" `  J`"`8@[2 J?? &`   ` "`8`8` $ؐ 9$` `  `$ؐ "  `` ,`,`ؐ $` $`$`8$@$$$@``@!@` ``8$@`2 `  ""8$`$`$@  ! @#`@#`@J  s$@㿘 J  ` ,  `?   @  (8$@  (,&` &  # " "bL@w `J`  J` J`  ܒ( & ,F+ " a @ ? & ?#+% ( @"@  `$  ` `"@$ɐ  ("  J "   ,$ (" $٠?@ - (Ҡ? `@  ` %` #` """L@w  , && @$ ,    2)&@ %&# \`2JJ!p` * J  *`  2J     &   @ 㿐 " \ &0)@,#@-!!@@ `!@'` @'!@ @g    "a ʦ @ "a @ 0@,ܐ#@-!$! h %!'N     ٨N  2  Ҩ  @ *: ` ` `   /   `  : @ `? *:  \] !M J ʀ`ߑ* : `V9*`͐! €& @Kސ@Fv }@Y}L`{`$@Y{@Yo } 2,@@K@F̠$@=@Y_ }  $@2c .@2 $0Д@Ӑ @{   //  @K@Fe̠@K{@F\̠@Kr@FS̠ @Ki@FJ̠@=$0 ac @Y `@X `$@X @X 2,@0E`%@+ߐ@,!@+ڐ @,@t`@Y /@+ʐ @,@X d ~@+ @,@K L@ /@+@, 7 @+ @,@{,@X$0O ؠ`! ؠ` `( #& $ А   А ( LL@$0$*`:`*, :  @t$ \///  /  L@^$@t`( @6T&@!$@0M ! !(  ؠ`Ж @@s` @&$@3&@  `@+'2& ""@! ` #``2 @ "* "2 "` M -  @#``2'@ %! @B (㿘  㿘  㿐 'J  \  `" @`k͐# .` €, :  #^  ap* @ V  S  P N  !p*` G`, :  [A @U 2.Ɛ 8 L #?&@D  .L  a@`J  \  `" @  !p*` ` `2, .: @\ 0 ?&@ .p 㿈  !@' ' (' '')J@  @ \ `" @U?$@ِ,`: , [  ]":`  , i$&`?㿘` ?"`  "b8 ` @` "@`$2 * *  ؒ " " 8"$  㿘 `  @J  7"@`   ؒ $`J  '"*#$`! @J  "@ \ J` "    $`㿘!@`ې!" !$ $ 㿘`~&@``& !t(@H  Ԁ "#  `ؐ" 9 #  @)B H    Ā %%<#   "$ @d 2$  2$ Ā@   @$  2  ؝( ` ! `    @$` $`@)  <  $` " 㿘#@>``@$` 4 @Uْ : , @UҒ % N? \ @q ?@t"  L  @U ? . @ "$㿘 % # 52` (` $ $$ @ 2 $ <  2$ $ 㿘 @) P @)ܔ    `& C X@-   y y y y y y y y |, |, { |, { |H |H { \ H H H t H H@  "#< @!"    ????????'7 @'a"a@<@''@)@K/ "9!( @#   @   @ @-! @ @`'\" ` ;` Ձ  2" `   q  2"$d  @V    = @K$d@'Ȑ"d@)4 `  *@p*`?@@Tc8 `@T` `@Tܒc@     #HX*"  @+ #  *`!   #`  @+   `@"`"L    @+ x 8 @'t#X@(nL /@@ #`@Ѐ  @Ѐ@2 DԀ@ @ )!J@ @  !J@  ""8@( @wF@';"@)X`@'5 `@( X`N`    @@;% `#h#p"@@'#x    @(@T  # `@(j @    @@v   , ,  @ 6L @̐  @ E`. @ $@$` #. @ P\%`L % L  !@ '`. @  $`  @  0   $`   @-"c@J`Ґ#`&%` `, c$`㠐   @& $` @Y= \@Y8   \, ,$` `  $` `"$`\@ h<     J `"L @   L  @ , L @=@. `?`@&""&@- L , !L , J@ 2  L c⋐  L  #ؔ @x L `2   #  @l  J ` # @b 0@& @'ڒ J@    @Q @@ 2  @&"@'@     *`  *` J`  "@l*`@  㿘@%ސ 0   `@&ϐ  8@`  @ #@RӔ 㿈'D'H'L'P'  @  0 'v?L  !@`''0''@ a@ @`  3L "  @  !@" "?`ې"<*` € ? #P` #Ѐ`5 @)`H L 3!@"`H" a@ Œ`'Da@" @` "@ @T`  a@" " 㿘!@ `"`"@@ 㿈'D'HD`  J ''` H@  ' '@쀢 "!$a@ @`   <?`/*`ې"\ €쀢  2 "ڐ"HJ `D `  D "`D "Db8"" " @ @"`@ `Xa   %!`@ D 8`L  D`  D` ?"` 쀢  RD D@W BV .  L ?'`ohD"  3a$    D&a$"`H '@.   L   D ` ˸ "cЀ V  쀢 a$ 2"a$@@Z  "`Ё㿘  J `   #|` #pJ `  !#p@ !!@R`ې"|*` €a@@_  !@` 2`@ !@㿘#a@ Dp`44 [ a@`$ $ $ $ @$a@㿘!@` " `  `@"` @#M` "` ` , R@`" ?  $` ` R ` ` @  ` 5 T@ ( J ``  #Р   @d`  #p, @ @ @ @ @D @ c@ @;@$@'`㿘!@  "    ,`R@ `@v_`$   $   2 @" 㿘!@ @ @  㿘!!@@`@!@`"`@㿘  ! !L@2@[  2 㿘@j / 2@P8 r  @BW`@ 㿐`J c b;!(`@1 `@J@ )!H` @1 ` @J@ !h?# * * 2 `@ ? 2`  != 0@@b   @Y @F/@-!㿘@@R   @G @F@!`!p    0 !p3!pJ p( 2J  㿘p – @  2@ `!p  @  2@ `p`2!Ò ! ! ! ! ! @!!㿘 ?",@ @?,@vh 㿘   @k  @OP 㿘` `@* 㿘 @    $  &@ $$ 㿘" . @ " @O<   $. ?㿘 .`@ J `   @ sh "+ِ Ȩ"'Ȥ  Б,` "`@j$?$Ƞ @'Ȣ``$,` #0 @ 0ޱ! b !N " `,``"`ޠ!``$(N "ޙ"Hh %!b  '` J@  @K@ " *  $`!@*`5! @ ސ! 㿘 J  *`6 5 1    &`* * * !* ` @K!@$ @ @a@@]@ъ  `*     aL`* $xJ  `   +a0 (@N'@iؐ!a8 *@N! @iϐ! ! b J`  ``  ,@`" *  $`,@*`J `-   @ / ",` J  -2,`  ,` ! @  bS7쀤`A2  `o`?`0* `0'? ? ΐ8  O.  , R @.#i@뀤`s" " `  $ %J`@2`R`@ %P@>耊 !`ؑ*  `J`-`+`J  ``-  J `2* * #ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @%J`!hܑ,?aP &?ؑ, `2 *`t$ @f ؐ*@' ؑ*`" ؔ*`2'؁㿐 @,>N J`2   <#$&@  㿘 !=P %!' `+ @h@h@@* 2$  @!@&`Q@L`?@p @ !㿘   U + M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  a@Lm  `  | )`02 `  2 *  ``?㿘 0퀦   @〦   ?" ` [ * fŀ " 4 Z`"° @  ?    @ "   ? 2 @   2   2w  @ِ@˔ "h   ?g 2\ @ U  N 2C  @V@ M?J  @, @ 2        @!*`?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% #   ) |?? |2  2 ` `@Jːa 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@Jy "" * " " " 㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@I 2J N :2` `&`O.` !`!! 5a`:`;:`,@+`?`J N  `&`3&@`;2N.&` :2` `&`.`L : !`!! aߙ<``  ""81 ? `#@* ?`@ &`%&`2$<`@+`?`K  !p*`  &`  ap* @`&`&@&`<`㿘L  !p*` !2 L L  *`a" L !10/L ' !%1 `'`#$ #0 #0 ?L@Ւ   " *@`" L  `"㿘!@ 'L`o "bT @o_ " @@oX` ` @$@mT@oD" $  @,  `/-+ "@l@ L @>@7b8 @l@&ڠ !@J`㿘`' @&!  `@L@ "` @&& "$@f@ $,㿘 @꥔  @`#@@   @"㿘 @vO   ?  @vE  ?  㿘  !@$`$@L`  @ca@ !@’`㿘  `  ""8N@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@c"@@c@J / /,  $'" @bJ / /,  @ci "@q@b "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘     ""8@b `` #"``a$aa@b^  ""8!@`㿈@bÐa@ ' 'c @ ''@  @2*@ /*@`*@`]"@㻐 %!'&@ d_N /"N Z@Fɒ / $@@b  N .G 2 N .2 N .  @ (;N@ /@ 4  /&@.@` @" g@aܔ@.@ @c# 6 .@`" O / @ " 2N @ɐ" $ h h h h $ h h h h h h h h h 8 h h ¸  h X ` p 㿘"!!@0 `!@`0 "$`,$`$@$`(@V   4`  @s@kq  , 0` 2@\㿘`"`` @sW   "`  `0`0``` b(ڐ    !!@`&  d & !!@0` 0& b!@`  & ,& & & & & & & & & (`&& $ @s 㿘`"`` @s   "`  `0`0``` bHԃ     bh (6 bht  & & & & & `& & & ` &&& $ @r 㿘 b O1!@ 0"`!@   &,B B `$ @?& &&&&(&&& &&&$㿘   @H@ju &?"$ ,0 , 㿘  @,@jY &? ?& & & & 㿘   ` &  @  & * & " ,㿘! 3 1? 6bȐ h@Ʋ $?"@  *@ &  ;    @Jv  & & @ @ 㿘!   6bӒ h@| $?s"@ `l * &a `G d@$@2\?  ,*`Y   &  " "@      @  + & & & & >& @7  "@ % @ 6$@6`  (@,& & $@  &  @b @& ?ܢ@`  * && &     & &  &㿘!2L  6b @ h=?@ $8"@ X ?2-?  $$      $ @`2  "    ?(@ſ$ $ $$ $  $ 㿘bҺ `c ҳ` 4@^e @"&& &@`@ ?@ @$@( ?㿘c} `4 `0 \?(  @!,@@ L " $  4@^&@ @"&& Ң@,@㿘2 c0:   !? ?  $ @`$ 㿘@2@cH @('?"7?``@` 2.?i ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` 㿐@?c`Ր ?"B?@ "-`` /cxƐ @(@İ?`$-"6` @ĩ`@ " ` ?(@Ğ&@&`$` @E  逢 0 2 ` ?2`?`?&`*@`&`㿘 " ?@]@㿘cz `6c r `@@`4 @]$@@"&&`: ?24?@ $`@&@&@  @ܔ 6$@)`  ?(@&&&$` @\ޔ@"&&㿘'L'P'T'X@6Lh'P'T 'X` c Ȓ P@hȖ'H'L'P'T'X  B H@H %! '`  @, `:  %"N@ `2  & * &  `   U`* : `L##̓*` €CA?"<@;N@7 261N@ -+ ) !p*` &,@: , ?Ѐ`  ,@-,* :`@  ?Ѐ` "N@` & , 5 ۦ ۑ* : `S"|*` € Ϧ쀌 * : `Y`"(*` €   ,` @& 0,@@g 2 =  u< -7 +20 -`   04  ,@" 0"!##`   4  ,@  x X,@ 0,@'@$@` @\ ` // `@@d`%@ @"@@ L@`+ @`-` `0  )?"*3 0  ? 0Ò &   @*@`& `  @` x 0  ?*`:  `&   @*@`& ` @  0`', `2 < `& * & `,   `  ?L@r &   @*@`&  ``$@, `2 < Y& * & `4 @, Z(? %! @ 㿘 !` `?@}$!\!\  "aP $!\T "a`!`` ` aP ` @ $aP`@ 㿘@ * #%@   @ 2   @J  @C $ a\ `$a\ | |$`ސ $a\㿘ϐ "#%Ȑ  !@P   @ a\ `$a\ $`!瀤! $a\㿘  )+!\`a`%!\Ґ %a`  `@`؀ `瀦 0`* &! ; &   @ؖ 2 2  @Ȗ  @ $ %!\㿘!\`  $!\ۈ! "a` #!`a#& a<$!\ ! `  @?`?@ b a< & J؀`  & 4 X@ `⾐ 0"@"4& 㿘\ !`@ "\0 H"a`@ 㿐@X  @ @T P!!@ ` !@ @` @'''!@ @` @'''ز !\`!`%a\ , "a`aaa sЀa!a `{ a`(!@  ,!@ na  00"  aaa!@ %a\~̀a!@ %a\`!@ ~`!@z`0 @{%a\`ؤ $ T耠` "@ :` @`! $a\ ` %a\ڢ%`a"a`(c!0i` @,% צ%a\ؐ" :  " :  2  @W#؀ "4" :  N #a<@¢  !@$< , , @'''a<" ' !@$< , ݔ, @'''a<" '!@`" : ؐ" :   ؐ" :  " )@o  %a\ %a\  (є )ؤ {̔ }Ӥ@Ð `ؤ$%a\ !@$< , , @'''!@`@ 5 X"@`'!  !@$< , r, @'''!<"@`'@  Ȗ8#c '%a\'''''l!" @l @X!a<@   !@a  x  ` `e#ؠ$@;@A@$0$@2a   @? @$ $@6 !" !<$@! @$@@#  @$$!  @,!  @   @s    @i    !a< @~!$, @% ,!@ے` $ %!@,$ T  ;!@ !@$< , , @'''"@`'!@"@ $ !@$< , , @'''"@`'!@"@ v $`!@`㿘a\ !`"a\Ő "a`! {! }@  ֐ ` 㿘 Z!@h ǐ  & @ @& 㿘a\  !`&!\ؒ ,"a`!!  &!\  @֐ @=  & &  㿘a\  !`$\i  "a`! {!  }@     @`2$`& \ `$\G $` 㿈!!@ @` @'''@ !\`!`$a\"  "a`( $a\%!Ò  @$< , , @'''<" 'a\`!`$a\ %!`|ݐ! $a\ @$< , , @'''"@`'@"@p &   ) a\` & $a\ɐ %!`0!`!k 㿘@ JL #!p *a`=`J 2 @[  ؀`& 6 `&  {?  "a\a@ ` ^2` /& @@ a@& `  a@"`   ` :"  @* `* `* `"a@`  "`  "@ "  a@` ?2`㿈!!@ @ђ` @'''a\  !`$a\9  "a`;: 8$a\% !@$< , , @'''<"@`'a\ `$a\ $`߀ ;@W " :  !@ `  , !@ ,   '''"@`'!@"@ y㿘@" " " 㿘` @  `  T` "`@@ѐ@k" `"T`" `@ 2T`㿐 "H!`"a\퀢"a<"!T!T X" "h  a< @ @ "@R` 2`@  // "ݻTT"" "T " T T 㿘!@ ƒ`22 " " " " " " 㿘`0" ؘT"4"T# !P㿘J ǀ`* :   a)   b@9\ "  e rb@9R  r tb@9I  t2 @9@b؀   2 8   "  "  㿘!\` $!\` @ Aϰ "a`!`   J#؀ @ ``H`D `Aa<9 `7(3) (`!<` ` # #(!@ @֒` ؐJ  !< a<c@8`? .`,$!\2 `!@.` @``@`*``a@$< , ~`, "``"`@"``@" "@㿘!\`  $!\8 @"a`!`!"$!\$  @`* `a@$< , ~ , "` " @"` a<" "1 ""8 㿘` & `@ " !"` ?#a\ .` "<DJ@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` ~LV  @*``@$.`6 @^5 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 ~@@ב*`~9㿘T  ?%  * @ @N N@@2   @7 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@7 .2T* `2L`T TX*`T@R } $@$`$`$`$`@Rw`4$"R`"`"      㿘 @7.`㿘T` @ `}_* T``  "@ 2`T` &"@< , &㿘!#0c8#p ` $ " """   h h#p  T tH!ap 4#"c$$ "`"` ap`@"$ T$ t$!$ 4$" $@ @ @ ` @! @ݔ 㿘#p!"!Ԑ!a@Д )㿘@# "bL  @S  $bL"a 0@S@"㿐 ap* @L D A 4@ 1* #p;#p %  /`@ ,@Q #P @ɔ  2 @  @6Q @Q P @(^  2  @6@  ΰ  㿘. #p@@ $   @"!"! "   2 "!"a  `@@f"㿘! `@4"@p  "  @   p  " " H2 @  㿘 "L   cX"LU "L"! @"! ""!#p      "  2@ 㿘  & 2L " @ "#  ) "#  " !  & ~&  a! #$#Ѐ  !{ߒ` &  & 㿘"!"a "!cp  $  "   J@ 㿘#p  2 ` 0 @i< 㿘 !{  峐 & a` & N@ #    "@& 2 # J ` π&   &  &  @( 㿘! `    @   `  @    @  㿘 ! @ 㿈< ";     ad@Wϔ 耢 `` & &     J ` @ "&  & #  '& ''@W  㿘  2  cx   ` π` & ` `  0 `  &  &  0 L \ @ @ \ d  D  H h  < t 4  t  p p p p p p p p p p p p p p p p p p  p p p T  p p p p p p p p p p p p p p  p p p p p p p p p p p p p p p  t          ( (     0        㿘 ?* : `l"*` €   #@c  2 @   K#@c  2@   @`3   А@| *:  ##  @j @c @\  @ # , @`@O  , `2 Ȕ @?V 2    @5 ` %)(@*   #@ c  20@ 8@ @ H@  `'-`+)@X` "` `  )  |@  2 `@`h```x @ג`! 0@ϐ @ɒ`    0@ @` `R@ ߀` 0@ @`' *:  `   @В@ ؒ`@ @ `@@|'   V  !!  @e  @]  @V `6@   @@0`@ 2@ @  '@   `    + M @(( @ 2@ː 㿘 `       4`  @ @ `  @ `0漣?`."*` €0` "8@H`@" P X``h@В p@ɒ 2  @0 !!x#@㿘 `    ^ $O  @K0 2   ^ $A> ?0;㿘 %N  , @€NҰ NN`   " ` $ \N $ (N`&* : N  ) $ ( (N` * : N  ) )  + " ( "ؐ $N`{  {ђN  sN  NN }   }N  ( | )~N㿘'P'T'X@P h'P'T'X   B @Py`N% Nŀ`:~#@*` €wzL s *`j:  L  iN(bdd 2 `2 : `? -,L K *`B:  L  AN9! ;  ;+ (+ #`  ?  $N ?  N@  Nr㿘 i v 4 4V  @^$ޒ$ ` $  $ ? v$  " $@@@$@  `$@  $   $ ? ve$  " $@@$@  `$@ " @Ȓ$ $  $ $ $㿘@  "v6@K㿘 #N + * `,@€N  N N  N`  ?N  N?@? ` 2Nՠ?N?a" NhȠ   꾔 B#N  * `\@€[N) N$ $ (*  : N`? ) $ ( (*  : N` )' ) $N`{  {N  N  NN }   }Nݰ  ( | )֒N㿘  & ?u}  `- us $@$`$ `$ ` $ `$ ` "` %$ ` "`$ ` "ߛ$  ب - &㿘 7  " up  " uh   u`  " uX   uP " @  ϒ ̒uA㿘  " u6 " u0  "u*u'  㿘 "#H  @Tf?$H#!$c @? 6 @$c@$a @4    @4   a 01 @\D  $H@@$b  @\3   @@$b({ @TH?$HH@3c@T 㿘! "#H @T?$#H  l H  l l l l l l l l T l l l l l l l l l l l l l l l l l 8 ' (T ( ( ( ' (8 ( ( ( ( ( ( ( (p ( ) + )@ * * * * * *, *X *< *h )d +< )x +h + , ,p ,x ,X ,d ,p ,p ,x ,x ,x ,x ,x ,x ,p ,4 ,p㿘!!@ Pt*`t$` !@` "X$`$` $```$`` $`D$`H` @`$`L"`㿘!@```L"`T`?,` `@!"?@`@ @ ?@| ?<` `("!P`,!P" `0" `4" `8" `<" `@" s@s`㿘`!d "\`  @@ڐa"`@`" 㿐&@@ @1L@ [-@ ( &@3a@` a@s`a@$@ڔ | 􀢧(&#6a@s`㿐!!@`L@ `!p*` h!@ "!@# "ᨠᨐ $ $ ,  $ @ + `+ ` @+` + * :`  ?Ѐ@4 +`@- $[$"L``U߀` "#\*` € E$  @$  #:$ 7$  =$1$ - =@*   0L 2`@`@=$ !$㿐!!@ K !p*`  !@$" $ ;$ Ӕ`#    L   " L" @ $""$ $  @K`@$ !$㿘! @  "T"8 M # a  & `" ?.@c ?.@R `  #?. @ ?` . @R ?.@ 0 0? -.0@@@㿐@ ?2Ð (㿘$`"`8 ϐ L  ""8"5 " @ @G6 @@ `P   r &  ?` &@@ @ & ` &  2   !&@| 㿘"2& !@""ᨔ"`"`  !"`  !&@[㿘! @ v `"z?" &@t @2  ""8    `0*`L  *` L x X     *`: N  & ap-#A : 7 $4?? 4 * `,  ` `  ` `   ` ɴ? 6? @Nǒ ?L 2 &@㿐r2 b  & q  `& & "!&@㿐@F'0@ "$!@ `p0@[ @3@ "@(#@K? &`   ` 2#@@ #@ @ @@ @ap* @ x #\" "8衐, N@? @ &`   ` 2`@ 02`N@ 0"``| `@E>@$N D & %J `@ `  ` + :  `|*  R *J 2J0%@#N  & %J `@ `  ` + :  cx*  R *J 2J㿘    @E]@EZ  &o@& @Dؔ =,  $& @D͔  p㿘@P " L [ =@ݐ  @  6 !p * @` &  L = !@$ @  J ɀ`c@)f `@)` `@)Z h Rh6` ` .@ @$ 2 8 8+!@o`@y  p/   b@ b"2   bb " ɐ      ?$"2` ?$$ `* $ p$ p@2$ "   `"  ? " o. $  ?$`"  o$  2 ""8""   4& ڔ  b    ` "  "8㿘 " n @` `"&  ` n n `& `! @ a&!@'㿘 ap* `  N* `2 ` [@} 2J1 p(*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈!!@!n`!'''!@ PT? H? ?  ; L   " L@ ?"@ L " t  y& @$< , m, @''' " ' 6L2T @$< , mǔ, @'''"@`'@"@ m㿘 "#L`@J㿘 !Ȓ  @ 2`㿘!{ 㿘ߐ ?`F#ؓ*` € ~`9&@V aԒ" 1 "cL >&@I?* !@DY?* H >& >&T `,ؐ >& !&( ?` *` €# c !mI \ $c. 0 L """P ~&wp\   0#`܀ m#`$`L /}@S5  x@ȫ s<  m`h$` ~&*ZdY#8`TO8! " J$"T G$"TB7>^ ~&)!4& ~&@I  " &"L ~@&$"!" `&  "# ~k&`," ?"ؒa&㿘Ԑ ?`/ X*` €! # 1l `d֞ $#p 0 (  " "bP1 ܀ lt` & Ɛ 0 0 㿘@A` @ @`$@0$`  "` & " ` 2` `l `@% @ ~$`$ `$ `$ $ $$ J@ `]"?["J  ][["  㿘 [@%t !@"@)㿘_$` 8        4 7 7 7 8 < < < 6 9 9 B Bl Bl Bl Bl B, BX Bl Bl BD A| Bl Bl A| Bl Bl Bl Bl Bl Bl Bl Bl Bl Bl B Bl Bl A T TL Th Th T, Th Th D| Th J Th K Th D| Th Th Th Th Th T` Th Th T8 Th Th Th Th Th Th Th S Th Th Th Th Th Th T` J Th K Th N Th Th Th Th Th Th Th Th Th Th Th Th Th T Th N D F4 Th I I Th Th J Th J Th Th Th Th N Th I Th K Fx Th Np Th Th M F Th Th TL Th Th Op Th E Th F F Th Th J Th Jp J K Th Th N Th H| Th KH L( Th NT L Th M| F Th Th Th Th R V Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( V Y( Y( Y( X, XL Y( Y( Y( Y( Y( Y( U Y( Y( Y( V Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( U Y( Y( Y( Y( Y( Y( U$ Y( Y( U U Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( Y( U Y( Y( WT Y( Y( Y( Y( Y( Y( W Y( Y( Y( T Y( Y( UT U Y( V Y( Y( Y( V Y( Y( Y( Y( Y( Y( Y( U Y( Y( W Y( Y( Y( Y( X㿘h(@ΐ@ڐ %    $ `$@n?5 "( "` `2`@y`     ҩ   "<` @ ?@( Y[ Y Q?!"<` @ 8`?@"<@B&"<  ."< "  㿘 "`  "*` €! "+  $b ^@ "b ?bဢ 9b݀ @X$b  ""< @ '"b@ "@ b  ?π #""?В "$b!*  #"@0 $b@ "< /"` "`!`!h @ Ĕ ?@  b  @!"<"` "`@? Ē @  0   "<`@ ے @b<*@ "@ ʐ n$b? &`   ` ` *` * ?Y"!* `Q"?π "?В "$b"* J` l#"   6 4$b? &`   ` ` *` * ?"!""$""@F $""* J` 8#"    @$b$b $b!* ` "$b   @c "T  J"h`  @Z/$ba *@ "h@" ( $bb耦b耦 2 Ta @  @"Tb< "@"" @  0@/$b@  b2 "< "bT "" E  "T' ?!J ?   &`   ` 2  & a耦 ?K `  ` " T? !@ @<? "@" <$T  @ " T'@ְ 0!"T* 'J Ѐ`<  `@ <@< M  - * <`"  *@ "  <<  `@ <@< ^  @* <`"  *@ "   @ <@<  * `" <  @ ^"c b    W 0X  0Ub$b@a "   ?5 0G? ? 0B"` ""P @ 4@ 9 "$b # $bdbd! @l"` " ߀   0%"`L"``s`c`C @Ԑ   @2@bd @+@    @   @!$b 㿘 ""?# bP         #""b#b#"L H@$bP@?    .       㿘 "耦 "耦 2< "` "<b@` @ ɰ 0"P ?#"P"` &` ?"  * "<`` P ?"P` `?#   #`@?=#`  "2!"<  "bP" @?, "<` `" "` "`$ "<`@ , "<   "  @?"<  "@P" " "P# "P"<~" bH   ""L C "ؓ.  €o H "`"#l P "H "L "P  a  *`"d J"` s c C  bd?@I@  E b<@ ϒ ? J р`! @  5 !"<  ?@ +?P"H* # b`"P  ` "  @>"<`  "` "<*@b  ""<` ` "`  ""#l 㿘  %@  @@" @  @ @I }"< 2<8"  2@ "`2@!"<#b@"@` @>I"<   b@"`# # #bd@>< @?* : `y #H*` €@ O  `! "#p, 繐 %N` 3?  " JN`@" @ J @;_ ⨒⨀ ``""@  )e  @:֔`,@⨀`  @@:̔f ,@ ,@ $" "  "< b   ""`"  #  "" "   """b @ "< ` "`~"ap @ b< @" !xN@N``c ap @u "<K`  ` `@f  &a?N@ c.'N` w W)<"<``J ? &`   ` <"< &`K ?   ` 2<    N` %  N@ c@@_N@ y@|<" N@ c   b< "  ""b   % # bXX@& <? bX<` "? #` "   ""b % # bXX@   ? 4  "<` ?"`  ǰ? "< b    ""!"< @"< @"<` ?"`  "    `""! ?"@V  ""$" "    """bv#" "   """ap @} b< "d"! "# b@.@ "$bW$"! "# b@!"@ "$b"J$""< ` "   ""bN` 2 @ 6  4B?  <"<  @ `* <`? "` "     #""""< `V   "  ""@ "⠰#@  @t """< ` "? !< "`<`  `*  `< "` <`   " ?"< !!  < @9Q $ !"<    "  @"⠀"b  @"<`@ !"<   "   ""b  @#"<`@""<`""`<"@""@"<# b ! @I" " ""r$b  "─@  ?" ""TN@ ""#h  "#h  ?N@`?`N% `?'  └@Wh   Z?@@ 0T""$@$<? &L?4 dJ   & *`: ?   ` 2J  J  J ; ?8 &  J  ?   `   `* : ?   ` 2J  J * J  ?2J$ '   * " L '    " & J?   ` 2  J  "  J 逢?<   b ┐ " &  J  ?   `  @ @ǔ 2 ?@  ?   <` ?#` p"b"< ` g% &#    ) %' %b<  J@ @ @ `  ` $b#H  |* H `@ `  ` $b#H x*  R (b<` `??"`b<# !"< {L *"<(" b<@U  J J Ҁ`"?@  @   "` "<` @" 㿘@?* :  `t  !0*` €"<`?@ "<`?@  b<   ?@Q  b<   ?@+ "<` &հ 0N@ ""#dN` ""\ "#d ǀ f Fcd cd a  N@ , `?b\ @   2 0'< `?<`   '<  `@ 6?< `  4 0 b<   |?@ x b<   n?@A j"<  ? b &  J?   ` S  OJ"< ` 4 2C?0A"<` < :"<` <` <`@_J@ < $  ` < ` <?? < @GJ@`"`耤``4 0?㿘 ?! %# "H` bP@`? ? ?"<` ?"`$" 㿘&@ ` ""X"< "X@@8Ӕ ["  { ( ) 0"  } ]  0   0 ???㿘#bNؠ Ē⸐ @ s".ؐ %""@㿘 " + "@s @  ".$bN@sy`" @$"#$b$bsk b?@&b$b "" @  $bN@sW`" @$"$b㿀  )! "#l  "" b< %"\$#l" "%""<#\#``` ` v̚줒 <@b?0Aj  " %""l9<"`5 / + -  3 @  ""@  2?@,`@@0:x@H `?"  " `<`"`b %%&&bd 㿀 )! "#l  "  @  $#l " ! "#l  " "  b<   %" $#l `'%" `  "<#`#\ ``` vF覒 `@ܰ?0G@@԰?svԐ 0s ',`@ v @+9 7 / 5 -  . @v˒ @   ,`@+9 7 / 5 - @/ @vn+  " "l`?9 7 / 5 - b<%" ^aHb<"w} 2`  " "#lJ?`/  ""@  vg✒ &&'"%d3 㿀  #\  #`u蠒  s( vH 0@<?   HЀ     ` 㿘J Ѐ`  q!ذ   qԐ ^ @qѐ㿘 !  "  "e 㿘@q q㿘! "  "`YŒ`$"$`$`㿘@  %!'#!%+ $-/ i  $#$cȐ $c$#@@nL? fc\* & @ @@ . @%?@  <   $`@`@Y@@?@$#@a@? @.M / /-`?< @ /@ 2L ?`? ` L /"?* L /2? @.^ #@@\ǐ  @0@  2  Ȳ@o %!X '@K ϐ"#Ȁ`y@?% s#Ѐ` @?   %"ؒb @."0`#̀`)@?  $@~Ȁ 2  @J8@E @Eʒ OA 9"P"X %"ؒb0@-#\` `/ % b(`? "`@ѐ (  $( `  %"( ? $ @(  $(` 2 `y`Y2g @3 _ @q`"`@S `<  H@ @\"p? @H<H  @ @["/ @JĒȀ `<   @5\  `@Ɛ "@D !`<  @@Ԓ! @"㿈 @"   "&@"! 6 "@@7Z @p "@ @h sc )H @)$  %#@  "@0+@\vcĐ@l #"@֒@O "@Β@7@7f @7"@", "@ 3 &#Ȁ`2#@@ #@@"L@ " @z`-L #(@ #$@7J''(#,@7D''@3c耢 #8@w@6 " @  "@d 㿐'D@'H 2!DHcPX @#H"@M#H@ @Y ? #`@AcHG  #p@Z͒cH> :  #4cH@ 2!DcPȘ @#"@#@ @( ? #`@c  #p@Zc  :   #c@Z 㿘! # % c@,b b@,c@6 㿘@ǔ  4 4 4 4 4 4 4 4 H  4 4 4 4 4 4 4 4 X 4 㿘@(X  2"  @Z, "㿘@(K   @ &  @Z  &㿘 @(d @(b2   ."@, J-`?` J  &*8  + J (J? `2 "@ 㿐  ’ 2  @( $$ 㿐  `@#y? @Y  & &㿘 2  `?J@   ɐ "   㿘c   8"c܀ ."cL`*L   = @p "#"#L  `<" `>`! 0 0  "cܐ  "cܐ  "c. "c"܁㿘`0@; 㿘!#܀   # @#܀  0` %a 'cܪ M) VT`@Z "  @4! @@;  @И  Ѐ  *@ "     HƐĐ@eѐc܀  @" P㿘#//    `X@;_ 2` @2`& ` `p@;Q @4 & @ & ܀ Ҁ Ѐ 㿘#     `X@;!  ` `" & Q܀ ဤ 㿐Ң cܦ sĐ D -? (?` X "ؓ*` € -@@J H @D B  /@1 3 `^?` - "*` €  @/! $! 0 @/82  @/2   @/ 4 0  @/`? @/@ ֐Ԑܰ      㿘wcܢ ; m    c܀ 㿘cܢ   c܀ 㿘`H@^ `"# #܀`"@. `@ 0`@ Đ@I㿘@h   `N" 0 @@h`M`>䀤<  & ?'Ȑ ̖Ș @++ `@W2 ` @%T'̠ `@9ِ  @(̐ 0''Ȑ Ș @+  `@W @(O  쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @b Oـ  %"`Oؔ?"`` "*  #"@W !@n`@ ` %`?"`‒ * "@Wߐ  㿘   %a@(a"@Ɂ 㿘@㾐 %! '#' $) @6@gȔa8? s\* & @ @'@ " @(,@@ a@@Vn @! aP@Ve  !`@ Y . 2*!`@@6 㿘   %ap@( "@, 㿘 I@ 8@ @֒o@  "?$" " " " " "  ` %!'! @5 )   @M  2@} @z!@X >Ԓ?@P@W"!, @!,!,O@1Ӑ @F!㹈 %!'@ 耢  `n#@l < @ @ `0#$@V/@'{   $@Ⱦ@'n? @@@'g? a ,@`;#(@UΒQ @ !X@``@'M?,@ X`#@3 #@, e`e@  `#@@@1O @1K. :`@ z` `#`@U   #!|*` J@    @ȧ#㿘@`a@ ??@hD @hA @h>  $ @1 㿐2&@? "##@  / @.!`@A5 a#\㸐$@ # @ &@n ?"`"? @e`5㸘@$# @ &@K ?"㿈   ?'  @( ?㿈c@9#Ȫ ~ c@%- @  # 2,L@ S# @q Jc@Д  " @c L 0c@i ` a   @K `  c @x@   `@$ `@) @n J *@"j 쀥 @"@ 㻐 %!'@%c( @ ?":`  0@ B #@/ @``8Ȑ @@; O %@x`H`P@%7,@  `hȖ@ 0 %;9 ?-!+@ ` @  ,@&$# @@"  c@Ԗ0@} ޠ @ %! @  㿘N      - ) & *`: ?   ` "N N  (*`:  - +s? 2Np  N -"* +*:  G D & *`: ?   ` *.4:  .`M $ ?Ѐ`5`- @-`B2*@ *@B `5-@-B2*@ *@B  N   8@ @~ N #o>@s @}o @yk @ug  #!b  K@  ` %#x*`@ R` 2O N  ? &`   ` , @@< #?@ @  @  @`    @{    E>  (K@@ ""?㿐    2`` #"@3` + @0;   #4  #@? """ #aئ ? @3` + @; ,2& !, @@   @ @ `ʨ 4`,  ,`@B2`*  *`bC eC (0  8  `   &`F F?   `@ 9  4 ?`c ?! # ! 4 2  #` &`F F? #!J@ْ  !J#`#\@˒   %!'  @Д "@>P  @R@R @R!@@RÔ!,!,@ )@-v @ Ё㿈   ?'  @%t ?   @* J@ " 㿐'D'H    -'N] `.`?: -@L2 Ǖ< 2 $ '    ?L@ "'`.`: L@@  @:  ?'  ``@ 2@[u @"@ .`   &D@  Y-: U R@ܒ NHN D..`  L   <,@ L`  2,@L "),@L  $>   < "; "   2 "  ,@ `  ,@L Ȣ`,@@"KH 2" %!p'@"# @!  2L `耢 /$@!! @!! 'J   @^$#($@ @V$ $@*@M$$@O` J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @ .?'l@Yl l l@ $@, : ?L 2,? l  l%c ?@E??  @<!H㿐c@ ?㿘c :@@ 㿈 c///@찒  $@@@ @&@  t t t t t t t t t t ( t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t x㿘# 1!P* (N%Nۀ`M +!*` €``,`` !`c (ސ@+ d 0,@r d`(Р @+{  0, (Ɛ@_  0, "\ZN@ N R@P N @``` ! ` ()'! `"X @= `` 񀥠 (:1,¬ `` (:w1,@+ * @  `` ?$@* $@Nf $ @$(@:T1㿘 z N?  &`   `  & N,  N*  ?А   ` , ."*  N? &`   `  &N?Р & N?   ` 2 N * @(w *` ƀ: N  `* 2  * #"8: *`2`:`@: @* 1N ƀ? N 㿈?@4 !? #bX @j 聠"#a` @< !"# 聠"#P? '?''   DD"# !8    "#m  ƅā"#\: 'Ԁ 7 Ԓ?'2` @'* ''  * '̒ 'Ԑ`̐" 'Ԑ ̐" 2@@'̑* 'Ԓ<'  'Ԑ `  2 @ @' 'ԓ: ' 2 @ @' ''''''Ȁ )Ȑ ' Ȑ 'А" 'Ȑ ' 2 @ @' 'ȓ2 ''Ȁ SȐ ''  1 *Ȑ ' 䀢   ܒ 'А" 'Ā ?'Đ" 'Ȑ ' 2 @ @' 'ȓ2 ' =ahp@?ah-ahp@D??'ؒ 'ah?ؒ ' ' `@'ؑ:` '2 'ؐ `  'ԑ*`@'''?聠"#  ` 8  0 @  0 @ P ` ҈ Ә ԰  ۠ l (  P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P  ` 8  0 @  0 @ P ` ҈ Ә ԰  ۠ l (  䐝h??'T %b@??T  *`.  'T caa'ax? #bX`@ !"Ȑ @ !  #bX`  @L@ !"  'T caa'ax? #bX`@ !"Ȑ @   #bX`  @Lo@ !" ??ؐ 'T caa'ax? #bX`@ !"Ȑ @   #bX`  @L5@ !" j 'T cab' #bX`a8? %a? #bX`@\ "" Ȑ @ o @O "" 4 'T cbb' #bX`a8? %a? #bX`@& "" Ȑ @ 9 @ "" 'T cbb ' #bX`a8? %a? #bX`@ "" Ȑ @  @ "" 'T cbb 'ax? #bX`@ "" Ȑ @ @ "" 'T cb(b0' #bX`a@? %a#? #bX`@ !"Ȑ @  #bX` 8 @K%@u !"Z 'T cb(b0' #bX`a@? %a#? #bX`@J !"Ȑ @]  #bX` 8 @J@1 !" 'T cbPbX' #bX`a@? %a#? #bX`@ !"Ȑ @  #bX` ` @J@ !" 'T cbPbX' #bX`a@? %a#? #bX`@ !"Ȑ @  #bX` ` @JY@ !" 'T cbxb' #bX`a@? %a#? #bX`@~ !"Ȑ @  #bX`  @J@e !"J 'T cbxb' #bX`a@? %a#? #bX`@: !"Ȑ @M  #bX`  @I@! !" 'T cbb' #bX`a8? %a? #bX`@ "" Ȑ @  @ "" 'T cbb' #bX`a8? %a? #bX`@ !"Ȑ @  #bX`  @IY@ !" 'T cbb' #bX`a@? %a#? #bX`@~ ""Ȑ @  #bX` ؔ @I@e !"J 'T cbb' #bX`a@? %a#? #bX`@: !"Ȑ @M  #bX`  @H@! !" 'T ccc' #bX`a@? %a#? #bX`@ ""Ȑ @   #bX`  @H@ !" 'T ccc' #bX`a@? %a#? #bX`@ !"Ȑ @  #bX` 0 @HI@ !"~ 'T ccHcP'ax? #bX`aH?Ȑ @   X @H@i !"N 'T ccHcP' #bX`$a8?aPD?ax@l !聨Da@?$ %a?aPD?ax@J !聨D %a#? #bX`@ "" Ȑ @ @~ "" 'T ccHcP'ax? #bX`@~ "" Ȑ @ @~ "" 'T ccHcP' #bX`ax? %a#? #bX`@~ !"Ȑ @  #bX` p @G;@~ !"p 'T ccHcP' #bX`ax? axx@? #bX`@~^ !"Ȑ @q  #bX`  @F@~E !"* 'T ccc' #bX`ax!8@? %aax  ? #bX`@~ "" Ȑ @ @} "" 'T ccc' #bX`ax? axx@? #bX`@} !"Ȑ @  #bX` ؔ @Fc@} !" 'T ccc' #bX`? axx@? #bX`@} !"Ȑ @  #bX`  @F@}o !"T 'T c``('axx@? #bX`@}N !"Ȑ @a  #bX` 8 @E@}5 !" 'T c`X``'axx@? #bX`@} !"Ȑ @'  #bX` h @E@| !" 'T c``'axx@? #bX`@| !"Ȑ @  #bX`  @Eq@| !" 'T c``'ax? #bX`@| !"Ȑ @  #bX`  @E9@| !"n 'T c``' %aax  ? #bX`@|c "" Ȑ @v @|V ""; 'T c``'!x@/ !? #bX`@|4 "" Ȑ @G @|' ""  'T c``'ax? #bX`@|  ""Ȑ @  #bX`  ̔ @D  @D@{ "" 'T cb(b0'ax? #bX`@{ ""Ȑ @  #bX`  ̔ @Dg  @Da@{ "" 'T c``'ax? #bX`@{ ""Ȑ @  #bX`  ̔ @D,  @D&@{v ""[ 'T cbPbX'ax? #bX`@{Y ""Ȑ @l  #bX`  ̔ @C  @C@{; ""  'T caa'ax? #bX`@{ ""Ȑ @1  #bX`  ̔ @C  @C@{ "" 'T cbxb'ax? #bX`@z ""Ȑ @  #bX`  ̔ @C{  @Cu@z "" 'T caa' #bX`a8? %a? #bX`@z "" Ȑ @ @z ""t 'T caa' #bX`a8? %a? #bX`@zf !"Ȑ @y  #bX`   @B@zM !"2 'T ccHcP'? #bX  #bX`aH? Ȑ @= @z !""#x???'?'?  @  '?"#㿐'D'DD `D `??'':` ':` '|'耢 耢 d ܐ "# ܐ@'? 'ܐ ܐ 2  @ @'?'?aX * $%D?aX * &'??'? * '?ȁ"#0c: ' ܐ "#~2 ' ܐ 耢 ' 8  :@  '=耢 3耢$ D"#Q"#J%?2@' "#82 '  8 ܐ :  '''?aX * $%D?aX * &'ā"# 2@ : :*:       @    㿘    b`  ?   b`  8  R  @ $D` @  $$`@ $:`  @  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  !h3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         b`㿐?h  @  ?@ `㿐?"p  Z "x B"7ąB' B'@    ɖ @> . 6`  `6 @3 @򅠈?"p $%"7ąB' B'@@ f "  D'…B'@@ F #dd#dd` B BBD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @h  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  "4@   "  d`]4 6 6 ,@ ,  @  "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d , 6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@㿘  R  @ $D` @  $$`@ $:`  @F  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  #3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .      $6 KcЁ@$ KcЁ@$ KcЁ@㿘` ` 2 `@h "`@t? "?` &``@ , :   @ * &@@=㿘 L@  . 8!* 8@ @J /"J /2 L@ /`8 . /*`8 *"J /"" # 1 8@ Y.@t  ?"` " (0 (`0" " #`@"    `  0 "! H P """  """㿠   @" &  g @㿘` @< x  ??''쀢'@t3 " ?  *@ @  '@Ԕ؀ ?؁㿘@>@  $>>2   *` 㿘 )  & `&  &@ , 㿘   2?2?    `*`,  @  ` `* ,  &?   2 ?`2? ?   2 ?  2? .2 ? 2 2 . `0 *`    2?  2 ? .`2   ?$ x l ` T H < 1?(+ ( % " ! !P!p!!! ! ""("@"`㿐  ?  @ ?? % KcЁ@  $ $ $ $ $ $ t \  ,   D $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ Ԁ` ``*`?`[`#?? & 2&+` `  `  `  `? &  +`\ @ +G` E@T*` \+  n+ \+  r}+ \+  bw+ \+  aq+ \+  vk+ \+  te+ \+  f_+ \+  sY+ \+ Є 0+P + K+ ` 2 ``*`?`[`#@ ` \+0  00+ 0+ ` 0(+@` \+  M+  `? &    ^+`  ? +`@+ -+ +  +㿘@N@:`@*``2`"*㿐N@ nl) & *?[# @  ` 2%.    #    @  ` "`. \  @2`*.?  `` N@"@ @ eN@ 2.(&N@"&` N@N@"&㿘 N@`zN@8N@N@p "*$ KcЁ@㻈 %!+`<'573/88@]$ @bx b#"@`<%`< )J #8@ & @ & @Вb 8 ␐ @& ""&  @n찒 @Ŕ 耢J `#@ <$  @V찒 @ͭ 耢J `@ $ 0 b@=`< %``# ! % %"@}c@ `#"@m/c`@@q`  @ @N6?@`@j` f`@?` c@5 '@!'@ 4`* @ ^ @ o @y@) @5@" @ @l@ %"@c0<@ʒ6 *   +6`*`% `+ @l%"@   @  : @l`  %@l@z %"@c0"@ߒ`@ @z @l@` %"@ʒ`H@'   #\  @n  @^ @ΐ@ʐɀ '@  #\  @P    %@@# %@;!  %"@``E@|LL @4@v @4ߐ@p @4ِ@Ҕ  "O@l"@D %@"@`` @   @4 O`   @x @ސ % @^@@ѐ@W @c ? %! @Đ p  ? ???'`'ܔ@Ԁ ?0@ 0Ԁ   @,   2 @?㿀! %!  ?  ?'//' @ ! @y   %!'   @ƒ` `@ @NY @J`2T? #"\`"M?@+L G $@@Du@`@_@ `1@!͒  " <  !T`@* !(` @!@ !X " @? @!㿀! %!  ?  ?'//'@  ! @ې!㾈! %!'@!?쀢`# =` ;` 9` 8 & %J? `  J   + : ` `@ `   + :  x*  R  * J   р?ȐJ  7 *  J " "  J    & J?  J     J   퀢?*J  @ L + -L   @ 56 @Ғ -   @1m& L   @ ?@    @1Q @T @OL@ + -L`  @`0 # ` @15L`  @ `` @1& @瞐  ?@痐`?  ?  4  @Ă 2L? @!` %! '#\ /! @ 2;    ?ؐ ???''Ԑ`'̔@ϖ̀  &a@! ̀  /  !#\ @ 2  @5   2/@̰ a @Z!` %! a`'#\*a` /! @` 2S  #\ ! @S 2F    ??ؘ ??''А`''̔@h̀  0@g+`̀ ̲ /  !#\ @& 2  @Β   2/ "`a@Ȫ @=̰  @!㻐 %!\' ! @    @  *`@ а? @" ɰ?  7`4` @  .``2 "("0@H @ " @ @H .`82"@@@ s@6   0: < @ 8 22``2`*`        ?#@2` 2`  2`   `? ? `MK``2H? 2@>" =?@ !@ @Hw@ ``@@ (@ ?@Ô "?  @   a@ ? a @"@㼐 %!' @" (?@?`@@儔 `@!   ? @ %@.*`  @"P㿘 ? ?  ? ? 􀦠  @J " @ 8@?  ?㿘 @E@f 2 `"   @@    @^&㿘!Ք"`  "`㿐@    􀢠 `" ` 2`22  @ @K@gN"h`'X"h'X@'(   %"ؒbx@? @b  @F%  2 @F  2@ڰ?0&   @ g "@ "@z?0@ q@A  @A  @g" @ @^"y u @/  "@f@ں  %"@#cc @䄒b !X@~ X J@ 2'X#0'XX@ot / "X`'c8'X''@j0Y@8  X@o^ / "X`'c@'X''''@i0@X#`@ 2@ŒX'X@A.X ` cP@#H  "cP&cP@j 2J@@'X@@o! / "`'@#@&&&X&&@i@f[@1 %X"@cXڐ @ @? x؀ N  @~'$ ` ''@`Ē@q$$    $:$$     ( @x* 㿘? @g 㿘@ 㾐 %!'@!`` 0 /@e? .+",  @. 6!?4@c44@ @g @e`0 4@, @4?2@@ +?$ @ X㿈 ''@  ($΄ KcЁ@㿘@e" @ ?2 @e`2?  @f ? ? 4 ?㿘 %"@$= KcЁ@$i KcЁ@㿘 @g" @eY? "$: KcЁ@$) KcЁ@x" '" "  @؀ ?  '?ch?#ض  @v ޺ ?@ ?# @!?3?a/?#?  ?# !?#?󀢡?#?  ?# ! ??󀢡 ?#? ?#  ̀??  ? ?# ! ?#?  ?#  ?U#؀Q??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    L # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ??  ?# ! ?#?  ?#  ?T#؀P??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    K # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ# @ ?`?D '#\   @2@  x?@c@? "@ a` , 4 $    "?J 2, ?:#@ :E4&@ @? ?`)` ` % _ J _"@ఐ 2 `?$  ` , `4  ` ,  "J 2L Т` 8@- `?@0#@+sSF ӄF @   "  ?b %!' 4 @ 4    i ΐ d?cH @ ]@6آ   #\   @?@* F ؐ @ 06*` *      @ `( ( @* @*  @   @@?#\  @X??@ ,`4`$`` @  `J 2,``z0d %`@?`W@ "SL "O @ߥ " L _2;`  @ߛ 25` $` ``"!  ``  ?#@ " #`   ,`@ ,`,`  ,` 2  ? ,`4`  ,`` @ "L  8?#  @" @s %@*5 %! @i h㿘 #"`?  , @€? 㿘  ?@ΐ㿘@ $S KcЁ@㿐`wF ?㿀@' ''''`0   `a ?"a@㿈' `1 `#\ `"px@ "p㿘  0 @ @2@a  /"x %!   '#\@  @`  "@ua @ 0 %!  '????  4 :`*`$*`#@ * * # ?''  ?,` ?'' ' ?@$'''', ?@''? ?'P ?# :/ @ 2: :[ ,2 :R ,, ,  , , @$ 8 @~@$@Ĕ਀ $6)   @    @ :,   ",@` " @ݘ! @ $ KcЁ@㿘 N  ."*" /*@)J /"  J/"*" *`@" J /2"  #1"@.@_  ?"㿘q@abm `9 1 *$㿘 #"h # h㿀'@K ?''@耢 @#&$" KcЁ@$j KcЁ@$' KcЁ@$+ KcЁ@㿀! # *` *  *    *     #\ #`  "#h#d#l@ސ"p"p$. KcЁ@㿈'H'L'P'T'X H  !"@Ò('& "("@ @( !  "@(!"  #   ?'  @  $"" #b "" $7 KcЁ@$8 KcЁ@$  KcЁ@$ KcЁ@$ KcЁ@$ KcЁ@㿘@ . "``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ *㿐`2&@2&'5+L@ 1" @5  2  `@* 2  `@ &@  & ڤ   @boc袒 2&  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@$ KcЁ@p#'#' ' " ''''@]''@]"    @8: @ |԰  J  ,  `@]`" 4 @# # @]`" 4 `@` `/ '@@]@ "  $„ KcЁ@㿐@] _ L [@E Q" J``MJ  1`M*`k`G`K`(# H H`m`g H H 0 ! 8% $ @$! H@$"% @ `@$  ! @$`""!"@  &&  &&@"$Ä KcЁ@$ KcЁ@$u KcЁ@㿘"`   @   $b"` %@  $b8 $"5 b* @*`@*`@"*` ' "b@b * @*`@*`@*` @$" $"@  $b*` *  *  "* @&b$ KcЁ@$b KcЁ@$ KcЁ@$ KcЁ@$ KcЁ@X %!>' 2 #@: 2%"! "  ` @  2` "`@ `@ 2@ 2@ @a @3 㿘 #" "  @  2 (@ǐ1 $9 KcЁ@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" 㿘@@ @s @㿘c   @ %= %c@ Ȁ @,  &cc`? "`@ː @  "@ ဢ0 L?   ` 2 *:  "ΠЀ #"ˠb"b  @*$`L $`$`@$`L $`@""` "`L L㘢 % &`0@  L  `@ `  `` ?$` `8@  L  `@ `  ``  $` `@@  L  `@ `  ``  p$` `H@ɔ  L  `@ `  ``  X$` `P@ɱ  L  `@ `  ``  @$` `X@ə  L  `@ `  ``  ($` ``@Ɂ  L  `@ `  ``  $` `h@i  LL  =2 L@n$`@%L EL㘀 #" L #2 " L "  " "& L "& @ 2,J A"62 J\2 J ""  *@'`# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@ְ =   㿘1#   p@'`&#@ @O 㿘1#  @8&#@ 㿘 @x  @ @x 㿘#c!@8  ! @X"  %!'@ P @  X@XP< @ H D " .@ .`  .`  .`  .` .`  '  ?8h8 '<'@'D'8 @H 2 LH @ "@O` @  @@  @R (@` '@Xc+@_' "@_# `@ @@w  @@`@@` 2@_ʐ   KcЁ@"` qh r r r r r r r r r r r r r r qx r r r r r r r qx r r q q$ q@ qx r q` qpI @Jg" `8o-"H  XJ+"F J ?`F  u2B a00 `   +  *@+  *@  *@* @* @"    @ *@"  @  㿈L 9 ?'@ @- @- @ @G @8 ( L?  0 &`   ` & @ J`p@Wr " @o `  =@/* L g  o a *`:  u*` : mid8`:  + - =`=*` }  ?* : ` n[!*` €$`"`"b II -@  & ? ? <`@ <` ="  +` -@ s& ? ?  X@z  -@Ғ \& ? ? L<`@c?2 <`<` = ``<``="  -@쭒 7& ? ? @>` -@앒 & ? ?  X@&PL  ,9*`.@e@P 0 @Vl "@Vh @F@Vc"`g"*`o`= -`X`+`-0>0;`u06*" -"   +* ("  %" *2 ?* "  * " +-  =  *   - +  X"`" `: J@+-X2@   `J@-+`8  X`8  `( " **   " **  "J@" ** ʐ $! KcЁ@㿘'L'P'T'X@L㿘  ! %`@"؀`@w""@`@㿘 @&@G 2 `   @f&㿘!ߒ   㿘@  @`&@@` &` 㿘 @=&@C  & @?& & & 㿐@   @]`؀ &&@@@  􀢠"@L@ # J?` '@1 # $'`@0` ?@&&` , @`ࠒ "@, L "  " @࢒ ,@`@ "@J 2@`#@4@& ` ` &`@Ꞑ   &`@T?z@T9"``2& ,*`:  # "" ` *`?2$ @ʓ*` `* &` $ &`@ & $@[ࠒ ,  "$L  $ 㿘&`㿘2 㿘!`<   $\ KcЁ@$; KcЁ@㼐 %!?  c!h '` $ `7 @  &Đ`` ؔ`" " 3 !/@Ґ *`  @ *  " ` 2 @ & @0 !d @ %@_ Ȓ "  '@ @0Ґ X`%` M` @" E&Ȑ   D &/ % &    ?  ` 2 .ဢ߀݀`2 @U@Ǥ!` `ؘ  @`耢 2@"` `  "` "`İ  %! @ h %!a8'!Ȗ @ߐ ̠@X ?А@! @ OЀ  a@  L { /-+)L f"e4i` b2f``2c`  ؒ *2#"0  $@Ԕ0$@͔(0$@Ɣa@0 #\$!X@@@ )  @@ @` @  "& 2   22 & @} 2 ``4 L  f  @Ր!x㻀 %!a8'!Ȗ @2 ̠@ ?@lF! @ O 9 a@Y 2 '4+ b2($@K@m@   @@ @菐 +@臐 a0@2  a4 L ΀ f a @p!㿘` @:@Y  `  ` @<㿘! @! @g   @4  @W 2  @㿘!!p !@Na$!p@x`"`㿘!!p "@$!p" 㿐ap   !@,a $pp@Ē y J?` 2'#p!!x@А, L@ #@π # 2,"!|@4 !|*  @a p, L%L "  " @|ᰢ ,@`@7!| " ""`  "'$L " *`:    $@ , @Pᰠ " $,  "$L  $!|㿈L@ 0  `L@ x X2 @ ` @, `< & :`?   `   , ?Г:`! $, : ?   `D : ?.    ` ?? ` @, `ʖ*:  . `$? &`   ` 2$?$$:  . *  % KcЁ@$ KcЁ@% KcЁ@㿈 4 ''   @u ? "`!@좒  ?  @a ? @Pް?@漐@P"@b@泐 @PͰ  "$ KcЁ@㿘b  ! @ "@P@ !  $N @P " 㿘@"% #h !" @J  @b@P" $h*` @̐"  @ @Q" @ѐb @͐b "㿘!@Đ"@촐  #"#h@쾐"㿘 & 'H   ` `2 -+L  L0 L x XL )0  ) #?)  > ׁ   $ `%E    # &I "m B  @ @  @O?"1 + <@ !b @ @  @O1"?# ?ƒ<@ B   ` @ `  ` @ `  ` @ `  H  H"@x@ؐaؔ  ' %'''''"'@耢  ?2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ `㿘 ?*` * bHN  2! #cH @  $cH@G 2$` 1#P@ #P @̈  㿘 ?*` * c`N  2! #`` @  $``@ 2$` 1 h@^  h @W  㿘!c  @#`|'  @ x@##`@ "     @ " @㿘@#@    @ߖc@@А#  㿘c  @Đ#`|'  @꼐 xΒ㿘 "@N^ '@NT @NO"㿘@ꓐ#@K    @c@k@ꀐ#  㿘c  @t#`|'  @l xΒ㿘 "@N '@N @M"㿘1# "@.1#`"#@ΐ &#  !@a؀&#@ 㿘@ 㿘!@$#  "# @#㿘!#  @Λ#c$#`"#@㜐 $c㿘!@#@#X %!'` u c )/+# l#` #@ `%#@m # # R 1P'c c̒#\'#` #Ę@Р@Nc $c$c$)#Ē@+Ȁ @6%##`"%#@提#@|Ƞ@$%#  @#̒@W@',#@=$ '@ʩ 2L##`? "`@H @  "@ q0 +L :`  \@Ґ o ! Y%## #@ې Q# @(# @l@#a@Ƞ 25#̒@@',@Pגb&@PӒb&@Pϒb "#@Ĕ J@ #@ K&I&@x @Pb  " @C # %#@ @Pb  &"@/ #@Pb&@Pb "#@ @ҔJ@ 2#8# &Ā#Ā  c@%& J ,  *"@`    ""@*"@ `" Ā@  '"@  %! @ "$] KcЁ@㿘@Ccȁ% KcЁ@%$ KcЁ@㾈 %!'` @K   "aL "ړ  " @K "  h"'p''쐐 P쌐 `숐 섐 @쀐 0|  x t  o %@   ?????'̐ ?'•  / @ڔ  ???''????'???'` @@亐@#@-+ /O? &`   `  O` %#x*`@ R`/ O` % |*`@ R`/, @j  O` ` ɀ@K5,̀ b(@ٔ @Y , p @e? p@K`p ɐ P Ő `  @ 뽐  빐 0 뵐   뱐  뭐  메 W!L @K!L@L!L`" `` @Jٰ ?" %! @"0㿘 `Ȕ   L` %!'`''' ''''' '$'(''`  ``0 0 ```}@J? "! @]"@x"PbX?' '> ''@ݐ @K1? "   @ϔ '? @ʐ c"`ƒӐ     ܐ@Nk  @Ⲑ   ??܁< $ b(" c4" p ?" d ? l0 " - ?" s ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$d KcЁ@$K KcЁ@$ KcЁ@%% KcЁ@㿈 ! # h#d   #\#`#p@ #p㿐L? &`   ` 2  ' &@  @#  J@`:` `@ `  `2 .@J`".@ .@``֠ 㿘! !P  !PH` %```#\`#`'@ #d@@D"@ b  [?@@̐U G J?` '< @ᮐ , , b@$ @Ā 'Ēb@ @ @ޜ@  @  @R @{@H? " @{"Ёx %!'@ϐ"@b NX?@b@WR  J?` '؀; @;ؐ , , b@)$ @K䀢 &b@܀ @,耢 @)@!  @ @ @ @H/? "a @ "㿘 &N    & N?   ` 2 c@G@ň @G? " o KcЁ@$  KcЁ@JJ2 @(*`*$ KcЁ@㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& 㿘 ~6 (2.?  *@`@  /2*@N @HE @f# @ "%  @x 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@Ւ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@   `- `*` m #\@/Z  㿘@@㷐  #\#`@  \`  : /6@ " ^ "$  /;< 9@(@2 @ 2  2  @ /< 62@ `$ @1  @2 `2@  /2@  / 8  6 /  #\;`@㻈\ %` d 'i @E:6"@U 2` ` @Ɣ$ U?@E&`€ L?` "H GD @ /`41 )"Ԁ .` ." @4 ` @ ? 6#\#`, 2`  2J`` @`@@Lf @#㿘`@ `@, @’@m` ` P?@ړL&`  `` *`@,&`?$@&`  @ `"@: @@C& @& "@@g ?` * $@`&@@` * $@` @   #@@Dl?" ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@?`@ & 㻐 %!'  @q$   ac@Z$` @` @@Kta @~# 㻐 %!'@G$ ? @$€!a @~y#0㻐 %!'@$$ ? @(€@c-a @~V#8    (*@ ` 2  㿘N  @  " @H $ ## "#$ @ 㿘 ## " @ޒ 2   2 㿘 ##` @@`@ 2@$㿘% !a #l"#l (J @D    ?l@"@:l "``J@ @+    ?`@" @!` " `㈒c@"` " `""``J@ @     ?`@" @` " ``J@ @    ?`@ɒ" @` " ` `J@ @ِ   ` ?@" @`  "  a `$# $"ᴁ㿐N@ ' !J@` :'`J@ `'@F#H&@F{#H& @Fw#H [ @nTJ 2 M& @Fc#H G @Z@J 2{ 9` 9& @FM#H& @FI#H - @&J 2a #@4\ # @& @F/#H  @ѐ J 2G @4D @4 & $? #@& & & $@F#H& @F #H& #H@F  #c (&  ##`"  2&     &   &   2&   2&  `2&  ` !` #@ 0 #c? @-$㔀  a İ  !` !@z !&!!   t I a . @7 "#P#h#\% #` !a@@Ya  $a &!@O' $a$aj@ ! #P#h aᰘ@ % TJ&!Ԓ@g̀ @&! "J @! #P#h@sЖ@И@` #*  #c  @Ȥ! #P#h@Wcc@Dc@&!  $c䀢 "R@N a@@' a*@! p!l ;`!l  2`/"@  ''@Ȑ L㔀 ! !lJ + -J  @!l    "a  "a@0 "@  #"c'!lJ  @@԰ ̀` J@ I @ @E<㔰 P %!cx  1'''/РА#@ 1 ! '' Ȕ  !    a @{?#㿈% @o ##? ) X`!\)`2#$X !` !@ !$X%!\!cP@耢 2 $X@  $X%!\$%!\$㜰 X %! a ' @ ;    "!?5 7 #!lJ`+`-"J !l# aa @ !lJ   @ Y!! ! @չ$!~a #P#h@ ! Y !`@ՠ $ᨀ2!l@ Ē@Д @`? " J  M! #P#h@! @Ț! 1ᨀ "$@k$ᨀ`@d $!l &' #P#h@ش! @!  ᨀ "P$@DL$! a@{!a!,֐!l <`!l $`05` `@@& Ģ ` J@  @Q @!lؐ !l@֒ !l a @&aJ&㈀`T  %  2/А В@(  ''@Ȁ !  a @&aӰ %&㈐ 1/@2`  В@`''@АȠ !` a @&a  !l ! @y#X %! a ' @{ = ,  @y;  "a? 5 7 #!lJ`+`-!l # aa @f y!lJ   @ Y!! ! @]$!"a ##@ױ! Y !`@D $ᨀ2!l@< Ē@t @? " J  ! #P#h@! @l! 1ᨀ "$@$ᨀ`@ $!l ' #P#h@X! @E!  ᨀ "O$@K$! a@!a!,z!l ;`!l %`04J ` `@@ɐ Ģ ` J@  @ @!l { !l `  @%D&U  %  2/Ȑ Ȓ@͔  ''@Ѐ !   @%x  &㈐ 3/ȠȐ'@  ''@zР !`  @%ᔀ  !l a @xX#؁㿘! !   "a"!"@F ?$! #"# 㿘 㿘! ! "!@ $!! ! `"!@( !$! #"#㿘  #?""#   t 1  &!!#   i &! 1 !`  `#@  &!` 㿐 a  z # 1 ad!h @$ad 2 &!h!h "&!h@&!h$ada !h "!l% * .`  al"  * .`   at@   ax@   a|@ al"   * .`  al"  * .`  al"  * .`  al" * .`   a@  $@@   $ 㿘@? 2 `@ & & @4 P &`@ 㿘  @2 *@p&  2 & @E&`@  * "  & 㿘`  @ .`@ @*` @*@$@"㿘  @: ,`@@ 2 `@* 㿘L@  @ & `?  ` 2`L@  &`L@  @ &   J`@ ?  ` 퀢  L   & `?  ` 2 L   L   `L"&  ``&@v `@I @Ԇ@* & 㿘@`  2`@3 `$ ,|  ,v   )p    "@m @g@e 㿀'"Ḁ . @Ժ @(,@?@<`''  ?0@?@\耢 &`@ & @@n (@0 2" 310 0 @ P `@{@h䀢   㿘J`"e #J #^ " & @  ` 2J 2  &J 2L ( &N &@`p4?2  &J`  @  ` "J "L"@Љ &@`@\ @ә@  * 2 㿈  @j@З04;. 1 *'5 #v  ? @p0 "` &Ē㿘  ` `@#  `  @     @    㿈   @@-Y ВÖ 1 L ' 耢 " ?:( @ 01 "@  "@  @@  Ð@ذ 0@԰ 㿘@Ϡ  `@s N  `N@  @t`㿘   Ȁ` Ȑ@tI㿐` @" @"@  㿘ږ   Ӗ  ɖ   ” $ @Ҵ7"NN? ,2 N`@Ѐ  @?  @ 逦@5 㿘 ##! #`$#%"# $c@! #  "#@#  @@#c $#  @$㿐 ##`'!"!   ؒ   K $!!  `  1 @0@@ `@| . ##$  #㤀  "@" "㤐 㿐!"!'  ' ؒ    $!! @ ` 6 1 @ `@΋`  `  3`  2  2 @ "  &# 㿘'L'P'T'X@L㿘@8j! %  `@ѫ"؀` @Z"a@ѡ"@/"@њa@r㿘'H'L'P'T'X@H㿘  ! %a@х"؀ @Zu""@{aX  N "q @h @ `"j N@ "f @] @('_ &'@&@6Ā  %T # Ė ?''?'?'' ` #\ ` 1 {ؒ ؟!䀢    `@Sa Đ?"`h@ఒ !a`@͋& & @Н*@`@|'@ ' @Ў@@*@a@@]ā㿘`? "`@  "@@ܐ  ? ? @  gc" "" "  @(*`  *02 @$_ KcЁ@㿘@s @u` $/ KcЁ@$a KcЁ@$I KcЁ@$ KcЁ@$ KcЁ@㿘`0   `"`a ?"a`` `&`` 2 @@p "@@7'? %"``"  @ܐ ? `@?&`*@``&@`  @Ő ? ` 8  ( H t<<<<<H<<<<<<(    " @@0!S 4x * @`*`@%$` $` $`@Nj @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@n$ D$ H@  `?$ @:   "@(  @8  @ `$ $@ O@ @ @ {4 (< DbE$ L$e& & & @ ` "`@ `㿘   @J @:  J@ | 2@  @&J@ |!` & "@ [  "@ :  " @ { "@ /   " @ m "@ !$㿘 @?ܑ* : ` X&|!* € @ @A   D`" D D  ,  " @ @J@ )} )  ,  H" @ J`)g&@ c@͔   ( "( `, T"`,@  `( "`( 0 G"0@ C@ >  `@85 @ 0@ , @ @Β  , &@:` @:,  @ &  `  @ , :`@ؐ @  @?֐ , :  ? {`  ` &  `  ` &@ , :  +"(  ? *"  , {J"@J "@+ "@> "@"@1 "@s "@# "@  @F" "@  @= $@ S@0 @J@ ,2`& ` &  `   !@@@ @m @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ޒ @ے  @ ! @?֐ , :  ? {`  ` &  `  @ 㿘 @ @ &@Ӑ *J㿘   @ J@ ^2 `&@S  `( "`( , ", @-  @  ` :J@2J`` & @+  `( "`( 0 "0 @X 㿘J@ ``\ & @ @H J &aa)|a{`." `[`*,`:`#a(),`:`! a}a9,`a1 ~b[,`:` `@p| @ؔ w@Bs@  o  D`" D D  ,  " @ @ `  J@ \J` ) \G )  ,  H" @ @ ` J@ \ J` )`,&@Ē (.` H @~ `@b@t @    "`H`2:`@ ,`:`@ɐ  @"J *  &"@i "@J "@] "@>| u s`$J \o`$J {k`$&@l @ #J@ , ` & ` &  `  !@P @C !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘 &    . J@*`А @ "   ?  `  $   @ђ 㿘    `@ߔ  2&   `@Д   (@s  &@ @J@ ^2 `&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@=   o ` 1`?,'` % &@ `@ ?  ` "?@ * :  @ `@* ` ,`?<@` @U- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @&@  @͒@@[0@y@ 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @  @  `  J@ :J` ]3`@q 0m   &@h J - ]@^ @ @ @T  @ ` J@ = J` ]`?&@> 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@ @ ` * `@   .`㿘 # & @ J? &`   ` 2"#` @  @ 2` @J`2`@В 0!L  @ `@* ` .`L `  `@ܒ@M L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@c . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2   $`D" `D@@H 2`@J`"N``@   @ 0L@  &@  `  %x*`P( &@  `  %|*`P(*`: 㿐 &  ]&/// & &㿘 ` `8` &  `   * : Ւ0@z`   `4, "`4㿐 &  ^  ]&////͐& &㿘     .  `y|#*` € $" r&  "@L`Ԕ  "@(  @j" "@  @a $@ 0M "@( "@   "@K"@  @B $@ ` @ݐ 0% "@ "@0@Ɛ~0@t0@  "" "" " 㿘   "    _ `& 4    @,  "`@6,  2  @` " "  ` "4 ` @А !"`@ 2  @` "  "  , `  :`Ϯ` @$ ` " ``%   @ @       -   τ:`$   %  * --%% `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@q`  @&`@ڐ @' 2 `` "&` @&`  0"?@&`  &8    ` "     `&8   `  "     㿘  '`8? @  Ò `4 &`4,@ @ 2  ɔ 2,@  $ @ $ @㿘  @c@ .` *  @e. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@3* "@    (@> "@㿘   @;.` 2& ے 0& 㿘 &`  @**` &` ʐ &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@u  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@E  " @?  " <@9 < @3@1 %!'@ (  %"@ć`^ @!  %`@{"0CaT $#DaT& & & & & $@$ $  $ @$ @(`'H 'L'P'T'X'\@Ŕ!@/QH ,@Q`€ $$ @ $  %`@A",``@@ѐ@ϐ  @õ &  &@& ! @e 0 %!'@ !?  @/S @+u   p   @ #@`b @e @㿘` $  !㿀@( $` @?`   @g$ @6   & &   & '@)$ & &  & @\ `$`@2`8  $`''``@   @. @= ''  €@. "  @$`$`@&$ '@.s``@㿘 $@   @@ $  @@㿀 $`!@ @  @ 2 @i X @$a  `@$< KcЁ@$  KcЁ@㿘 @I 㿘&@&&ͩ  @*&"*? &&  㿘 $\ $`#d"\ 'D@% = ?$@ِ 5 $17 $ `" X " &`N@ : @0&` ? ` @8 2 @¯܀ a-` `! $#X`" N@ : `  $ "#`"#`N@ ? :"` :0^ ?`  "  \D*``"%\ `:` Ȁ`5` $#X`" N@ : ʒ  $ "#`"#`\ ??%\N@Ā`: \??%\ $#X`  $N@ :  $"#`  ?2'@ `2   "@㿘a! $#p? @ @ $#p#p *`:  + -"`*`:  + - $ $#\`) % $\ `" ' $? $ $"ch"l ̀ \dJ`\!%  $ cl#耢$d! $#hcl#h\"@ " $\ $#h$\?%#h$clI?*@$dJ - J 0 $@ - * $#耏` $d\ * @  %`+$\`# $ch?! $\#l \#l?ch$#l\"@ " $ch\ $\#h  $cl?2d\"cldJ` "`$dJ` -J \! $ #l#$d $\#hO#l#h\" "@$\?%#h$#l)\* @d "%JJ`-`"J`-   $d`:@ 2 G?#$ddJ  :$d -J  -@a  -dJ`"?J` $\ $\ $#X`  $N : q $"#` ?6 W25`J` ;1`dJ`!\ $\ $#Xc耢 $dN :#M W $"#`N`:_ ?] :* @$dޘ c$dO`J@ : dJ`F\ C$\d%`J "J`5%`Ȁ : \ $\ $#Xc耢 $dN :# $"#`N`:  ? :* @%`Ȁ`\\ 6*  J@-+ $\@ %`\#`$d$\㿘  L 㿘B 㿘8 $ KcЁ@$t KcЁ@$ KcЁ@$P KcЁ@$ KcЁ@$ KcЁ@$3 KcЁ@$ KcЁ@㿘 @&ذ? /"@㿘N0k N x XfN  a? &`   `D U .@N H E # &')+` @ ` D 4` @ `   %#x*@ R` @ "`(@!a0@ a  .@* .@ݴ`.@ N ŀ 2\[?ǀ &`   ` `%% &')+ # @ `   @"` , !aH@ r*  Nް  .@`/.N  @ `  Ϡ 0q?/EN @? &`   ` 4@3N  %% &`   ` ` @`"`  ,` H@N N* @ ܰ .` 0)@'&@ `       `  &@* @ & * @ &@*  .@`@ ` @% @% ("?㿘 %a`@͐"@㿘 %a@"@$R KcЁ@$Z KcЁ@㿈`  `@''''_㿘#? ڐ K? !?`V!Ѐ` !ؒ ݔ ?" Ȓ  Ő’  $ Ȕ >>>>>>>>>>>==>>>>>>>======>>>>>>>>>>>>>>>>>=>>>>>>>>======>>>>>>>>>>>>>>>>>=X %!'@ 2@_@S #  # .@K@G :  *  . : . ".  aܐa %" , ,  ,  ,  ,  ,  ,  ,  ,   , , , @5 @ `*@ @)  @%  ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` a @_C! xN -   a#\@ڐ7#b#\#`@ƚ#!#\#`b @!b8@ @@f!0bN  ӑ* : `K`!*` €   0,@  ,@L@  @`"H+ 0"P""X#耢 L@ `" 4 Ǡ  ,? @H,@?@?@!㿘`&    ? `   i$@CR? /`4 / &/ ! %!'L'P'T'X'''" ` ` @! 7'@'c''''Đ@-4L! @^$"`${ KcЁ@㿘*`$ #  А :`b@ 2  .2 N .2 *`  ` %!a8' ̔!@P '"''Ā  "#  %  ? "c# '̀'  #c@r#@ `؟@Ԁ `  "@Բ @'Դ %"""#$#$b|"""b| # @tN* <2 @tG* 52 @t@* .2 s 2r3 0 "#ؐ@rj$ ؟ Ԥ%@ Բ @'@#c #@ @  @Ԑ@'%'$ؐ@r;$ &Ī` "`@#㱔"  @ 4` @͒Ԑ@'' @{ @z@zb %@” :`07`0@zĀ Ԓbh %7#c@q#@ &t`Ԁ  m` %"#%?]`@,Բ @U'@yԀ  bhԐ %@sJ @2 @ ` 䀢  ?#@  Ԑ @%Ԑ @'#  " c '`"#@ Ȑ  'x'@ @mԤ'Ժ``" ̒ '̀`#c@qd#@ `؟@Ԁ 2   4 %'@ d  "b|@  @ ##" @   @ےԐ@%'@#c @" "`İ  % @\"㿘a8 !@u ̠@r ?2 @G 0@ @   @ 0@ 㿈a8!Ȗ @R ̨@rː ?`@$&` ?     @ " Ē /" "#" " @b . 2N@j 2 N?  &`   ` I-N? ."DN##@wє D!"#@@!""$"b|$& b|"$& " $!@' @" J?  &`   `  .2 NJ ?J .#N?  &`   `D "`  @ : 2NN :2HN $N? .@##@wl !"#!@ې""!$""|'#$& "|##$& "l#`J?  &`   `D 2 + :  : . J 逢?J .#! @l8 O  b@  L 9 L f"( y b %2#`2 @,@@  @h@ ܖ@Đ@ `2L ̀ fx %!a8'!Ȗ @ ̺@q ?@`? ?@ ?@ "`߰ (`%      ?#@"             0 @t / @m "?" 耦/a   $ #\@Y" - 7? %2@YӖ  @= "t&c @%a @kM O  b@  M Z +"b|M f"F y b D2B2?@:@@ 5  @g@   @Ր#@ѐ##& & @k%b| %`@@B  & & " Ē@   %M  f %! @Y#0㿘! $#t #@@ycP$#t@y $"#x㿘! $#t  $#x`@w $#t㿐a8  @!Ȩ $#t` +#@@ycP $t ?t@y+  %` J?` 2'#t!"#@4, N #ߐ@ # 2, @zcX # , @ue   @u^c  @c@ '  ' "#   t `@t"c"b|b|# # # "L"L "  " $#"`&# @zX "&$@,  "!$@L  `*`:    @$@`@zX " $@,  "$@L  $@ @$'#@U%`İ#㿘 0 @uВ   ,   @u 2 㿘"#" "      @ 㿘""cc$  "" " " |"#c   " /"ta @zcX Z ,%@sѐ L  L "  " c`@z  cL " , c  %c@ "#@$@`ð $cL  "#*`:    @$@`@yΒX  c,  cL  c c$@% p %a" # # '`  @uې 2 *   h#\ @W #"bt bt@$bt@- cx@܀ Lbt  "`! @W#㿐@    "# ` # @u !" !""x "x@@$"x c@ߚ `"x  "`ā㿐@h  .@?` .@`.@`@h 㿘  % !   & &   @ && @ $&@@$@ `&@ 2@㿘"#" " Pa8  @!Ƞ 5 ahal ad @,`@ah @al   `@   2`  0* P@ &ђ ?  +`+`@RR@ 22""蚄?2J  J@ `2J 㿘@ް  "@ ( `&& & & & & & & & & $`& $@$$@@ i c@v _?48 `.  @ K@d I`D&`6`8&` $@ * 2``6`:6`:`&` &`%   צ@@4 &"  2 : $#  &  $ & $@[ "@;@6@4 @2 㿘`(`D&`$ @(@# / @2`L`  `@y@ &`( `0&`&`& 㿘  ` @ T 8 6 @  " @  @@  $ `   @e  $  `@Ր@?"@ϐ 㿘 $@8 `> `4`>@ +4`:`'`:* 2  !@ * 2``94`:$ # \  $` @ 4`:$``< "4`<*2  Y`"  <$ @ 0 @" < "  " @t$ 4 :` *$$@e $  @Ĕ? "#@s <`4 <$ `"\$` $```2`@   $$@ D$``R@,T`8 2`>$  X $ $ 〢 2$`@I * 2``4`:$  #   $` @ $`4`:`< 4`< 4`>` $  J /@  /*@`(`@`DS$@ T`8?2 @֐@"$F `$* T`82 `<$ 25`)  $ ` @Ӱ 9` @"$ $$$.` `2``㸐@? $ $$$`   4`:$㿘 6`>@  "㿘` @@  G"@" $@2?  :  9 27   "@_@2  $& $ T 8   J`/ $ @& #  @& k 2   㿈 @ 'H  HH`X  @;5 :%  2 $ `  ?`  4 ''쀥'H 2 '@@g  H2 <@%  <' @ 5 <'@   ' $ J?`/  $B  / * U 8"@ '    2 `L` .2 `L` ?` ` `@`   `@ )@ `@ " @ @@@ J 5 : $ @& $"ɰ "   $  '@ "4 8$  ` $ $   4 :$ 4 : 6$  쀢 " $ `  "  $ $  D $ #4 : $    ($ @S D D$ @  4 :* 2  *`2  $ &```@  2c $`@Ր耢@Q $   2-- $H29 U 8 2   $ 6    㸐@a?  5 : $@]& $2 H   5 :@@@ 5 : $ @& $ ?C" @x( $ `@ `@7 "* @R` 2&`@ʰ T"I " @&`  > h>> > > > > (> 0> 8> @> H> P> X> `9 < @ ((&`0 &`, N`D`.&`4N`E  ?`Dc  2`  `2``0"&@`R`8 6`,  @  @    㿘 ( *@l$  2 $   "$ @A$ $   "    @Д  `"`" 㿘`$ H@   @X`$ ``6 >& & ( M ?& @@ D㿘@  㿘 a   @@&  ?"  @&  2 &   "& @&     D" "  2 D""  P86㿘   @8   ( $ .   I "?ʓ ?`0@`,@@? "Υ@@"㿘  `@ `= 3%``@$@#6 $"    ,*  @$@ ֘ Т06``ے`(qԑ6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =%``@$@#6 $"    ,*  @$@ ֘ Т0aE$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  ےĖђ%X   ` $  @@ @g: <  (  >(` :`@?? D8 >` > >> `` "`@`  @ 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @[@T?@J kby@9@2?@& 2 8@@ ? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   &`#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @ْ@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘 @ N * @j   ) & @ N@" `   `2  `      ,  `        `0 "  @(? `" `@ `  ``_` @ `  2 _` `$ `@ `  `_{ @ `  {_  {  @є2  @ @Ě]`& ` `㿘  0@ N * @  ) & @ N@ `   `2  `      ,  `        `0 "  @m? `" `@ `  ``_` @ `  2 _` `$ `@ `  `_{ @ `  {_  {  @2 2 @ @^`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@; #7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(`X   ` $  @@ @ِ: <     >(` :`@?? D8 >` > >> `` "`@^` "`$@X`$@U 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @{@t?@j kby@Y@R?@F 2 8@0@)? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   &`#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @%@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘  ,@ 0 ( N` @h  , @ `@+ & @ N@`@W " `   `2  `      ,  `        `0 "  @O ?  `"` `@ `  ``_`` @ `  2 _` `$` `@ `   `_?{ ` @ `  ?{_  ?{  @ L @ `@T`@O@ߘL& L  `㿘  4@ 0 ( N` @  , @ + & @ N@ `   `2  `      ,  `        `0 "  @~ ?  `"` `@ `  ``_`` @ `  2 _` `$` `@ `   `_?{ ` @ `  ?{_  ?{  @& L 2`@ @ `@{`@v@L㿘>!`+@ @( "v`M) PV~ўȄ@ d ƞ@"y@@o@耠5$@  i"@&("`8@2@ ``2@| {@v `2v@o 2p@i 4j@c `(`` ` Y@T   @ @. @@O@ I/@("F#A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  M ֒$1 KcЁ@a(##''@<  @\^!`'```%59;!تШȲl'   * ` *J`|`:2 8*@Ē@@ĒH@  @גaP 2`X    @̒a` `X $`XĒ!p@ : `X $`XĔ@ax?"$`(@!$`0@$`,@!$`4@  $@c| 4`Ē!@? 4`@y?2`0}`,$`8Ē@l?2`4p`8$`<@_?.4`HĒ@U? 4`J@K? 4`LĒ@A? 4`N@7? $`PĒ@-? $`T@#?$`Ē@?$` @ @" @ @@ $ \ ` a/////@?8&|&@|& @ݔx? x & Ē@Ҕt 2 t . . Ē@Ŕp? s  . Ē@є  $@2c.  *`:  p  ,: ?4`@ $$  0Ĕ/@? l *`&:  4   aW$`@$@㿘@  @@\ڐ "&@`@ 2@ &  `   > @Zɰ                         ɰ             %t t㿘 1$!` "$@Z$&!`"!\ @!$`@$!\$` "!`$!\"!d @- ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ x %!'X\'DX 'H'T' ?X #$a` @T !$!\@$ g!\a`@˔!\' Ĭ@$ X      @ A'$@>n" #/ % t`+   u #T@K찒 ` @@@@p @ @ H"D!" L c '`+M@  `(8,L \24,, %$@ $@c 0ڤ@*M@@#$ 4Ϩ ѐ ζ? , L " #"T@ 2ݦ`@, 2զ   U  @`??w  ?L: ,?#\$ ?  ~@ %" ?2 :,??J %L  : $ " ''L?`: :, '"@  %$@$&@ '@ >@01@$ @@@?(a = X $$H"@ 2@@ "? %@w? %D#@  %! @=k"0㿈@''`?''  ? J ? ?  &@J `?  JJ|:? ?J:|?  㿘@@㿘1$!h "$@&!h$$$"!p"ad"l 㷀 %!$ap ' "$p$ah  p@]b8 $h0yְ )$ !`` $d h"dS h@\젒 h`` @Z@ p$h`$p` @\b8 $h0I*?쀢`2L$"!l?  &`   `  $*:  : #!l  J?`\2#!l#!lJ?`\2"l"l:,@ $LJ  : \2$@"%@ '^?< @R쀥 ݢ@ h@\)젒 h` ` @@J $h*?b@@X'@0- #\?7    # @t@*` #t㈀ .@$'$t@" L'L  =2 $@  ㈓*`" (?`*`㈑* : , *`: ,   =2 =,@ *`,   @* ,``  㿐#*`  "  "@$ $` KcЁ@$# KcЁ@ ` (  *88 " (" $ KcЁ@" ( $ KcЁ@㿘 @? @V㿘  @V  $$h KcЁ@" $ $% KcЁ@㿈'HN@ r'D wHJ` &  n"@Ӑ ' g 耢 @ 0]?` H ?" /5@w / @$@#@ђ$-``@ޔJ?`/#,.O j@w` e@wah 2 \*? /@ * T"@@m$Q  `2L `G < ( 8  ^# &5 ,O /.    *? /@Q * "@`L`/`#x,,@mn$#o@w$rJ /"*! @4W!p   ` h  "@$ $  /,&@ @8@50Q ""$.@$`ú$ .-@!@-` d'x ''2'|" |@"ɠ?x!  ./`@ % @@'x .- - -@   /-   @D g@3$?#5 @6 YL` .2 `L` `  ``@W  "$` `    _/ @ (&@&@@ 2 `? /, ``$ @c@&-c'` "@ "@ @^@\@t "㿘@ @$ `@@?` $@@@$`@>Đ@ 㿘@f㿘@ ( ?"9 0 <   1  &"  ?@ؐ @{2#$ @&   & && & & @ & @t 㿘@  $|$ *`    |#" # # #?㿘`$*`!@@  2 "  @  " : @{  & &   @6@  2 @$@㿘  @&   2* &   2   2    @i  &   @ 2   "   & @ `"  㿘  , @4 %t" l` @  c  @'@  "&&  J " $ KcЁ@$  KcЁ@$Ą KcЁ@㿘㿘'L'P'T'X@ L  ddd4dddddddddddddddddddddddddddddddddddddddddddddddddddddddd4TTTTTTTTTTx l(|<DL %!' 0 ``  ?"   @ `? &  `  " %! &  & &  4@w@ 2@  @  ` 2 @2   @ z`#l,  €  4@w 2 @` ?& & d`ޢ`@ h2ڢ``ע`@ l2Ӣ``Т`΢a̢`@,* ƦР V ` hQ  Mh J H @bA b>   @ h7 d2n@``f*``22`@2a2 ``= M:J"? &  `   `    b@v #b % & ? &  &@v 2 @  ` 2  8@#X,  €" d  @@vX& @$`@$& &@ @ Ө"?d/ J #  ?& &   4 @v!  "0 L@`  ?& &  @  4 @u 0 L@`  ?&  ,&",'"?d# # &  & &`4@uΐ 2o `@  ` " `?&  ,&  4@u $  &  `  " $5,8!T@Y ?Հ`MS" *` €`@ @ @@T/,@ % -`4R (,@  % -`R `` 34,@@+,@@  @$@ꀤ@ ,@ , ? &  &@u6 2@ (ư @ x Xd@גd$h,@ @ `   `2``@:2a2`2``2z*v"8!t@8 ?Հ`:2!4*` €,@@"',@ @ $ ,@P @@ `,@ , ? &  &@t 2@@@ (8 @T/ e E@F @Ad$,@# `2`":"$ ? @-! @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘q 2 * $P% &&@@|@@t&$@ @8@k"@&&㿘 & 'H   ` `2 -+L  L0 L x XL )0  ) #?)  >{B y   $ `%E    # &I "m B  @ @  #?"1 + |<@ !b @ @  1"?# ?{<@ B   ` @ `  ` @ `  ` @ `  H  H"@㿘 &    ` `2 -+M  M0 M x XM 0  >?{? ?@+@?   ( O !@ @  d? ""? ?{N<@ B    &`   ` `ͦ &`   ` ` &`   ` `  `  '㿘 0 @2@Ð$ #$ 0" 0"`  ,< & ,`@  @ 0&"@ 0 " ?㿘?: `2`0@,`0   `"` a ?"a` 2`0  " ` @r H?` &` ?6` &``  6` `0@  `` & @ "@/?&@*` '&`` ` ?߀6` @@ (` 2 `` &`&@``@@&`<`0&`8"`0 "``B &`&@.`B$| KcЁ@㿐1 x7% i5i;%%3%$&ȒH&`&|""x'`#  .( > @?* $%Ȗx (@ (   (. @?*? (%%8$  .@/@.?$$X$$␶  .@/@.7$$ ./$h 9, x'QxIxA,x  , "''@#  #%@4("('%8@4(@'@(#ײ`` ʐ $eaxx ]Y xx  )%! "@  @    (@'@('$"$  " %@% @  ``(@'@('` 􀤠O9%ȆH .$5%xȔh ( ( . '   (@&@$ . $(  % %쀢%      2*`0"㿘 % `2 u  3ibx]i|]"x6  a"Ybx b6  $ d6 . @ *& 5@ *`( h5 f * 5j a, @ la "x%-@e!x %n.bx @@ %!@ai@%""|b8&bx @     <b @1f@%1 )22 0@ (@@ ! x2@ 1f@  bx"x 1g* xb "x3`1g  @"xcx 1c"x3` h !x dx 3`1d "x @h@"x  `e+`ix x @ @$@ $$$   㿐'L`'P %%x' '%%8'' 997A"xx3$3@3.`#( ., ;1 @(31  @5@ @1 @   . @ @ @@c%5x-1xx#)>' ~!~     6 . ( 0 .`@.  @6  / 00@@ @@/%6 x?1)"x6` (o 6.x.7x38. bx@`? Ix4`4` c `+  4`, 4 * 4  #4c %/ LQ x  @   @P  㿈 % `  / / / / / / //''.@.`.`.`.`.`.`.`㿈N@ $ %N` 1@@  `2Z * *  " (ϐ 2 N@ _k@   N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ*    N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ* @ % ]  N  *` *"  N p 2 N !$ @i"@""9 N` z  `?ŀ Z  @ ?ˀ 9 -  ?ґ+ :  z `?ŀ Z  @?ˀ 9 -4?$*"*`N`"`@ `  +``  耢 B  %ఓ3  3 .@ ? 3 `.@ `? 3 `.@ ? `.@`*  3  ? 3 .@ `? `3 .@ ? `.@ ? `.@`*3 ? 3 .@ `? `.@ ? `.@.`" 㿘.`6`I8N N @6 3 0(0.++N `! `<0(.7`N  `(.7` 㿘 2 a $. .  . .@% . @6㿀 %!'  'i,`2  `@F`*`,2  2    8  ǔ ! @&! %!'a@ `N@ 2& %N``$``a2 %` `N` $ %@A  *  %`@D* @2`  %  /@5  `  ?#@ @b @И ` @?@v `@r `@ ?#h#f 7  @J.```$ ?#h# @% ``??#h  `*`2 " *2 " *2 " *i" $ 2. . .  .` @%@  @@@@   @%X!*2@ @- @0 @(*`@ @2 @ (*`@   * @2 @ ?* @*`@ ڔ*㿘&0@2 2 c@2 . #d((33c@3. #d(( 2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( $33c@3. #d(( (2 2 c@2 . #d(( ,33c@3. #d(( 02 2 c@2 . #d(( 433c@3. #d(( 82 2 c@2 . #d(( <333. #c($@ hD@&@&㿘&0D@2 2 c@2 . #d((@33c@3. #d(( <2 2 c@2 . #d(( 833c@3. #d(( 42 2 c@2 . #d(( 033c@3. #d(( ,2 2 c@2 . #d(( (33c@3. #d(( $2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( 333. #c($@ h&@&㿘a@LH*`2`  *0 : *0@`( ` 2㿈.7 6ܐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' r'k', 2`*`& `**`2 &  6 ,  2  J'C'{, 2   * *`+`&@2& ߠ / 2  ֠㿘.56㿘.6  `O *`2 `  㿘.6  ` *`2 `  㿐 3``*``*@(`@ `*`+``+ @ @  '' 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 3``*``*@(`@ `*`+``+ @ @  ''7 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 ?  @  . ( *`*@ *@ @ '** +   '..􀢀2 . ...2 . `. ƴ㿐 A*`*@ *@ @ '** +   '?..2 .  ...2 . . @  . (  Ŵ *`*@ *@ @ '** +   'x ..2 . ...2 . `. @  . (   % `? 2`*  %!# %!iaD'@~f$##aD@T @~[D㔒@$i"#0/i5 )i" @  $"㔐 @*`@" @~9@@~3DD@㔔@@ߐ@~'@㔔@@~@ߐ@F@~   @В?    ??@~ D @ < @ <   DH㔒 x@5@ @  @}ܐ@@ @[  㔐@@R   `@}@`@}  @}@u@ܒ #@}+ *    %# + #*   %# + #*   %# + #*   %# + #*   %##  %## `%#*` ?耢 ? @"PH;j&. ㉘ `v  " : "" " 㿘  (0 3`+ +` `? @@ # > `@@| @r &@ @l`@?@ @|㿈 %a'`2*@`*2*2222 ///////*2@ `? @" /@ %aH  %!  @w"`㿘Ɛ   . . 2 .  .   >`P>@>`>`>`>` >`(>`0>`8>`@>`HX< (. .`&5ک x@  @@0`(`@@:1@V5 - @  ۪@@5`-`@Ą @0os@ 1 ) @Ȅ =_㯂@@0`(`@̄@@*5 - @Є * @ @5`-`@Ԅ @?Q@1 ) @؄ `&؂@ @0`(`@܄@"=@㯨5 - @ ?ք㱪@@5`-`@ @"W5@㾈 1 ) @ "@@0`(`@@?f@ᓨ5 - @ )P㎄@@5`-`@ @m@!1 )  =@b@@0`(`@@ @0,@ 5 -   @Q@ @5`-`@@@:m㪈 1 )  5Ą@]@@0`(`@@ @S5 -  6(y@@@5`-`@@@9Ȉ1 )  xs@@@0`(`@@ @0ք5 -  =5C@ᇪ@ @5`-`@@@V 1 )  *x@@@0`(`@@ @?;5 -  @٪@@5`-`@@@#J1 ) ?B@@0`(`@@!} 5 - gX"@ @5`-`@@?yN 1 ) )/D@@0`(`@@5 - =҆`@@5`-`@@/p1 )  &߆Ƃ@@0`(`@@:I 5 - 5;̆@ @5`-`@@" 1 ) 6u49@@0`(`@@95 - 蟆@@5`-`@@1+e1 ) 1= H@D @@0`(`@0@ʿ㗄5 - 5*@㧄@@5`-`@5@?$91 ) 1Vք@Ä@@0`(`@0@#3 5 - 5?@}@@5`-`@5@!aф1 ) 1@O @@0`(`@0@?95 - 5(P@ @@5`-`@5@ᡄ1 ) 1=߄@₄@@0`(`@0@/N5 5 - 5 ⻄@@@5`-`@:ᴄ5@㑄1 ) @ % %%%$ KcЁ@%# KcЁ@ $ KcЁ@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  PPPPPQQQPPPPP㿘@`@ @5r` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  Ӑ#,` €?, ?".` ,  ,  ,   , *`$ @$.`.@㿘 i  @ #  @+*    @ :, @ %! .",   @ ` :  , ,  , @ 뀤,#XffXffffffXYfYYf[T[\[\[\[\[\[\[\[\[\ffffffffff\L]f]ffff[ffa(fffffcffd,ffffffffff\ \P]]][\P[f[f_a,bL\fb\c ffd8f\}}}}}}}}}}}P}d}}x}}}}}}}}}}}s||s||||||ts|stx|su|u|u|u|u|u|u|u|u|||||||||||v<w|w||||u||y|||||{@||{D||||||||||v v@wwwuv@||u|xyzu|{u{D||{D|v㿘` @z&`&`&`   %!'''"`` ` @w!` ` `,`$7''7'''''@ @_ 2? @`  @4`   @"h`! %!'H'@'`0   `"` a ?"a` ` 2 ` @ "` ݞ? "   HW` p' ('''''@v 'Ȫ ' %Ȗ(@f   %'?'`$$@ ' 'L p@'` '''?/J'?`ZԐ",*` €O  / L ?Ѐ ,`L** ?Г:`  L $   H'H@s  -`' '-``'` ' +/J *?' L ? ,`L** ?Г:`  L $   H'H@)  -`'-``&g?f?Ѐ  ,`* ?ТJ?Ѐ ' $&S?R?K ,`* ?ТK ?Ѐ ' $2?' 7H'H@ۖ /,*@'J@ l2"`' `ȑ-`@`/ȶ`-`@`'';  `-`@`''-!``@ `-`@`* :  `-`@`*  : `-`@`:  6  -/`  g   G" `-`@`''ش?`"-`@`''ش?@  #   -/ "x' @  " #`#\@ g G?@$ g g E e e f'@<'܀ @`  O @  O `4  $ O Ӯ -/ ;+`@ `-`@`2 `-`@`* `-`@`" `-`@`"" `-`@:`:``-`@`"`-`@`''8  `-`@`''*``@`-`@  `-`@`  `-`@` ̐ `-`@ b 'Ъ`  x`-`@` "  @5 "$ /@s`-`@`''8  `-`@`''*``@`-`@  `-`@`  `-`@` T  " "'`-`@`''8  `-`@`''*``@`-`@  `-`@`  `-`@`  2/'ض$ب S "  7 F"4`,  `4 0 , 806 03, @ `0, c  ` `0,, 4` Д ` 4  ,@r  % /Ƞ /؀''O Ԓ`'ԀԔ'Ԁ4OԢ" `.`3 %a $$` ' 'i p`a$$@ ' 'S pO   $$` 0/h/ih $$` ' '/ p4Ԣ" `.`/ %ᰨ $$` ' ' ep`4$$$@ ' ' Opآ"`-`/ %ᰨ $$` ' ' 5p`4$$$@ ' '˒ p e$$@ F  BV " $$` ' ' p@$$` ' ' ߤp?``/ %ᰦ $$` ' 'q Ťp`4$$$@^ `` " $$` ' 'M p$$` ' '; p `-`/ %ᰨ $$` ' '! up`4$$$@ ' '  _p$$@R$$ @ ' ' Bp"@`-`/ %ᰦ $$` ' 'Ӓ 'p`4$$$@ ' ' p " $$` $ @ ' ' p  " $$` ' ' ܤp$" $" @ t  4 R   ./h/ih $$` ' '[ p  B$?$ .@ ?`4`/ %ᰦ $$` ' '/ p`4$$$@$$` ' ' fp$$ܐ @ ' ' Rp1Ԣ" `,`3 %a $$` ' ' 5p`4$a$$`'`'̒ ! & '  'Hp  'H Z '` @? %  @"8 %!Ȑ '''/*` *H*`**` * *`@o  + %a@i  % ? ;  N `Z1Ԑ#*` €N ?  L* @ L*`ДЀ @L $@ 0+N*4 N ?  L* @ L*`ДЀ @L $@  @ @C@4 *@ @6@4 *@`Ѐ NЀ   +  * ?И NЀ  $ N h2@ N l2  }{@@@4  @@@4  @@ܒ@4  @@Β@4v   @@@4i  @@@4[ @ @@@4N @@@4B  @@@44 @@@4)  @@s@4  @@f@4 @ @@X@4  @@K@4  @@=@4  @@.@4֐ @@#@4ː  @@@4  @@@4  @@@4   @@@4  @@ݒ@4 @w@@В@4x @@Ē@4l @@@4`  @@@4P  @@@4C  @@@45   @@@4(  @@r@4 @ @@e@4  @@Y@4 *@`a耤* &#\   @m\?& )+ "  `Ԑ#*` €`@?``@? ``@?``@?`` $ '  @Ӑ#㿐@ *  #\  @m?&@@#\ ? @l @o@n@& @  @l$@ &@㿀?"\ f#   e E   # 9/ -/?#\  ?@耤 g G f# fJ 02 @ c B  '@@ # B3'@   0`*@@ '`" "@ X %!'`, -,   +,  쀦`   0.w) ` `0..    0. `0. &  @ #(TTlp㿘i#.  ` @ " ,, @hÐ "`"`"`"`  i`("@ 㿘? #  t @t4`4  *  $ 2  ,   * @k ː, " & 㿘 v  *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? cs @  s4`4 444 4  $@? #s 4 4s4 @   4 $@  $'  "' 㿘`  %!*  >``#!j (```"q$ ( $@ 2^$@"`" >`U>``2@㿘>`@ *  Z `` "? * ` " * " 2@ ` " " ?& C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  :  4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐T ?. . 6  `''`'   " *@ $ 2 '$   $   $ ΐ $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?`  " * " *#??ā`@='H   @  @' @ &  `  2`M@ - + '2M@`M@` @`0 *  `M@`0 @`O* : + '     -*   ?4`+  *  ?Ъ`M@ /9뀥 :`E` =M@0Ϫ`M@0`π 6e ' `(``   -*  4+  *   -*    +  *    M@Ѐ Ӓ`e EI 2 `2"ڪ`M@+ -І `M@Ѐ .0Ϫ`M@0"`π !Ъ`M@ *  `M@?Ѐ/9*%@ "" 2     `H &@  '  HB?   ?c8* @ $'%H   HBD? >'@ 2:%`"_H%`   #8.` ?$%% B"@ $% c8*@?$&@ .`% B@?$% B  #8*` ?$% ?*%@P  #8* ?$% B?4:Κ "" %!䀢 H    + @?$% B?: + ?,$ ?%( B?  $(#a?_]   #8* ?$% ?K:4   ` + ?$% B?: + `@?" # @ D(?)F!?()BD F?  @ ""䀢`|H 4?@?r  4'''o  0[5 # @  I ?   ?  2:?8 ?  ? @! B0&   P!+'   `X&1'?  "   X!``  X  `h hB'`hB &'??@?Ѐ B- %?,??? @'cD?   #D?  X  `hB B?f?? @D?   F#' € ?   p  `x 0  ``` *@eʒ` ܒ `       $@  ?3 6" @   4`% & $@    4`( "w & X  ?H 2"?"쀢 #㿘 t -    `p `1?#  n @n4`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' hi#'L'P'T ?i# *@  ""i"#Ȁ`6'@ '@ * ' %  T#"@̀ ?  P      \`N    \"ఁ B T "\ հ` "  /Ȼ2g Ⱥ| ?* &' d2`   @Ȑ"̒*2   ̐"*@'   B?{͔ ? '?   ' ` ș D  HFBL ' B# ' #8, $ȇ%)'#?    '% 'L 8'LL` 'L L "'!* €?'? 'P'P`P 'PP' 'P``' i ` "#  ,  `"i"c ` Ⱥ  '   c8* @<"  # Ƞ    ?Ȁ  # /`@ &' B<  `ȅ!?Ȳ `c8* @>`$Ȁ %B? #  /`@ $ȇ%B?ȡ<  `耢  ` 9' 쀢  `艡 B ?' ȀF ?0D'@'&    '$% ?ȅ)  P?䀢 I c8* @`$ %! ȑȍB'`0-@ȍ…&' Y?  Ɓ) 0 @6V?ȕ$ % ȑ DDB?ȅ'`0.Ȱ …&' 7?ȅƁ)} 0`@4?Ȑ* c8@ $ % B Ȁ@B'`0.Ȱ ? !D-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZX #8, "P #     ` Bȁ  1-@ Ȁ@̍B'`0 L.Ȱ  ?ȉ"#B  ?ȅ$%L` 0?N 92?-@ .   艡 B ? D`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 8 } t L̀ 2'?@2 '   ''  *` s '@ `` "```@m g耢`    ٔ 쀥L  ˔ }  1Pɤ8 1-@`Ĥ``,܀'  Ը* @an     Ԁ   ' 'Ԑ  `Ԣ 06L  *f` L` ̀ `9+ 4`f.& ``L`̀ `ƒ  4`2N.`"K.``:  9E. `9` 9., ;..@   ( ` 0.@  Β 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ ߐ2. 0-@` .T"\2"+dd 0(# %؀$j %!,       $((()(*(+ (,!(-"(.#(/" %܀  %,", "` "`"܁,㿘` ` ` 2 @@ "@ǀ? "`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @]>` ``&@$`$`$@$`` "`*@@_`@"@$`$@.@` @_ߔ@@@H$@ 2` `` `,` $u` ` @_Ô`@"@$`$@`" $&`b   `  ` @!Ӕ "@  `@ ` `@ @ @_@@@Hx$@ +0@ `,` 0   @_o`@"@$`$@2`@HX   `" $&` ` ? @4` 㿘 `2 @B 2  $ "  0`  @@" 0@\L  0" &   ?6 &  6   2  " @b?@Hi   &  &   &  㿐@S͘;`` (` `?#;```0  ?2 `2 #`    ?"J@ @"J@@ 㿘 p %  a􀢠' ! *!h@ `   !*`!@  @'@_  ! ! #h #\#` #d @S?Ž  "  @" 㿘 㿘jj``  H@a  H 㿘@H & x` ``? ` ,  "??, @`2`Q! %!'P'T'X'`#`ذ ''" ` ` @^!?"77''''牔P*!  @$"0㿈# %a a  % ?'  @a~ ?쀢  , ,a , , 8 %! '?''Ė  '''''b@ @]֐?' @]} @$Ð @ ''' e ŬƵ Qx 㿈/ / * @*`"* "@*` @Z '<   ?" "? 0" j`j```` `(`0`8`@8@8`8`8`8` 8`(8`08`88`@`H8`H`P8`P `0!`0" `0     !'@]'`X?ֈ!㿘 ` %@Z %#0   V  X 2 $  ?6 6 && & & & & & D& H 0" 0"` 0` ` @]!㿘@a  %0 " `0  ` "@` 2`[ $㿘5@F=!㿘j!k 0b $@$$     @]U!`X!@F  " $0ht(4@LXdP\pp? 'Ѐ` !0*` € G  fN耢 ? d W  7  f>耢 v?t ,  )  C  #     : !              'A'ؐ    '9'ܐ                    $?ؐؒ ԖИ @_ ?Ԁ ?  = ?' v " ? ؔԖИ @^ ??ԁ(X\@Y    % bx@\"d! ` ? d@X@   ` % bx@\"S!@$`X - `2@< *` V`6  %#@$$$`  $`  ?$` $`$``8$`$`\$`T$` $`(@^$`$ '''''`X@: @:3 +``<`€$`P 6$` '     '! $!d!d$ @;N  b~Mؔ$`@9:$@ $`@X @X 㿈`'' #\a %!'D'H  '`(\'L'P'T'X?'X`@'d'``$'``('d@ '7''`8&`8``€`P`X3`€H D@ € PL€ 2` &`, ``€'T@`X `ST `e  &`,&`0  Xd  &`, !T'!T ' 'T''7?/ضb@!b? `#* $, ` f, e  " ` ?/``^``Z 'p`  't?ppt'` 'd&@>&`,ހ   "5``"`Ix x"@|'p"`'t@?pp@'ht@'l@?hhl'` 'd&`&`,o \ @`\'\ LŚ  `"@  `#"s` &`,L&`0(k``X``@ 2e`@9N @8 .@9`,`, XD@ `€   &`,&`0  %@@8,`,D@  @  X'X @8s''&`,`, %!  :" ,"@0"`4"`㿘  " 8 8@%  ("$"($"(""" "  "" """   㿘   " <dv < `@ 8@V@VҸҰҸ|렝㿐N "?'"@ `2 ? "?J 2?8  ????' $ $ $ $ $ $ $ `?"V  2z? 2v? 2r? 2n??h? "   "]?$$  $ $ $ $ $ $$ ! #,`#, 2`"    "/? ꀢ    2/' ' ' ' ' ' ' '   $ @ $$ $ $ $ $ $ $  '  ' ,' ' ' ' ' ,`n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   n2m? ,g? V,$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @+`` `` `     2 `?&   "&@i&㿐a8 !@[ ̤@  q @ ?  `@< @ 5 O  `@< p@[U!x`* J@ %J@ f" y b  2 @ @Ò@  `J@ ဢ f@[*x`@S `  &  Ā` !*` €???`@x& ' M  `1 b @ 2) @g  "$  " ``@א  $  @А $  ?@  & @` %!'&'ܦ@ܒ G @/ @ @n 0@`,?@ $#?@  @r   ` ` ܰ &܀ !@L!   㿐@ 2E @  2 > @; %   .@ $'?@S͐#?,@t   2 @?&`2@S㿘   @&` ? 㿘`@Sg &  $  $ $  $  $   $ `$  @V$ `  *`@$  $ *  ` `@V[0 㿘@ 㿘`"M    2G         ;?9?7?u  ?#@!*? " $?      #!@Y @ے@Y `׀`2     2  2     ؀     㿐N /?`@? ?@?@  ?@o & " @&`?  J  ??c( %!? 'D#"  ? 'L'? Ⱥ?  ? `  ``D 2 D?Dc @`#@??Dc#ج `  v"`?D@ #@ b8@   _"`Ā`@``?@U̐   N"`Ķ'L? " $?#@ ??c?@@#@D @ I D"8 "?@@ * 2 `@ * `4 @ * 2 ` @ ```4@`(`?c@D@@ $ b8@؀ " @Ugز@ 4 @9 @```@耢 ({@@ѐ @Ɛ@Ð L`X@ %i@``@   `( %@~W@`` 2Q@`` 2K@`?@T ` ?䀢 ?#@"6@?@T ??###### `     ' ''' ?' c' ?''   '?c` ?@*# ϔ & @          2  @S ?c@@`?c@#@   ?#@??c@@` ?#L?#|?#"Đ # İ  %a   8  ??????????''@P@  @P@ 2 `@P?"`T     0! 0@ '''''''' '@''' @?''Ȑ@t @P@P% Ā   $ `     2$ @P@P㿘! %#X    @`$#X@㿘! %#X @;w$#X?ch %! %cX ' ?   @` '#X c@ ?##X@ v M # `@   ,@ `Ƞ ?,  L  *`:     "@Ƞ , @H  ? ?L  ?`#`#` #`#`#`#`#'''' ' #' #' '   G ? #@$@`I ?  2@?#a   Ёx  ????<  $ ` ` H  8P  ? ???)  @7R `*@  @h 2*@`^\ `J@*:    `"  @O Ȓ " `*@``"`J@  @` `'` '`'`'`'` ''' 2' @&@`  2@   $` ` Pp!  !?`??? @% pZ p!|`!|@O$ ` $a| .' @R{! `@)g !' ` @'` '`'`'`'`a|?E'   $ ` ` @RO!a|@)< 2a|)   $ `` 㿈a8!Ȗ @U8 ̮@N@ ?"`k?@    T" Ā`;?#`)@ $`` ` ` #\#`@3#d  @@ 4@&   2   2   @&`@`2``!ȓ- €     "`@Na ? "`@NZ0@NW㿘a8 !@T ̤`@ 3    " \ " " N J .Jd?`2J J .`? 2 d@! "dJf2  ? @` 4[Ĵ   2 D 8`7"3D -D@B 4= `=4Ā "   " `2 ``  2`""`  `" ?@ ?` $ ? $İ?㻈 %!a8' !@T ̢@  `" 1?@P$  ?N .2 @56@P@P $  "` ?$  g!(444㻀 %!a8' !@S  &@ 5 G" Đ$#d#` #\  @ʚ   @$@X  )"`Đ@ 6 "`Ē ` 2`#*` €     "`İ?  ! 㿘a8 !@SZ ̤@Ӑ    "  " " N J .Jd?`2J J .`? 2d@ ^pd2  ? @f 4aĮ   2 D ;`:"6D 0D@E 4@`=7Ā "   " `2 ``  2`""`  `" ?@ ?` $ ? $İ?㷀 %!a8' !@R ̠@" `" '? @O?"N .2h@[ , #\0($$a  !@㻈 %!a8'  @Rc! @2x  @Nѐ!P 2p l @ a` f@. ZJ?` '#O@N, L@  @? &`   ` "`;,@@ ђ 0 & `L@?   ` 2`L@ "`1pJ ? &`   ` "*$@33!@6{ !@H @6q !  t!hHa8`d !@QӐ ̰@L  " ?`  @ m@R6 @4 *` * $  >*` a ?$ 'F'$@]?2[?$@Ԑ@ ̰.2 @.2  @  ?4  <$@` @l @Ӑ  @ϐ @ϐ  @ǐ 4  $@` @. , @2 . @2  @ /`2 @ ` @4 &㿘a8 ̔!@Q< & @)?  )@.@?# .@2  . .`@   @u @r `   &6` 㿘.`  .2 .   ,,`6 VW2 v6 , 4 VOn6` ,`6 㿘@O%?'q)!$ #c4  qq2@Oz2a$ q @Os2a$  2 !q 4!! q2a 5q3 %-q7q1 %4!! q*  `@OS#$gc4 $᠀`  !x ,,`2   , U4*  2` , 2   ` ,2`x 6 6c\#^ @ ` ? &6#^㿘!q  ! %c\!/ q!! $qtqq)q!a' !U˒ူ?4!q!q!c\@ *`ᚔ2`35c\qa %^ . 6 X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@ $H , $ H H  % p % t㿘a8 !@O ̠`$h @O Ȕ,` ` ,`㿘a8 ̔!@O   6 M I ?#̐ @ @2  @2      ' @@T  ""   0?#   @ @2 `"  @2  㻈 %!' %@ј$ $@@* `4 @* 2  ` @ ֒ "   !  !?㻈 %  !􀤀 '% #? @$ @@D* `4 @?* 2  ` !  n!X %!a8''D'H!Ȗ @Nʐ ̨D'@A ?";?  'H"$  '  <''Ā@ '  ' @  `   @? ` *@ %#p`"  ܤDHp`#*` €   )4? p  %#` `'  % % %#h`l @ J#` @ܒ   z$l $#`"#`UH܀  % "chJ@HD ''''#`Cz H`  7ֲ#`рְ  ֲ@"@*` 7ր @ 6)Ā`& @'u @X* 2 'آ 77@"7ր#`O ր  `@m@ "b* &7֑* 2 ""#`. ֒"@*` 7 @  #`` % % %h  l @ " h @1ܒ   y$l  $#`R *@@  %"#d $ 1 %  `#d 1 %#d  D#`T܀ # &#dD #`@HH#d   /'7#`Tr &#d"D #`HB\H " *s@* `'T ' 4' ''#`  @?2  \#` 2 *@ +  &@   dĐ @FŐ  `#`0@ ='"!'а#` ;͚Ѐ -' '@#` $ (` #` (2 DH #`    2   *@o@!` "@    " @`'D  `a %@Q %#t`  DctܚH`1#*` €   )4'? D"ج `@'@" Ȁ`E? = "@? <";"? %!  !㿘! %#`  S? % % %$#`"#d"h"l㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@x  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ "? >*@*,2$? $     ? " ?` & `  ` %x*`P 㿘D`4 ` "' 8?, ., \" Ȑ  < ` "&`."  `?*  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*` %x(P㿘@ 㺨 %!a8' !@J{ ̴` Ȕ$h@Js  ''    @ Ā@i %@  %c|  &Ĥ ͹P?  x2&|@P %&| &2  F % B % 2 & 2 & 2 "&  5 .6. &@Fd<*@ ' &d c&  @+M&`]#  2B @F}# ;`@+>!N` '&DH" \ "NN` `  .  $  ' N`` 쀢` NN    2 .$@` ~' `@* /c' #_@F1 , `@  .O N `@  ( Oƀ  #`(`2>N "  " N 0 .`!@* @ Ӓ` 2.!'`(@  2@ Oƀ  : @  ƨ N   L y b f*  ,  L y b f *  " Ӱ `0@  T Oƀ  O`8`2N "  " N  `!@*O@*C 2.N` &DH \N   . " $   N    N   2 .$ '`8@M 2q Oʀ  2k `h N "  " N f d 0J ? &`   ` "*  ?0?8  ?H?@'0'8 H  5ِ'$m$ &$$` 2!$`/``@E$ @EW!$`/``@D `" " " " `$ "@G`P@ה   OȀ   NN "  " N   ;# ! & `@ `  `2N N`" N@)bcȀ 2NN`;瀢`N.@1 R / h"@    #@)J 1l.   &`   `  * N  ; 쀢?*: .@  $@@,@{', $@@,@u',l"@  *` %@ @% @_%  @ Y / @*` "  ####Ƞ@## ̠###.   &`   `   N  ; 쀢?*: & ./ @4 @Q  ?    4,, *,``  .``@ݔ   Oǀ   `h@l@ `4& d **` &d@+N` @0  @(p .  `@(s!`#`N`  &DH&H  PN  .Nd`2N @(O . $ `$^   & @Cz p  @` & %!  凐  㿐a8  @F!ȢN x#% *`:   N "  " `@F  ' @4 NKK? &`   ` @ ;+ad* < 1$ad@  + `@   ``@   `$`@  ` (`А@  2N` $`N   2 N  0 ???㿘 @Ĕ  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  ` @?@? 㿈  ?'  @E5 ?? )))D)l)㿐@ ?㿈 & , : ?   `  0   N x X    & , :  ?   `   K,  ?Г:` ":  ?   `D , :  ?*   `  : . 􀤀E $ =? &`   ` < $:` `2 "*` €?#!耢 * #?#耢 쀢`* *`  耢 쀢`*   *` * `2&@ 㿘  0 @ @Hذ? /"㿐N  / (   ؐ@&K " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿀 %!' @A N :   N :"Nt L N  `E ?#  @%  !@%  ",߮ )N`:`.`2H N ΐ ˑ4, ,   6  @2h  ,!N`   8! 4, , `$   ? % **  @@ٔ  !  !    (     @ ` " ( @ @ @`  @ # 2 @ 㿘 @? @$㿐 ^?@)`0@`  `@@"`0@= `0"`0   `"T` "a"aT` $` $`@={` 3\@)ܔ `@=;  ?@=3`2  `C  $`4` $`$`$@2(" $`4` $@ $` "$` $`$`@*' 㿘   2 2&   21q !Ғ 2&!㿘 "ݔ 㿘 "(Ք 㿐J# ` @    # &@Ȑ# `?㿘&J# ` #  @ ! #  # & 㿈  ?'  @Bs ?? 㿘`40C "@"&&@?8,   `a ?"a @” ܒ`"&&@?&@`", 4@(  ހ" ,㿘 @C!@$J ` @$?   2 `"  @$0 @D "   @'I&㿘!q”!Ȁ  !ȁ㿘@   !@ca&@@` &` 㿘 @'&@<%  & @Ӑ& &` , @a  ,@`L@L@ "` "`a@ ,@  J 2@`?#@8@*`2 & & ` 2` &`@;| (  &`Ű?v<"` & @\&*`:  % "$ ` *`?2$ @;*` `* &` $ &`@ & $@8Ḡ " $,  "$L  $ 㿘c㿘+#㿘!qc5!؀  !؁㿘 H* D  @;c "?& H& D 㿘 4@& 2F&@ @E  $&@ @ "$4 4$  @/  $@Ò D@=$"@$@`P $@D@=ސ@&l ئ&@D&@ "  `  ?2  㿐@( & P  3! 66  777#`<6 6 & $& ,& (& &    @( 㿘 @\  6 "( `v(`L  ">0@";0=@&t @2P  @ ? 2 !?  0 :@ d < :@  d  " : @ DE      a "2 @&q h Ȁd7 @2 T & X9 2  <   (4 А$$L4 2T X  @B 2$0 @" P  @ ? 0 @ :d "0< :@ d0`" :@ D8<" @d  "@@d   @2)L4&L@@ @D 4%@2L@%@&0$$@` @@"0@9 0"  ?X4 L  :  @ @?2$$0$` @@"0@9 0" @ ?24 @$  @ "@$$$@%c  ?@?20?0` @@"0@9U 0" $ ?4 $ 㿘 ;   J H ? 2H  J  㿘 &  @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0   + #ؐF $ $`   - &, "P %  ?"% D" ٤#"?D  @`? @ `  ?ʠ? @ `  ? @ `  ??` &@㿐@&    "  2 @ 4 2  @{ { "x   ?''D'''  ܘ @=      @8ܮ  ܘ @=њ ܚq  h   2c  ^ T`  T ` ?@` ` L`D/ 2 ` @:g>  : `    * @"   ?     + "    ? 2@`2@@ + * @ ,`D "@70ɐ"* @7~ @7? @:ܢ @    2  1 2  ) T %` %` @:n \ . %`  T@:d T   ?@`` ?%` @:T D`%@ h`Df / 2 ` @9"Y  T`` %`` %`%`   *  @"   ?    .  @"'   ? "%` "%`" %`  @:S@@9@ Ց.%@ܨ *a @6䀥@ D%@""@6 㿘@6㿘@:? @6 @9”0 㿘 &  @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0  EP??Œ  + &> ? ""?BL  @`?` @ `  ?ܠ?` @ `  ?` @ `  ??à4 `2&@㿘'L'P'T'X@L㿘 %c@%㿘 %@、㿘 %@ϐ#㿘 %@ђc㿘'P'T'X@Ph %!'< %#@   aȐ ## #ߖ#` : ' %#` %#@@̠ ڎ((  (6'$@@ ̖  @ & 6$` 2` 2`  &`` 0_ & 6$` "`| 8K & 6$`   :,  , *` B$- + :  %!`%N m`% @ @f0 b@ & 6$@`N % `` `. . $. *` ő: .@[ & 6` $' $bP '''' 0ڔ `  `` @@_@@Ȗ ?,`7@C@M@  @@ ?`7?`  "X -  >@ $ $bh ''''А0B_ @ %@x %!  ː"p㿘?"& BG?&&   %!'2   gl ?3& J: ?-a  )  ? j ?/??????????? /b7@3 hA j? B&& a  t"㿘 2&& "&   &㿘A?&& &  `"`㿘 / V`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<``<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<`<VW`WX<VX[XX`<`<`<Y`<V`<`<Z,ZL[[,[]^h^_`<`<`<`<`<`<W WXXLXl`<[W`<YY,YLYY`<Y`<Z<Zl[[`]^H^t^_x㿐@C' !@ "`2*? *H %!'Lp`%fL`z` 0*` €Y`` "*` |  !@yG`` "*` `  !@i7``  "*` 0  !@Y'``  "*`  !@J`'l  @O c@   ' #`  a@ `  a @ !(` a@`  "  a@Ͱ`  a8@ݖİ` a @Ֆ` ߒ "  a @–` a@`  a@ !@@Ô`  #H #D@ {!H w!P@ a@t`@'`'` '`'`'`'`'` '`$'`('@ 'ؠ ` B@O F# !p@vD` `?@|" a@P7` "  ax@E,&@g i `'l`` +!F?A! 2m!:!63 d 2n!-!)&! 2mn!! !m!!  d !n!!! !m!n &? $?&   4` -` - 5-:  V g  a@ '   @՚ !``` " ?ǒ   ?’  a@}` ax@u lc8 c< '` '@fd' '`'l  @Q`'l  @H`( @r@` D`  %c @ @c9` 5`$`6  ! !@Q?[ <?X <* ,  <, = a@#  cL  . L    /!㿀# %a' ΐ@ a  !@ `@  (*@  㿘 d d> d> d> dג d  `d ?`    `  !a  &  aJ ? * ``㿘q! % %#c"c"x !<L ?*` # a a %x#a<L *` *     *`  a`  6ax!< '  _L@@ Ȁ ",@  &L@a`  x!<) T@3 @" 2,` ?` %!' #  N : /@Ғ / 2  bH@  2  N /@’ .   2N "P "8?N :" N /`?% "``")?@3a@3^ #{$@ bx$@ $@ @ . 2 D6  2?( ?X? =T 2?` ` `&@` &``$&``(@`, 24&` ` 04Ѱ?` )ar4ʰ?`#`24Ű? 2? 2?*@ +`*` `  @? *  $@ $ @ ?&` 6 ``, & ` `` 6`e @*` `` & @` 6` gL`& @` &  @``& ` @4l?`  `   #L@ @*`   `#L@*@ 6`!L@n&`j& @ ` ` gL" "` L@` "` 0?` ` 6`gL" "`L@` "`?` `` ? ` , + @ @ d &  !  א"JJ Ѐ ,-+2 J *`8  J2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ; *@" * @&@N :   < 2@  &@㿘N -   + ’   @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` w  "$ N . `      &@` !ma 2N  / v` &`㿘 `  d 2  ے! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @ "*`@ * @*`" *" *       &@ d; d,`@*`@*`;  :@``: @.`"@f  &`@ ,  + - @* *`     &+  * "*"@ *` `  @0!'N <  >N >2D?&e&N 1ђĴ "4? " 2&@N  <Z >N >2?&?&N  , ;  2N?Đ1'N 2N  #N , ;i ഒ "?N ,ȴ "?N 2?Đ     &`&`&gL&gP&g` &gT&gd&gh`eب ';  ĔȀ$ $@$@,`$@ ,,`$@ ,` b而  d 2  ! . .*@ *`" *" * Ȩx&` 2?  `@e gP* *  ``gL   eؔgPgL@@6  * * ``  @1 eĄgPg\gXgL` * *  `(  `2*" %% #* * ` ``@ۘ Ė   &gL&g`&gd&`&gP&gT &ghĒ  &`&gL &`&gP&gT&` &` ` "8?#L@@@@ 㿘! ! ! 㿘` ?"`!q ! !/㿘!@2< @2: 㿘 @.# #۞` #@ 5@/!@ $`#@Y!L 2#qq"x "T"""P"L!<a@G"0Ta L :a: a㿘!@1 @1 㿐q!``'`  % %gP@ *`` e% %`    * 6 @* , 'L@@@~ &  cL @ *"@ &(㿘!@1 e @1 㿘q`! ,@1 " 㿘#@1|`` !y "` @1s` ̒@>` %# &(㿘 ޔ㿘q`! ,@1V " 㿘Ɣ㿘  < 8ϒ d&8˒!88㿐 D !L!P * 2.  4  *     *   @2   @   ?   @ɑ*''Ta8u,`@*`" *" * &$8h!n ` ?'@# ?$" * *  *  $@$@'` "而  ( d 2  "! . .@ 6Đ,`@*`" *" * ' %T#DB'8,`@*`" *" * $&@ T! ?"   @? Q  ؒ d 2  Ғ! ,` ,`   "而   d 2  ! ,` ,`& @  2u   d 2  ! ,` ,`@ Ӥ&@l8 V &ʐ?ǐ'xN  "@@ &{  & &7.&o.7 <& <h&`  _ d 2  Y! ,  ,  * b &*``*`&& 6& &$& 㿘&;hͯ "  2` "  2`㿘@ &87!784@"&@㿘@ &87 784ΐ@"&@`` ` ` `@ ('PP" ' ''''' '$'('' ' < f?В < ^?  W?ܐ' N?j'l H?Ԁ )!n' _? 1؀     l d 2  f! ,` ,`@ `'Ԁ!n() ؀   "  H d 2  B! ,` ,`$ 'Ԑ  Ԁ!nݤ' "@ 'Ԁ  ''ؐ  ?ؤ*    d 2  ! ,  , * @Ԁ@ؐ8 ð?Ȁ`;'''l'4'ʒ?ŀ ?Ȑ ;''''Ȥ  ,#TF8yq! `? ,`* 'PgP耢@2-?`? (, * 'LgL耢@ " '@  ĒȀ 2?耢@?전??좄Ϧ[?44  :`: @@''@4'@  ? `&' ?'`$耢` ~@  @' 2"' ?@ P "@㿘n  d 㷐   & `" v && #Tyq!  6 *" *?  ؖ  * `2" - #@ <  @6C?P-`@*@ * 23` 6/` ,@ *` *  @L-`?"@  && }`2 "@  " `?&& ؕ,`@ő-`?㿘!@-  ncT@- 㿘?" 㿘& `[ 㿘& `Rq L*` 㿘'DDD&㿐'DސDD@'ِD"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  㿘N@ `@)N    2N@ 2N?2J@ "J`  2J@ 㿐i  ?&㿐 !А4"@'"@* "@*`@*`'@,I  ! %!'''" ` ` @)!`#`? "77''''*!  ʳ# X  N "g @) @`"` N@ "\ @( @$'O '@@ΒĀ  %F # Ė ?'''?'''' ` #\ ` 1 1` П"P     `@c0Đ?"`h@1谒 bP`@%"'@ ' @(4@@*@bP@ @āP\ `N "w @( @`"p N@ "l @( @$$a '$@'@@]  %V #  ?''?'?'''' ` #\ ` 1 1` П!䀢     `@xcH?"`h@ఒ !`@$'@ ' @'@@*@`@$$@ $ @'@@*@@ &@@ %!' 'D#`t  ? e / ?`#2'U 2#r %#?#  ` " @@$ 2 `%c`$&@D - @' '# D@ 3  2 2 h@$0 l   @' l?& \& h  h 2A hD  x㈒$  ?"0 h/t !U`#  '''Ē '@*Ē@ 1& h1l1"̰ @$Ȱ     ?   ??//'a'b  @" 2  @Ԑ#" @# #   % @" @#ݐ #'''' #\@11  DЀ  "   % D"@'#c `€ ?c& h @ `* @7 `/# 2 & H"W @#S   & L. H. I& P& T ` . J ` . KԔ A. L `. M `. N ` J. O6 X& h@ -D %#'̑2`@:`' ` ? @& \a''b H ʸ \ & ` @A# & h \ 8 ? @ߐ#c&%c`2&@   E 㿘 ` @?& \& `㿘u 㿘#  @   2 ` @`$@$@#0 (((00(X(((((((((㿘1 耢 2 @"Ő!&  㿈 !q `€@x !LJa 6!! P$@ 耢`>&!*` €@ h7  Pa@ 6 ,$@ @얒  L`  Dh  ;(   2 `. @~!0  & 㿘 % "@%Ӓ`   #* 㿘 % "@%``㿘W , !d`  !d`ې  Ԑ @0 8ߒ!  Ő  HԒ! ,`,`㿘ː % "@%~`   P* 㿘! @4  㿘  `"@ J@  "@ 2N@@%L  @ *@`N &*@`@!  @! d 2  % `X@%/"! $!d!d$  2@ *` 26 @!@!y  6#$`  Td &@'  /   ! $!d!d$ ?O`/K`$`$@$` $` $` `L$` $` d$` @&' ''''Đ`0 @= @ 2 `P` #`.``€`P$`H``)@)) b@ %#$@$$ `@!< @!7 h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@Ӓ q $@ϒ  $ $h 2@d   ` % $ $Y %1"T&@'`T'`''@i'耢 F@  $ "'0<Ȁ2' @L $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@X $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " P- P `@ L@ /@ -p2   * $, ,  '7.#c% Ь"@  -) c"@'"`'ܐ@? ؖ"@ 'В"`'Ԑ@?В#* $, -,  $ `" & $` 0?   """` & (& $?~ 2 6 & $& (? & $& (㿘 Rb?&?$ $$ ( @㿀!! 2  < @ @ 2$!+  < '!T %!T&  c&  && &  &  & @3 (@1 @. @& <  `@㿘!  ` (<   L(4@㿘@   ``@ B!㿘@  㿘 @` " `    ``€ @`  @`㿘@Ԓ " @   @ݒ`  @ؒ`@` 㿘@˒ @` " ` 2   %` `@   㿘 &`&` 2 @ @` @`  @` @`  *d*  "@ "@ "@  "@ "@"@ "`"@"`     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &``" & %" " " "    " " "   "@   "     # d? *(#d d*`  *` *`d#@ #  #"@d 0#d*@  *` *` *` "  #㿘  " $ @   @$  㿘 @ "@$  @   @$    "    @ " "        " "   㿘@㾀 %!'`2`!'G쀢?2`^?@      '`  ' l? .G"'` ' ) .`*  .@ '䰒 0!  )! !A !И  !3"@ 쀢  %"!   xp & o6 `<?`<!'''#\ab7ڐ å! / & D' D`2''''' ,#\", ڀ   "ad ad`  ڀ 2  "ad @܀?"6 *66 ځ㿘@l @g`  @b` @]`  㿘@` D  % "@`05@ @$ <@ @M$ @  $  % "@ے`@r0 $   2 $   & $ 8`L& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @- 2  & @ "㿘   4   8 2 @b 󀦠 8@: & 4"$ 4@㿘!    " 8 @Δ & @@$  @$ @  2  㿘`   @   ?@  "  , ?  "  0" &㿘 ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘 @\ @Z㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` " @? ?"   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@ ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?p %!Ц' N  @'$` ` ''ܢ{@ $@@$``   $@:$@$`   B 㿘 (  㿘`    `*. "C  0.(Œ ` -. 㿘  @ޒ   \, @@b@  "`?@S@  " " @.㿐  & l   aH#\#`ް ""㿐 `ؔ #\#` cp   㿘? °?  "" La @ 㿘?2 ="    6    ?@ .@ 2`@:`+  * @    @ ` @ 4@ 2  : + @ *` Ҁ6 ?6 ?@ ؒ@ 888888888888888888888h88888888h8888888h㻐 %!' "?N @ / @w 2   @ 2    @!(  !0J B  ?* : `(3/#*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@?2 L 2 L ?  !8 O ?,6 & $?#\   @ː &?2???#@ @<  && ĐK'?J      (+  2 2 " 2+J " ?J@   J@J`  㿘@& " @  2  @`@`㿘@  `@  㿘@ޒ㿘@  @` @(` 㿘@c @㿘@\ @㿘@/  @"` @`  㿘`@ܖ$㿘@ @` 㿘`@Ɩ$㿘@㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐N@'Ȓ  .@ 㿐@'ڒ  .@ 㿐 "    0@  @ '€@€    @ &@  㿘Ȓ㿘$ "        a2      2    & `p`?㿘@l "2  2+ "   0"   @&@   % "@ bX    @&@㿘`–$㿘 "   @ "  2    €㿐 @   "7 @А' -8+ `  ` 0!  2@'&@   % "@bx ,1@A&@  㿘?иȆ  4h(             㿘T 2 0"? 7"   `" "a"a  @ `" @  &? " 0@  0`  @@" 0@א  0" D "$ @$ D$ 4 $ 㿘    ? ɚ @G  㿘 0   `a ?"a@  ? ?$  @`$㿘  @㿘 `b U$  2 0  ~? "  @J4 "  @_ C? $  ?4 $   4 ` @@" 0@T  0" <`$  8 '$  2 @{ 4@Z"  $  $  ?Ȑ*@$  4 2 @ 4 4 $ ? 㿘 2 5@8!  @ ~/? "㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘 %#0 ? T` "??`X2㿐  C & & '&@%@    C  & 6 & &@ `& & & @V  2` 6 (T  &&1  &< А`?`&$&@(&@ $ L( (7 @"$㿐@`P? %a  @      @Ҕ  1 2! #\   @??  2$  $ $  & x2`$ $$ "x  * "  $ @  "  @㿐@G`A %a  @    #\   @E?? &x2  $ $ $ $ "x@a  $ @Y  @b㿈"`"   '?   @\ ?"?"` %!'    @8@ { aa  "㿘 `㿐@  (  ``  @| "  " 3  `6!3 6777#`<3 # $# ,# (#  # 㿘T   P > B< P ?Đ*@4 㿘 ! V  @-  ?Ē* 6 V D㿘T   @?  2  ?Đ*@4   4 < P㿘V 㿐 ݔ  ??#\  ǔ@  ˒ 㿘N r   w a  0 0       & "{  "N + b @ N  +@   @ &@ (`` {ٰ  "@ !ܠ ?$! $! j?$!{ '3 !/   Ā@`@  ` @ L0 & " &$!  |$! !B!?!{r2p O!a@2j O ?   !  €" @ " [ O (U $!@Ȑ 2[   D* !8  *@ :@ *`$!@   `@,$!0@(@$!0  ! @ ?$!$$!4@ $  8{? @ܐ{:%"9899:9!hcĔ#Dc  & & & & & & & &  & !@{" 㿘 ?@ @㿘 " ? !?z? "( & |` ! @$ $ $ $ $ $ 4$! $ 8$  D @   Ē @ @`  :  @X$ $ - " @N *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$ z   "$ @  㿘 4u  & @  *  D# *#  * ,& $& `@ " ?!.`2 ? & ,& < & 0N& (@ , @4& @㿘!4@A   zX!؀ !!ؐ?* &! @*!??&!@#!@X 2!z9! 6!!8, @ "!@ ! , ! "!@! "!@!?}@ z ?"㿘` z "?"? !4  @ڔ  2 ?@  2?&!0 㿘!4 4aa!  $ $  "$ @!! @5 ?! ?  y˰? Oy"$!,!8 đ. ` . @ @G  2?  .  㿘 @F y "&!,?㿘  "!y  !  y "&!,?  @㿘 yu !  @  yh "&!,?㿐 @ @ ?P ` ` -` G`   % 2  `@ @h G`   @ "s ``݀@ʘ +2 `'@* 2 `@̖ "W ``  T?` ` @: F?F ` `C `! ``+00 `6 `,@  @  & "@&@k 2 `@  `?@[  ?0 @?? ` ?-`㿘  " !$x "$!,?!$   $!($!$$!  ! 2!$ $!( ( @A "m?$! @ "  ($!$?$!$_ !(*  `2@ *@ @# $! $!(`  @ `!$$!  $!$"! @ "! !**`     @3  *?0)! ` @ @ &@@ ? " &`! ( 2  @& *@ 2" &@  !$ $!($!$$! $!( 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @ޒ !ؓ,` "  ?!! `&!&! (@m    D*` + "&  ,  & ,& 0@Ô㿘@ |  @&@ @ $㿘! € , (  0㿘 @   $!  @.@   w?7w"  + +* !ؐ@" ! `$! 㿘`*  m* 2 *`*  4`$ , 2 @A  +  +  42*`4$ 2+ * 2 4 @`|%0+   &@2 @ ,$@,`4 2 @4 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2 @Ȑ +  +  42*`4$@ 2@*  2 +  4 @ 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2`@W @`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`@y @r 8 ?$ 8㿘`,  " *`2 (  `$*, 2 @k & @ $@``" *2   **2  ?,  @G ??㿘 @+  ? @Ɛ "    +  @  `+ &@  㿘`.  `2.*  ? @ "t?`  .  `*  ? @ ^` ?* @   2  "?@n -,`E?  &" !&  * !$  &!(&!$&!  ?@Q )&!  &!(`@ 2# !$&!  &!$ ,`2 @?&  !@O ! &ug "?㿘`   "@(`! @ 4@  A&!, &!( * ?@ 0&!  `,!$&!  &!$* @ Ĕ $?,` 2 @ ! `@@ 0u "?㿘@  ?&! &?㿘```? * 2 "@ ` ! @ @  0$!  ,&?@* @ ΐ ,` 2 @ !``@@ 0t "?㿈\'P 2d?@ P* 2`` 4 P@S $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`@P  ?6P"$ $ 㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?@   ,$ ! " "@!&& $! "㿘!! @ @!`"@`"@!$@$`&!`"!!   ` ! @2`@      @ @ x $`@   @  ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` @) 2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?     @ 21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   @ 2?`"  "  @  @  " @"!2  @"``"` *` @`"!"`!"@! ` " @ ` ?  2  lXD0`7 ``22`@(* * * * * * * * ؔ   (  H 'T &  T 0.?T2 7耦(7耢 2: " 4`444`4`4`ؑ45 'ē45 5 5  `A'? 7' `Ē`r9`*  r/`*  r%`*  T` rT :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', Eq 'T. 2, @ ( ?#   ?#/@..  ?7'$$66`% @"6``4@  *. ?  @26`@4@Ā2T`#@  " . @?* 2@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 0 2 + ( 2㿘 ` ?q    "@ @ '  (D`|8Tp㿘"L"`` 2 "[&@"`` 2 "Q&@ <`": 2 ` 2 &@&@@` 2 (````"2@` 2 8&@`"*@'&@`"%@` 2 8 @&@``"@` 2 (&@@$ &@``"@` 2 (&@@ 2`  ? p  ! 'Р"@  bt''@ } ''@ y'@ u' b' 'Д 'Đ  &d ""<"d@ep &  bː "@`  '@ I bt'Ԑ @ C'''@ ?'@ ;'' b ''  㿈! & .  #\   @ ? o۰  "oְ  "8x%@0@ 5 5`  `` @ % "RNbl@"" "blh2 %@ :`   2 %#\   @ǘ?? @b,  '$ " `""` ``"`$` "  " 􀤀"` "` oo` $@ $` ` "oe $`  @ """`'H! %!'o= %!` @ +   "ؒ ͔ ? } ,p  2v @ؐ" $kfLđ* : `>UB!*` € &`* R"` &`2 M"` &J"  & F"`C""H ?"bH &<"  &8"`5""T 1"bT.""` *"b`'""@ #"b@ ""P "bP""D "bD""X "bX %b\  %b\! &  #$ $ L  mb\  "b`#\   @? ""$ ?# n  "'"c #b"  & # # # `  "* ne""  @#@㿐# &?` "(   3 @"3 $  $  `'` 2 : ``"'` 2 *`'` ` 2   ې#Pn!  " $ '  * ` ' "` "@`& "H`@ W `6 `T5`  .@ -"""@m *  $;. 9 mڒ  '@mВ*  $ mĐ  '@m*  $bh"L@'bh"` '"L@Ē Ѐ bp "bp@K㿐? (    +?>   >  b$,    2 2 *   *,   @Ր    6 6   : 6 * 2 2@6 6 & @  6 @@Z 2@*6 6 6 6 &   ` ' ?2 * #@ `" 6   2*  (   # 24`   +@ 2*` +@*#  $ ?6 6  4`  9 ""$l* $b$ @&"@b$P b$`  "    ,` & `"@l  $,`   2? $ *` 4 b$"@$?b`": *   ,  @㿘" ` D"<`@"P`  1lo   "ې  & `2  2 #p"\` @u `1#㿐"<`@" `2 Ӑ#"P`c c 5 `۰   . .  .  . @ΐ0ʡ5   #"  #ВF@ 1"""@"l* @ \? # k )   ' "4 k2' )/"`kӒ    ' 4 M2'  "k* @`D H@F?@B"``w%@ M 1  * ? + ?-4@ 4`*   `2@ `  8 bD* 2 @2 @ "``E%@   PE 0ѐ   ` @0@@㿐" ` %#0"<`"P`# #@"& 6     2ڒ   0"    2Β !0Y" +""%"kb* `@:0`  *@?.  2 ؐ 02`*  2@  `  ɐ 80u"`` ,`@ Е,  *@$ ` ` `4` ` "$*` "$` `2 ``"@ " ` : `" @ "  * $@5"@2@2"`2 Ӑ " "`""%"`2 bj *  $` 2``@֔ `*(㿘 2  "G!0d"d %!`@jT "㿘# %a !@"d  a@"t $"dӰ 0"d$"da @"X`  ߐ!Pj% "㿘 # %a !@~"d  a`"t $"d,Đ"d$"da @j㿘 %!`@^d !p "bt"d 0! Ybd$bd! @?"X`  !Pi "㿐    p0  0? #0!"i*  $"`i     ' 4 %'79; &i*  $@i    ' 4 '  @ip* `b` ,  @~h"L"`&h"@  '"LiV@*  $`T  H @ bp  "pp"("`"` "`"(  "`"@ "(V"p@ `` @ 2@@ p"`" $` "@5"p` @@%@ *$` & $` $@" 2@@$`$`$` %@    h "bp" "$@"bp"` @ ""'b! & `"@ "@ `1Y  `"`6` ` $`  6"6   2 :'"`   ' 2   m 2 hDh* ` h* $` ?"` hu 逤` '2` " ``" `" "``0''    ӡ4 `` '2 " ``" `" "``0' 2`"l@* " $"l` Kp "``(@1""p ("  ! 2 ""l 2   ?'!g* `* $"l&" @p "@@"( 2" ""bp'b'"w㿐 ?' @+  &`   `     ` @"hRi[  V  @ hGiP  @2@  0 KcЁ@2" `А?? 4㈀ / ##8*"@ J=2#"  J JJ 2 J=ې    㿐ƒY V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*(㿈'XX#d#h#\#` @4 Ł J " 㿘'L'P'T'XL㿐#\#`  @ 㿐#\#`  @ 㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘(` fT  "L 2 $?fD  "fL`X  0,  ? L X `L X`?#@ f( 4GA,? `L X`  ``%<' L/2?, e,  `e ]"8L`*!  &@O , A, a,e` ? "! "7 e`/ B  e` #`? a &L` `Z" ,  `@ `  `*:  z  %!  % p'?h'd hd @ f8 "c? .` `.   : @.  ` , ,  . @?a" "c 3"㿘"x` | *@? #"x**|㿘"x` b|b|? *b| ` `,  @, ` - - ,㿘c? "c"x` ec|| (|   ` + *  *|  (| ,   ` + *  *|  (| +` +  *  *| (| ( + *  *   *  *  + @+ ` <<<<<<<= <<<<<<<<<== 㿘 @˔W `drN I   < ; <" b@> <:    2 "-  ?`#N#X*` €#?###    (",&  &d% "?Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*$2 KcЁ@$ KcЁ@ $ʄ KcЁ@$x KcЁ@$J KcЁ@$Ƅ KcЁ@㿘,` ``$, @2 `^,`2`6 $, 2 S`,`2`,``2 6**`@6$ 2`2`㿘`. `젒C"?. "  ,"* *`@`2 `" @ @4.`22@22*   @4 248?$8``.`㿈  ʖ   – 2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'2%* "@ , 2 $ @ @ "@44 @ '" ('`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\ƚ 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`  c  @V   l  i,`,`2  ' %@ '`' `# 'f`2#  * @  `@  @Ӑ "w #. * @  `@ c@ 2"?U .`* 2`@  *` `8,`,`2  *F @ے 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?V "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  Ҕ`Ւ "`?@Ԕ`  .` 8` & 8 ( ` 4 $ -?㿘 4@@ `2  & 4 & 4``@W.`,`2 `ܖ  &` ` *`*2*  2224`㿐!  6@  ?6` {6`  <p?*  D@ 6  *@  <?  ^ ?*  D@  @>  ? K?  ``? OB"6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.`.@@  `@?7 .@.`` 㿐!? @ 2h?  ဢ@,! "@ :  $'++ + +    @ 7 **  <?*  D@ 6  *@  <   ?*  D@  @> o? ` O"?㿘 !!<   , &!  " ?* $ ĕ.2 !8.`" $      (㿘 D, `$* : ?=@ 1 8. @@f Ā2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$  % *` ,$   ?$   * ?2% ``m , Y  2m ` g $Z % * ,$  , ?$   :** %  * @% , ;V  :**$   * @%  ȓ*` $ ?%$  D D .  4  ?* D@$@ g . .  6 bؔ 1' ^ " 㿘`2 ` '*  D@  $&& $ !8 : +`*`   @  :**$   * *# ؒ㻈# %a '`P 2 p#  #( $,?' ?&!d(!     ! ?a  _#0㿘,``$4, @2 `K`$ 6, 2 B64`4`` *`$ @2`* 2 㿘!@6  .`!8$ .`     7  2  *@  2@* *@ 㿠%s: %s not compiled in instbinUsage: %s ..., where is one of: %shostnamedmesgexprmv-shshkshsedmkdirmtrmmount_mfsnewfsinitfsck_ffschownchgrpchmodgzcatgunzipgzipcpedmount_ffshaltrebootdhclientftprouteinstallbootmknodfsckmount_udfumountfgrepegrepgrepmount_nfsmorelessping6rtsollsifconfigcatpingcpiotarpaxdisklabellnsttysyncmountdfmount_cd9660dd!Y0 !Y( <!Y  P!Y X!Y @@!Y !Y !X !X !X @@!X 4skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qdconv option disabled%s%s: illegal numeric value%s: %s%sstdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryA.%sskip reached end of input!]!]!]!]!]!]!]!]!]x!]p!]h!]`updaterdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rrealpath %scd9660%s: Filesystem not supported by kernel%s on %smainusage: mount_cd9660 [-egjR] [-o options] special node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file systemempty type list %lld %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s A@Y Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s @Y df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fssoftdepsyncsynchronousroot file systemroread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasyncasynchronousffsAadfo:rwt:uvforceonly one -t option may be specified.updaterwrqnoautogetmntinforealpath %sunknown special file or file system %s.root_devicecan't find fstab entry for %s.malloc%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountdmain,/usr/sbin/sbin/statfs %s%s on %s type %.*s: %s already mountedexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %smountfs%s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmaxmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemdirexeccd9660norripgensextattprocfsversion %dlinux) prmountempty type list%s,%s-ousage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-Aadfruvw] [-t ffs | external_type][-dfruvw] special | nodeufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s!j!j !j!j!i!i!i!i!i!i!i !i!i !i!i !i !i!iwerasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard!j`!jX!jPrprntflushbrkoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d :%lxcflagiflagispeed%ldlflagoflagospeedttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakallillegal option -- -%soption requires an argument -- %s%d %d %d TIOCSETDTIOCSTARTTIOCSTOP!op!oh!o`!oX!oP!oH!o@!o8!o0!o(!o !o !o#!o3!o#!n3!n2!n3!n3!n#!n@!n@!n@!n@!n!n!n!n!n!n-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5!r0!r(!r !r!r!r!r!q!q!q!q !q !q@!q@!q!q!q!q!q!q!q!q!q!qx!qp!qh!q`!qX!qP!qH!q@!q0!q( !q -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk!v!v!v!v!vp!v`!vX!vP!vH!v@!v8!v0!v(!v!v!u!u!u!u!u!u@!u@!u@!u@!u !u !u !up !uh!u`!uX!uP!uH!u@!u8@!u0@!u(!u !u !u !uC$!uC!tC$!tC!t!t!t!t!t!t-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho!x8!x0!x(!x !x!x!x !x !w!w!w!w!w@!w@!w!w!w!w!w!w-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostoposttablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s print%s: %s %s %s%d-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZmainusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.13 2005/12/02 20:36:56 cloder Exp $Ffhns.%s%s/%slinkitusage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.97 2005/11/13 20:27:10 deraadt Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsBEf:NRWb:cdenp:rs:tvwbckmg%srioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %lld (0x%qx) lseekwriteioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFOBootstrap doesn't leave room for disk label\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:A?P>> %c: %13u %13u %c: %12.*f%c %12.*f%c %7.7s%7d %5u %5u %4.4s %5u %5u %4hu %19.19s# %s# Cyl %5u-%6udevice: %s # %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u total bytes: %.*f%c free sectors: %u free bytes: %.*f%c rpm: %hu interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d %hu partitions: # %13.13s %13.13s fstype [fsize bsize cpg] sizeoffsetw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: editsh-cEDITOR/usr/bin/vi%s %sfailed to start editorfork/bin/sh # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sgetasciilabelsector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)usageRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%swunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) editorNo space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. editor_addpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and sizepartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk %s: [%s] %s: [%u] %dRounding to nearest cylinder: %u getuint@YAA? Error, partitions %c and %c overlap: # %13.13s %13.13s fstype [fsize bsize cpg] sizeoffsetDisable which one? (^D to abort) [%c %c] has_overlapChanging device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.edit_parmsfailed to sort partition tablesdrzwdfdFLOPPYxdxyhdCCDVNDsvnd!!`!!`!!@!!!!x!!x!!H!(!! !!!0123456789Possible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help./dev/%s%s%s%c %s %s rw 1 %d mpsaveStarting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' Can't stat deviceioctl DIOCGDINFO[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. \{sƑOJNqեvuNuޕڵs!0 '+5/&f%kt9<^|⫓Z2}@mrXN㣈Odv2/fP@WmUvhQ*; k~}xrBT?"R=PYvh{]25xp꺂] ot+iֹecolaZ.^Ҽu[(821 5nx'G b ;WΕͫ۝<ᔑ&b競ЫVjaVk܇v \btKHwgl;] = 늾dX`J g x9y׷^mIzUyϖu i Xb1 ~صh:#(_pm%"" JY'-%kl j7^#Ai$;3lhPJO+Z8#z,G4_6xA%Q3 "5-<Ӓ,U绶ɜ[[N*i%0nzcA1:X._-^]_|2cD[y@bA!d@ui@^ lS&]j4p a LFsCW$l)LyaRw :xw6͝frz'3'eF8̏y4t?W F<<4 [._Gv"nc@ZпYiD0kDN ԠԀMH>[U/f& -`+n"Wᆱ ¼JL PB]b{{n5vF Dcrtj^5̟n8:+xhТ1mUY= &u 6naomo$AG̋ž6M{vav%lz.d0K8oab Gh@=S x(A$qt8,27~UZf&+CC_6WE!QPt!V'>G9 (Bc Ni՝ X S, f{Bb9  F4:B7p f#+P~e8+R,֍"8 I8̓(^!DsІ4tO !LF [6R0&[(+"$Di|p)B,O?orzoC;%%&xT cB5|̹;g H:{;z>yv-^rGT3&;]F))x]Pah5A%h$Y{żՋu(_;A~ahɴ؊ √駸i8K#B6rQ(:D $y^ m 4S#VRׂ2MSM65$˰8_ƴ N]~`gkBW$V$#h=kQLj٩ \Ȉzrdfv) 'b~|L0CRhs"k[РQ0IWk!ނ6&7\ S&D 8z42vyq\&!(3'R@ 6"qJ8)МG 6}+ demːy6k!K/h)elɉ >Usbq]`xpu젃K.csf +}u )R."p4#w("F R>P veyĻޚWej\}WACIK Ee@if1k@"8p@BL/-sl!oHo&ՁD(~#!|`O39 JȂz(BB+Q;si_4o$ X)+L`@Z8F~|uS@IwHWN*'…+ix%^Zu0"bh;K[Nۑ/*^]$a$)! bVc)cC_[@Dwf=um[p-n(ڭMKe,>V-SJidO˴|3j hg0ǘ(DPS`M-58cʢ7RcwMod Q1Z\{+zP-4}%,^/YȌ6Wi#FT0$"Pj5;LtMpeϙΜ-o6G:ꄱs~hs5SDmęH*ѭ%h_ ^VA]{ac47(ń+-9%E)m"ğO-n%IKFPQy ^}e۾*Eag69!W}̑6:ήIQ#A0|nN%M`U}Fﱞ*54=/DS- %%8 qMu8E)H$ہ9|T3'֍cvWcPuAn'#B lݴc]X9Hq~9:/L_[̻ڋ?֊m̻IR1+ vJ׭*g)riMĞ vlVMْ=Xe @\c|5f/hp EP8N,w>!ˁF;_k¼f}w>0}&"ı6LLȷr'aiMaw {LA-Րz"$55_cSOq8L9YtӸŵ=siLR*UNNNj&+SKQJ[ D1$Rs.^%5XC\j;{{6V9 ` H(JSy+nXݮT4]({g⢊#o95ۙPD:NΘϴt&l: ;S w &DPrS~Z ơEF7/Y=;>rq eQ-n &\v{]\Ro5r -XRr[h)T?tLA rST6 !v 5rrC՚&W'{il"ȅ-i߈(gD РjHO(6HFocHj^ZI9 $9ɊLG- _@6X)ҝ"c{PxmH?:Cevص9/' P|R|ԮJ)35GM!;3<Ħc7qBMC QەE~W'=ɹVqO"ky(}"2H/xT Tdȹ};T! b%:/بYlpuWtߙf3yz-=1ns8RL $s0o:ُz`-Ope_Ln|ʡkJګ8= :9Sp|J J3 `c֝W0rK1kS;kqA=EI4ݤI~}{]|}7AS=O|:VJc'O&4|3KqnK]}^Gw gf!諹 gO82zҊD 3x( ŧQhxC yB۠78*gٙwP2j}Yݱ1"O2|#6:IePʛB8YVZ6=v&NeD[Xs'Wn$N⮘>\y JЙ^&nK|9Y~)]`@y/5 = MeuL7ͭ<Ұ">4SG[^ψ:Ps{~ j&GAN 9-m/X}H&xE I͍3$=F֥,@RedvVe Sar۫o_:gscwרL.q7uXYh3'bi u6pKֲ ]BuJM_a@!4]ꡔZxmOwū!#Ed%ܖ"fp 48 W:/puijMP$$<]c Ќ >v׬Il)i=Rw,L"IR i-z]ZH^G7jՆM/Ei7ۑJϿH!tɽjɿv=%F`G)w\D3^4q{rI#M@pq0 4m6"6=BeiG8tZh@LgckLEޙ]J(\c.rEmZw9|/vyJc_4w-n,mv3VU猡 K=VkDp!ē=|"1ul\|QQ&HlgY$əM#7'_Ja\Cya??䏾< Pb$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksget_physUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again ar_nextcould not pipecould not fork-c-dccould not exec$OpenBSD: ar_subs.c,v 1.29 2006/01/25 17:42:08 markus Exp $listCannot chdir to %sCan't fchdir to starting directoryextractUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. appendarchivedirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %scopyPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache table%lu$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $TRAILER!!!cpio_endwrCpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %scpio_wr070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %svcpio_wrFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sbcpio_wr$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $Unable to create %sUnable to close file descriptor on %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfUnable to remove %sCould not link to %s from %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)node_creatUnable to remove directory %sCould not unlink %sUnable to obtain file stats %sAccess/modification time set failed on: %spaxUnable to set file uid/gid of %sCould not set permissions on %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sset_crc$OpenBSD: ftree.c,v 1.26 2005/04/21 21:47:18 beck Exp $Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s Can't fchdir to starting directoryCan't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %s$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == => ls_list%s%s %s ls_tty$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $%s: unknown option %c %s: %c argument missing $OpenBSD: options.c,v 1.63 2005/06/02 19:11:06 jaredy Exp $ustartarsv4crcsv4cpiocpiobcpiopaxab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Invalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578Unable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8-I-rUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPE/%sabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdOnvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [pattern ...] pax -r [-0cDdikOnuvzYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T [from_date][,to_date]] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [-x format] [file ...] pax -r -w [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list $OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %srep_addEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistentRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s tty_renameFile name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s rep_name@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal maskUnable to set up signal handler$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]$OpenBSD: tables.c,v 1.23 2005/04/21 21:47:18 beck Exp $Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memorychk_ftimeCannot allocate memory for interactive rename tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %s$OpenBSD: tar.c,v 1.40 2005/12/17 19:47:02 otto Exp $ustarwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %star_wrUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00nobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wr$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $/dev/ttywrFatal error, cannot open %s%s: : %s@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.73 2006/01/09 22:42:35 deraadt Exp $socketDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %stos value is %s: %sttl value is %s: %smaxwait value is %s: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommainA??zG{A.ping: sendtoping: wrote %s %d chars, ret=%d pingerpacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet loss round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms summaryA@YEcho Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xusage: ping [-DdfjLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host benstuvusage: %s [-benstuv] [-] [file ...] stdoutstdin-r%s%6d malloc"+(9"+ 9"+9"+9"*9"*9"*9"*9"*9"*9"*9"*>"*?"*8"*=h"*>"*D"*Ex"*Ex"*FH"*xFH"*pH"*hH"*XIL"*HIL"*8J"*(84"* 8"*h "*:"):"):"):");$");@") %d:powersave on (%dms sleep) %ddBm %s(auto) ieee80211_statusSIOCG80211ALLNODES none restoreieee80211_listnodeslladdr %s %udB powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %s "5 "5@"5@"5`"5"5"5"5CARPTDMIEEE802.11FDDItokenTokenRingetherEthernet"< "<"<"<#"<#";#";#";$";$";$";$";%";%";%";%";&";&";x'";h'";`(";P(";H)";8)";0*"; *";+";+";,":,":,":-":-":-":.":.":/":/":0":0":x0":h0":`1":P1":HC":8C":0D": D":E":E":F"9F"9c"9c"9d"9d"9e";e"9"9"9"9"9"9"9"9x"9p"9h"9`"9X"9P"9H"9@"98"90"9("9 "9"9"9"8"8"8"8"8"8"8e1-g.704-crc4e3-g.832e3-g.751e3t3-m13t3e1-ami-g.704e1-amie1-g.704e1t1-amit1OFDM72OFDM54OFDM48OFDM36OFDM24OFDM18OFDM12OFDM9OFDM6DS22DS1DS11DS5DS2FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000T1000baseT1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselectmasterfh11g11b11a">"> "> ">">x">p">h">X">H">@ "<0@">(@"> @">@">@"=@"=`"=`"="="="="="= "="="="=x"=`"=Pframerelay-ituframerelay-ciscoframerelay-ansippphdlc-crc16turbomonitoribss-masteribsshostapadhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %s%s %s%smedia mode %s %smediaopt instance %d6 physical address inet%s %s --> %s phys_status "@"@`"@"@x@"@"@x"@h"@"@"@"@`"<0backupno networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: status inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime 0infty vltime in6_alias%s: bad valueprefix %s: %s%s=%o%s=%x%s: %susage: ifconfig [interface] [address_family] [address [dest_address]] [[-]alias] [[-]arp] [broadcast addr] [[-]debug] [delete] [up] [down] [ipdst addr] [tunnel src_address dest_address] [deletetunnel] [description value] [-description] [[-]group group-name] [[-]link0] [[-]link1] [[-]link2] [lladdr etheraddr] [media type] [[-]mediaopt opts] [mode mode] [instance minst] [mtu value] [metric nhops] [netmask mask] [prefixlen n] [nwid id] [nwkey key] [nwkey persist[:key]] [-nwkey] [bssid bssid] [-bssid] [chan n] [-chan] [txpower dBm] [-txpower] [[-]powersave] [powersavesleep duration] [[-]anycast] [eui64] [pltime n] [vltime n] [[-]tentative] [vlan vlan_tag vlandev parent_iface] [-vlandev] [vhid n] [trunkproto proto] [[-]trunkport child-iface] [advbase n] [advskew n] [maxupd n] [pass passphrase] [state init | backup | master] [syncdev iface] [-syncdev] [syncpeer peer_address] [-syncpeer] [phase n] [range netrange] [timeslot timeslot_range] [802.2] [802.2tr] [802.3] [snap] [EtherII] [pppoeac access-concentrator] [-pppoeac] [pppoesvc service] [-pppoesvc] ifconfig [-AaCMm] [interface] [address_family] ifconfig interface create ifconfig interface destroy SIOCGIFGROUPgetifgroupsall groups: getifgroups%dd%dh%dm%ds%lumalformed link-level addressSIOCSIFLLADDRCOLUMNS1ACFLRSTacdfghiklmnopqrstux %s: %s: %s: directory causes a cycle%s: %sfts_read%u-%lu%qudisplaytotal %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd printlong%s%s/%s ls: %s: %s -> printlink%*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] adDFadDfFm1kernel is configured not to accept RAskernel is configured as a router, not a hostmainfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routersselect: %sifconfigfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedmake_packetlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %srtsol_check_timertimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldrtsol_timer_updateillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dusage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a usage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a <%s> %swarnmsgmultiple interfaces foundreallocstrdupprobing %ssockopenmalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_PKTINFO: %sIPV6_HOPLIMIT: %ssetsockopt(ICMP6_FILTER): %ssendpacketsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketrtsol_inputrecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%d) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpeced IF(%s)received RA from %s on %s, state is %drtsol_inputinterface_upioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...get_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedinterface_upinterface_statusioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sinterface_statuslladdropt_fillunsupported link type(%d)get_llflagsocket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflagprobe_initmalloc failedsocket: %sshutdown: %sdefrouter_probelo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)defrouter_probesendprobeprobe a router %s on %ssendmsg on %s: %ssendprobea:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwWinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dtoo many intermediate hops%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_PKTINFO)setsockopt(IPV6_HOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> %s pollrecvmsgnew path MTU (%d) is notified main?A.@@sendmsgping6: wrote %s %d chars, ret=%d .%c\%03odnsdecodeinvalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOP???%s%s, (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lupr_pack@@ HbH Options: Dst Options: Routing: -%u %uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap truncated no address ? %s(TTL=infty)(TTL=%u)pr_nodeaddr --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms @YIPv4 addressDNS labelIPv6 addressUnknownRefusedSuccessNo Route to Destination Destination Administratively Unreachable Destination Unreachable Beyond Scope Destination Host Unreachable Destination Port Unreachable Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirect Destination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %dpr_icmphVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESP TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ... patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02x ff02::2:0000:0000nigroupusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host LESSSECUREmore-E-G-L-mMORELESS--WARNING: terminal is not fully functionalCannot allocate memoryraw_modeLESS_TERMCAP_ltget_envLINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll alsrget_termNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunseek error to 0%cESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off /?_-(P)+! [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found:%s helpCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar-%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%s/HOMEbin_fileSHELLr%s %s %s%s LESSOPEN-LESSCLOSE-c...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSm%*s plinenum~ Calculating line numbers! /dev/ttySHELL%s %s %ssh (press RETURN)Invalid mark letterCannot seek to end of fileMark not setMark not in current filelLine number is required after -l/%sless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for help%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeDon't use keypad modeUse keypad modeHorizontal shift %d positionsHorizontal shift: Show tildes after end of fileDon't show tildes after end of filequotes: Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminal0123456789,Tab stops: Highlight first unread line after any forward movementHighlight first unread line after forward-screenDon't highlight first unread linePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modeChop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters directly, processing ANSI sequencesDisplay control characters directlyDisplay control characters as ^XNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptUse the LESSOPEN filterDon't use the LESSOPEN filterDisplay a status columnDon't display a status columnPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesQuit if end-of-file on first screenDon't quit if end-of-file on first screenOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileAssume dumb terminalAssume intelligent terminalRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffersMax buffer space per file: %dKMax buffer space per file (K): Search skips displayed screenSearch includes displayed screenBe less helpful in promptsBe helpful in prompts%s: %spostoalinenumtoainttoaiprint_intiprint_linenum?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataap_posap_linenumap_int?-fileNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off/dev/tty""""""""""""x"p"h"`"P"H"@ "0@"("""" "@"""""acdirmaxacdirminacregmaxacregminacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforcerdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -I value -- %sconflicting version optionsillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %srealpath %snfs%s: Filesystem not supported by kernel%smainhostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCfork/can't access %s: %susage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'bin_file(standard input)(fd %d)%sinvalid file typeusage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxyunix-byte-offsetsline-regexpword-regexprevert-matchno-messagesrecursivesilentquietline-numberfiles-with-matchesfiles-without-matchignore-caseno-filenamefileregexpcountbyte-offsettextversionbinarybasic-regexpfixed-stringsextended-regexpdevicescontextbefore-contextafter-contextline-bufferedmmaphelpbinary-files%s[[:<:]]%s%.*s%s[[:>:]]%s^(\()\)$r%scontext out of rangegrep version %u.%u without-matchUnknown binary-files option%s: %s(standard input)r%s%s:%u %s Binary file %s matches -- [[:<:]][[:>:]]mallocrealloc%d%lldaFfh:t:vonly one -t option may be specified.nfs/%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCumountfsgetmntinfoempty type listusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]"""""""""""rdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotausage: %s special node o:realpath %sudfmountmain,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'$OpenBSD: fsck.c,v 1.23 2005/11/21 14:27:55 millert Exp $Can't get resource limit to max data sizeCan't get resource limit for data sizedvpfnyb:l:T:t:-b %smalloc failedonly one -t option may be specified./dev/%s: unknown special file or file system.rorwrq%s has unknown file system type./usr/sbin/sbinufsffsfsck_%sstart %s %swait %sno %s fork%s/fsck_%sexec %s for %sexec %swaitpid%s: %scheckfsInvalid option stringempty type list,%s,%s-ousage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] $OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s SUNEXPECTED INCONSISTENCY:%s: %s (%s)%s, disk %s: %s %s in fstab more than once!mkfifom:invalid file mode.node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%susage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrapnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x %s: devread: lseek%s: devread: readstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect blockxresolvestaticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlennostaticnojumbonetmasknetmtumpathmonitorlockrestlockllinfolinklabeljumboipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeaddbotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtv/dev/nullsocketmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) write to routing socketgot only %d for rlen %-20.20s done king bula sez: set_metric with invalid key0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway netmask missing%s %s %s: gateway %s (%s) not in tableentry in userouting table overflow: %s 64128inet6_makenetandmaskinternal errordefault%s: bad value%s: resolved to multiple values%s: not a network%s: bad address%d: bad address familyprefixlen is not supported with af %dactual retrieval of interface tablereadgot message of size %d on %smonitorso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelwriting to routing socketread from routing socketRTM_IFANNOUNCE: iface arrival/departureRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routeunknownrouting message version %d not understood%s: len %d, if# %d, name: %s, downuplink: %s, flags:metric %d, flags:if# %d, name %s, what: arrivaldeparture#%dpid: %ld, seq %d, errno %d, flags:print_rtmsg route to: %s message length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s flags: label: %s %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8lu%c %8ld%c sockaddrs: locks: inits: sockaddrs: %s%s: link %s; %s: inet %s; %s: inet6 %s; %s: ipx %s; sodumplabel too longUGHRBD M@dmCXLS1@2 3cJroute-sysctl-estimatesysctl of routing tableRouting tables %-*.*s Address%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-6.6s %6d %8ld %6ld %6s - %.16sp_rtentryInternetInternet6IPXEncapAppleTalk %s: Protocol Family %d: %s %-*s p_flagsdefault(%d) %sroutenameinvalid%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%dillegal prefixlen%s/%dnetname6af %d: %s0123456789abcdef*.**.0x%XHany*%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%slink#%d/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files Continue withmput%s: not foundmputr+wwusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetmgetonoffConnected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdusage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file SHELL/bin/shsh-c%sTry again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. userPWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1modefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. filenameusage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmore|%sCan't allocate memory for $PAGER?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. domacroExtra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sCan't allocate memory for transfer bufferWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %s(unknown)Trying %s... socketconnect%sr+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpGET /%s HTTP/1.0 Host: Can't allocate memory.[%s]80:%s %s Writing HTTP requestReceiving HTTP replyreceived '%s' 301302Too many redirections requested200Error retrieving file: %sContent-Length: Location: Redirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}cdRetrieving %s/%s %s/%sgetmgetauto_fetchCan't allocate memory for URL decoding:/unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socket(unknown)connect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopthookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection. %s:getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %lldr+w%s %snetoutsendrequest receive aborted waiting for remote to finish abort. receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)bindlistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnSTOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssu46AadEegimno:pP:r:tvV--r requires numeric argumentRetrying... mainftp> sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. !$%sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %sruserpassstringlistAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initftp_loginsorry, arguments too long. (%s) TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.remglob%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! confirm%s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. .Unable to determine real path of `%s'fileindir KMGTP %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterA.%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d ptransferA.>?P/etc/dhclient.confking bula sez: len mismatchFAILalias_routehandlerc:dl:quifi callocifi->client callocifi->client->config callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link .... giving up got link /dev/nullcannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"nobodyno such user: nobodypipecan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chroot/chdir("/")can't drop privileges: %m%susage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.DHCPNAK from %sDHCPNAK with no active lease. No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.wcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbininterfacemediumreasonip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %d\%03odhcp option too largecannot fork%s [priv]poll errorrCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpected option name.%s: unexpected option name.%s: too many options.expecting semicolon.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting string.option data buffer %soverflowoption data buffer overflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.expecting IP address.no memory for reject list!parse_reject_statementgetifaddrs failedno space to remember ifp%s: not foundCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %minterface_statusCan't allocate timeout structure!can't allocate protocol struct for %sCan't create socketinterface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcScoption %s (%d) %s.larger than bufferMany bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array\%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largepretty_print_optionDiscarding packet with invalid hlen.do_packeteof in string constantstring constant larger than internal buffernumeric token larger than internal buffertoken larger than internal bufferlways-reply-rfc1048ppendllowliasbandoneduthoritativeackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressddiroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverotptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringser-class-host-decl-names-lease-addr-for-default-routeidnknown-clientsendor-class%s exiting.exiting. %s line %d: %s%s^subnet_numberbroadcast_addr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packets# # # p# h# X# P# H# @# 0# @# # @# # @# # @# # @# # @# # @# # @# # # x# p# `# # P# # @# h# 0# # # # # ## #### p#####h#`#P# p#8# # # h## ## ## ## h#### ###h# #X##@##(# ## ## @## @#### @## @###x# #h# @#P# @#8# h#(####### h#### ## p#x##`##H# #0## ##### ## @## ## ## @## @## @## @#p# @#`# @#P# @#8# @## @## ################ @#p##`##P##@##0## ######################p##`##P##@##0## ######################p##`##P##@##0## ######################p##`##P##@##0## #####"#"#"#"#"#"#"#"#"p#"`#"P#"@#"0#" #"#"#"#"#"#"#"#"#"#"#"p#"`#"P#"@#"0#" #"#"#"#"#"#"#"#"#"#"#"p#"`#"P#"@#"0#" #"#"#"#"#"#"#"#"#"#"#"p#"`#"P#"@#"0#" #"#"#"#"#"#"#"#"#"#"#"p#"`#"P#"@#"0#" #"#"#"#"#"#"#"#"#"#"#"p#"`#"P#"@#"0#" #"#"#"#"#"#"#"#"#"#"#"p#"`#"P#"@#"0#" #"#"#"#""eoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversXvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-namemerit-dumpSboot-sizethost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadsemicolon expected.filename must be a stringno memory for string %s.expecting a network hardware typeexpecting semicolon.Expecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dnumeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (connection closed)buf_read (short read): %mbuf_read: %mcorrupted message received%mreceived unknown message, code %ddispatch_imsghaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainusage: %s [-dn%sq] p######p#h#`#X#P#H#@@#8#0#(# #softdepforcereloadupdatesyncasyncrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:realpath %sffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernelfilesystem must be mounted read-only; you may need to run fsck%s on %s: %smainusage: mount_ffs [-o options] special node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'cannot seek temp fileout of memorycannot read temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read filecbc_decodeinvalid pattern delimiter p unexpected end-of-file& no previous commandout of memoryrcannot open input filecannot close input file%lu newline inserted newline appended out of memorycannot read input filewcannot open output filecannot close output filecannot write fileunexpected end-of-filestdincannot read stdin%d \  \abfnrtv\@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-filenumber out of rangeinvalid addressinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%d ! unknown commandno matchfilename too longout of memoryshell access restrictedno previous command invalid mark charactered.hup/ed.huphandle_hup..invalid pattern delimiterno previous patternout of memoryunbalanced brackets ([])trailing backslash (\)number out of rangeno previous substitutionout of memoryno matchinfinite substitution loop out of memorynothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read%soverwrite %s? readlink: %sunlink: %ssymlink: %scopy_linkmkfifo: %smknod: %sutimes: %schown: %schflags: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory #P#H#@#*,x%.gzdeflatezcatzipcompressunknown program nameGZIP GZIP is too long123456789ab:cdfghlLnNOo:qrS:tvVoption -a is ignored on this systemillegal bit count -- %s-o argument is too long/dev/stdin-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored%s%s%s: %s%s not a regular file%s: unchanged%s already has %s suffix -- unchanged/dev/stdout%s: unknown suffix: ignored%s%s: name too long%s: input: %soutput: %smaincompression not supported%s%s: won't read compressed data from terminal%s: unrecognized file formatrcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %soverwrite %s? .-_taztgzzgzZmethod crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) @YOK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out @Yusage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_header `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@#.#.#-#-#-#-#-#-#-#-incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.2.3@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.22 2006/01/25 06:13:27 tedu Exp $HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_readuser is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-fh] [-R [-H | -L | -P]] %s file ... [owner][:group]group$OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $lost+foundwrong type to dirscan %d dirscanDIRECTORY CORRUPTED%s NAME=%s %s=%s DIRFILEfileerrorUNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUSTmkentryUNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u linkupmakeentryNO SPACE LEFT IN %s (EXPANDED) EXPANDexpanddir$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS ckinodePARTIALLY TRUNCATED INODE I=%uiblockblk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listcannot find inode %d %s %sDIRFILECLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%u BAD STATE %d TO BLKERR CG %d: BAD MAGIC NUMBER @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.26 2005/02/03 05:03:50 jaredy Exp $dfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... -%c flag requires a %s ufsffsrwrostarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** checkfilesys$OpenBSD: pass1.c,v 1.18 2005/12/19 15:18:01 pedro Exp $phase 1, inode %d/%dPARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlink convert symlink %d(%s) of size %llu bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%ucheckinodeBADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.$OpenBSD: pass1b.c,v 1.11 2005/04/16 18:15:41 millert Exp $phase 1b, inode %d/%dDUP$OpenBSD: pass2.c,v 1.23 2006/01/25 06:25:46 tedu Exp $phase 2, directory %d/%dphase 2, parent directory %d/%dROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'pass2.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d pass2check$OpenBSD: pass3.c,v 1.10 2005/04/16 18:15:41 millert Exp $phase 3, directory %d/%ld$OpenBSD: pass4.c,v 1.13 2006/01/25 06:25:46 tedu Exp $phase 4, inode %d/%dUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d $OpenBSD: pass5.c,v 1.21 2006/01/25 06:25:46 tedu Exp $phase 5, cg %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ld FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSpass5$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: setup.c,v 1.22 2005/12/19 15:18:01 pedro Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead setupMAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE%s: BAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) ioctl (GCINFO): %s %s: can't read disk label $OpenBSD: utilities.c,v 1.21 2006/01/25 06:25:46 tedu Exp $bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] cannot allocate buffer pool deadlocked buffer pool WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY CANNOT %s: BLK %dProgram terminated UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:CG %d: BAD MAGIC NUMBER /?..returning to single-user after filesystem check catchquit%s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d /dev/tty: catchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingsingle_usersh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootsession database close: %ssession database open: %sinsert %d: %sdelete %d: %s %s%s/dev/asprintf%s %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %d shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'updateasyncrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dP:T:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelNumber of cylinders restricts cylinders per group to %d. stat %smfs:%dstatfs %swaitpid%s: mount: %sabnormal termination/mainioctl (GDINFO)ioctl (WDINFO)%s: can't rewrite disk label-z tracks/cylinder-x spare sectors per cylinder-u sectors/track-t file system type-s file system size (sectors)-r revolutions/minute-p spare sectors per track-o optimization preference (`space' or `time')-n number of distinguished rotational positions-m minimum free space %%-l hardware sector interleave-k sector 0 skew, per track-i number of bytes per inode-h average files per directory-g average file size-f frag size-e maximum blocks per file in a cylinder group-d rotational delay between contiguous blocks-c cylinders/group-b block size-a maximum contiguous blocks-T disktype-S sector size-P src populate mfs filesystem-O create a 4.3BSD format filesystem-N do not create file system, just print out parametersusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s forkchdir%s%s: exitedcannot stat %s%s: not a dir or a block devicepax-rw-pe.rmdir %sunmount %smount %s %s/bin/paxcopy %s to %s failed%s: mount (update, rdonly)copy/mntTMPDIR/tmp/tmp mountpoint %s busytmp mountpoint %s too longtmp mount point too longmntXXXXXXXXXXmkdtemp %sgettmpmnt%s: initializing cg %ld/%d siginfocallocmmappreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dno block size to support this diskWith a block size of %d %s %ld minimum bytes per inode isMinimum bytes per inode is %ld With %d bytes per inode, minimum cylinders per group is %ld With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %ld cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d)%s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedfilesystem must have at least %d sectorsWarning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary%s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %ld, %sfsinit failedmkfs>panic: cylinder group too bigcg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 cg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d COLUMNSdfiPRr%s: %s%sfts_read%s: is a directory%s (inode %u): not overwritten due to multiple links%s: mallocrm_overwriteremove %s? override %s%s%s/%s for %s? check"." and ".." may not be removedusage: %s [-dfiPRr] file ... weofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejecttf:TAPE/dev/rst0%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGET76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %s=%o%s=%xusage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shelltcpshell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sO%s %d rmtopencloseC statusS I%d %d ioctlrmtioctl%s: %sProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pinvalid file mode: %s%s/%s: %susage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.21 2005/04/11 07:11:44 deraadt Exp $unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %sread commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])RE error: %scompile_re123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'compile_flagstransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthcompile_trcompile_textunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %sr%s: %s"%s" ..."stdin$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $%ssed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $%s %s: %s%lu \%d not defined in the RErstdout: %sflush_appendsCOLUMNS\ \ \abfnrtv%03ofirst RE may not be emptyRE error: %sunable to allocate memoryLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s can't get current directory - %sRnprsu,ne-p: %s-u: %s: %spvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=dprtUx##-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzbgjob control not enabled%%%*d %*s %s%*d %*d %sbad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process IDs%s: %smissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGlm#p #h <#X t#P #@ #8 \#( \# # T# \# # X# # # # ,# # # bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+alias%s: bad numbernothing to shiftSugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad maskc_umask%s: %snot foundprsu,-p: %s-u: %s: %sREPLY%s%s is read onlytrap -- %s bad signal %s%s: bad value%s: cannot %s%s: can only %s %d level(s)##-setfv%s%*ld.%02ld%s%s%*ldm%ld.%02lds%s real real user user sys system :ptime: -%s unknown optiontime: -%s requires an argumentm:invalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p# # # (# (# 'X#p (#h 8#` %<#X #P #@ #8 #0 #( # # # # (# # 6# # # %mknod*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tinternal error: unknown opunexpected operator/operandmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator#####)(!-a-o1%s: %s%s#t#f#c#xd#hs#Pl#@m#(n#pprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %sCOLUMNSLINESx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`\ nH#0 b# xH# x# xx# X|# Z# X# [# g#p h#h b#X b#P x#H d#8 n#0 cD#  V# V\# k# v# x`# x# k# k# k# mP# `8#x hh#` Z#P hL#@ `#0 Z#  bL# c# d\# x@# b# # `# a# d#x v#` n#X n#H j#8 w|#0 w8# l# x# x# p# \# H# }# ~X#commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD I-search: x_search_hist nothing to yank yank something first%s%s = %s '%s' cannot bind, not a tty%s: no such functionCPOSIXsubstituteexpand(NULL)%S%s: bad substitution%s: %sparameter null or not setunable to allocate memory%s: parameter not setfunny $() command: %s%R%s: cannot open $() input.*+?@! HOMEPWDOLDPWD%sPS4%s%scoprocess already exists%s: %s_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundEXECSHELL/bin/sh%s: %s: %sshcomexec: %sFPATH%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s##x#pREPLY-rreadPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %smissing )zero divisormissing :missing ]history functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %ssubstitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrink%s: internal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againbad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameno coprocess/tmp%s/shXXXXXXXX48###argument must be %job or process idambiguousno such jobj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procwaitlast: no last jobwaitlast: not startedjw:waitlast%s: %sjw:waitforjob not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumeYou have %s%s%s jobs stopped and runningjobsnotifyasyncj_async: job not startedj_async: bad nzombie (%d)zombiej_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)checkjob%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sj_printremove_job: job not found (%s)no closing quote yylexhere document `%s' unclosed PS1PS2\%c%a %b %d%d%T%l:%M:%S%r%RPWDHOME/~/%s%cdoppromptmissing ] MAIL_%s you have mail in $_IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-iHOMEPATHSHELL-xKSH_VERSION-rtypesetksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shSH_VERSIONPWD.$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV#####USERroot?include: %dshell: %dUse `exit' to leave ksh @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s: %s0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF#a##c####e#x#h#Xi#Pk#Hl#8X#0m# C#n#f###b#u###p#r##s#h#v###p#`#P#Hxxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacs-usemetaemacscsh-historybgnicebraceexpandallexport%-*s %sonoffCurrent option settings set -o %sgetoptionso:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifier%s: bad numbergmatch*+?@! %s%s-%c: unknown option: %s%s-`%c' requires argument%s'\''%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: flags %xshf_read: bsize %dshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: flags %xshf_putchar: no fdshf_write: flags %xshf_write: nbytes %dshf_snprintf: buf %lx, bsize %d0123456789ABCDEF0123456789abcdef(null %s)shf_vfprintftoo many <<'s too many redirections let%s: bad identifier forselect%s: invalid function name #@#8#0#(# # # #x # # #######{#}######## newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifunexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s aliasexportreadonlytypeset||&&!()#####]]<>ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s< <<- << >> >| > <> <&>&%s wdscan: unknown char 0x%x (carrying on)/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s48# ####p#h#X #H #@ #8 #0# #####LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS%s: subscript %ld out of rangebad substitution0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz%s: bad number%s: is read onlysetstr: %s=%s: assigning to self%0*s%.*s%*s%.*s%-*.*sENVSHELL%s: restricted @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB/?^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-if%s: destination pathname too longmain%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %scannot rename a mount pointcan't remove %sdo_move%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times/bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fi] source target %s [-fi] source ... directory %d|&=<>+-*/%:()syntax error%seval5non-numeric argumentdivision by zero%d %s _msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%susage: %s [-M core] [-N system] ssethostnamegethostname%s mainusage: %s [-s] [name-of-host] /var/run/utmplogoutRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labelreadlabelfsr%s%s%s%c/dev/%s%s%s/etc/fbtabr /dev/%o%s: bad entry: %s(null):%s: %s: %m/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...login_protect0B%lld%c%lld.%1lld%c/var/log/wtmplogwtmp\\#TERMCAP/usr/share/misc/termcapTERMPATHHOME%s/%s.termcap /usr/share/misc/termcaptgetentOOPS?nYacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error ynynfyn: DOMAIN error lgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10log10flog10: SING error log10: DOMAIN error powpowfpow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanhatanhfatanh: DOMAIN error atanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error G??C00=A@Alongjmp botch. no errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error : xxswufsswap ,rwrqrofstabscan/etc/fstabrfstab: : asprintfRSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s rcmd_af0iruserok/etc/hosts.equivr%s/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owneriruserok_sa__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopudptcp%ugetnameinfoip6_parsenumeric/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh rcmdsh: execvp %s failed: %s ####Ӱ#ӐNo address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver errorrresvport_af__elf_fdnlist%u.%u.%u.%u%u.%u.%u.%uinet_ntop4%xinet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u%s: %s#p#h#`#X#P#H#@#8#0#(# #############ո#հ#ը#ՠ#՘#Ր#Ո#Հ#xUSR2USR1INFOWINCHPROFVTALRMXFSZXCPUIOTTOUTTINCHLDCONTTSTPSTOPURGTERMALRMPIPESYSSEGVBUSKILLFPEEMTABRTTRAPILLQUITINTHUPSignal 0####װ#ר#ט#׈#x#h#`#P#@#8#(noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,invalidtoo smalltoo largeBLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%xregerror0%doffonsecurelocalrtsctssoftcarmdmbufwindow/etc/ttysr/dev//var/run/dev.db__ttyname_r_basic%s: /etc/protocolsr IN-ADDR.ARPAgetnetanswerbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetnetbyaddrgetnetbyname/etc/networksr %u/etc/grouprgroup.byname%ugroup.bygid: grscan/dev/tty readpassphrasetcsetattrsh-c/bin/sh%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrether_ntohostethers.bynameether_hostton HOMEglob3.g_opendirg_lstatg_stat: master.passwd.bynamepasswd.byname__YP!+__has_yppwgetpwnam%umaster.passwd.byuidpasswd.byuidgetpwuid/etc/spwd.db/etc/pwd.db%s: %m*netgroup: %mnetgroup: db getnetgroupnetgroup.byusernetgroup.byhostnetgroup: Syntax error `%s'netgroup: Cycle in group `%s'%s.%s(%s,%s,%s) ,/etc/netgroup.db+%s: : %s %s: yp_first: clnt_call0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL[:<:]][:>:]]authunix_create: out of memory authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problem#X#P#@#8# ##########p#`#H#0# ########x#`#H#0##User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0#X#P#@#8# ##########p#`#H#0# ########x#`#H#0##option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sPOSIXLY_CORRECT0123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cinet_net_pton_ipv4n >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" //dev/nullipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dsscanfgethostby*.getanswer: asked for "%s", got "%s"-_/gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswerbf%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpagethostbyaddr/etc/hostsr %u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.byname...RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx%s.dbtcgetentr|:cgetnext/bin/shsh-cexeclexecleexeclpPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shexecvpxdr_array: out of memory %s: : %s   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~...realpath/vfscanf:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy$1$%s%.*s$md5cryptMD5Pad__sbprintfInfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.vfprintf__find_argumentsexponent?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5InfInfinityNaN0A??҇coCa?Ɗ(`ȳ?DPy?@$@@?$ @$ @$ @$ @$ @$ @$ @$ `$ X$ X.SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%Y%.3s %.3s%3d %02.2d:%02.2d:%02.2d %-4s %.3s %.3s%3d %02.2d:%02.2d:%02.2d %s asctime3snprintfstack overflow in function %s__stack_smash_handlerclntudp_create: out of memory clntudp_call$$$$$$$$$$tcpudpfbfexplore_numericgethostby*.getanswer: asked for "%s", got "%s"gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswer/etc/hostsr# _gethtenthosts.bynameipnodes.byname%s.%sres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASESr__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conffLOCALDOMAINrbf;#domain lookupsearchnameserver%usortlistoptionsconfRES_OPTIONSenv_res_initndots:debuginet6insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$$$$x$pANYHESIODHSCHAOSIN$$$$p$h$H$@$ $$$$$$$$ $$ $$ $$h $`$H $@$($ $$$$$$$$$$$$$p$h$`$X$H$8$H$0$ $$$$$$$$$$$$h$`$8 $0$!$$"$$$$$$$$X$P$8d$0$e$$f$$#$$$p$"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%d/etc/servicesr ,/syslog: unknown facility/priority: %xsyslog_r: unknown facility/priority: %x<%d>%h %e %T %s[%ld]Error %d /dev/console vsyslog_r/dev/logconnectlog_r$!$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ x$ p$ h$ X$ P$ @$ 0$ ($ $ $ $ $ $$$$$$$$$$$x$p$h$P%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%e-%b-%Y-+%04d_fmt_conv-0GMTabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page../etc/localtime/usr/share/zoneinfo/tzloadmnposixrules,M4.1.0,M10.5.0TZ?vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFD_yp_dobind%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... %s$'$&$&$&$&$&$&`$&@$& $&$%$%$%$%$%`$%@$% $%RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s: %s - %s %s: %s $(@$( $($'$'$'$'$'pFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKclnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory : perrorlibcUnknown error: Unknown signal: NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC_catopen$3X$3@$3 $3$2$2$2$2$2$2$2h$2H$20$2$2$1$1$1$1$1$1$1p$1X$18$1 $1$0$0$0$0$0$0$0$0X$0@$0$/$/$/$/$/$/`$/H$/0$/$.$.$.$.$.p$.`$.H$. $-$-$-$-$-$-X$-0$-$-$,$,$,$,$,$,h$,X$,@$,($,$+$+$+$+$+$+h$+H$+ $+$*$*$*$*Illegal byte sequenceAttribute not foundIPsec processing failureNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisk quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$6H$6@$60$6($6$6$5$5$5$5$5$5$5$5p$5`$5P$58$5 $5$5$4$4$4$4$4$4$4h$4P$48$4 $4$3User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0xdr_bytes: out of memory xdr_string: out of memory isatty%$sniglet^& error: warning: /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONSmmap(2) failed, check limitsmalloc_init(ES): hole in directoriesallocation failedmalloc() has never been calledjunk pointer, too low to make sensejunk pointer, too high to make sensemodified (page-) pointermodified (chunk-) pointerchunk is already freeirealloc: pointer to wrong pagepage is already freefree_pages: pointer to wrong pagefreelist is destroyed(%p)ifree: junk pointer, too low to make senseifree: junk pointer, too high to make senserecursive call in malloc():out of memory in free(): in realloc(): ((((( AAAAAABBBBBB arc4_stir/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/binHASH: Out of overflow pages. Increase page size TMPDIR%s/_hash.XXXXXX/tmpopen_temp!U!X(!X!X$ !X5!XR!WR!Wq$!Wv!W!W!W!W|!W!W(!Ww!W!W!W !W !Wp<!Wh!W`!WX!WP@!W@KT!W8O!W0h(!W k!W|!W@!W!VY0!VY0!V^!Vc!V!V !V !V !VR!VR!VR!V\x!V D!V !Vp !Vh ~l!V` x!VX !VP !VH !V@ !V8 !V0 w !V( !V 8!V X!U$OpenBSD: args.c,v 1.15 2005/04/08 01:46:45 jsg Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $unblock and -DNO_CONV?@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: misc.c,v 1.14 2005/05/27 04:14:24 millert Exp $$OpenBSD: position.c,v 1.7 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.17 2005/04/08 20:09:36 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.43 2005/02/20 01:34:56 pedro Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.40 2005/05/26 20:16:21 fgsch Exp $@!b!b!b!b!b!b!b!b!b!b!bh!b!b`!b!bX!bX!bH!b!b@!b@!b8!b8!b0!b0 !b !b!b!b@!a!b!a!a!a!a!b!b!dp!d`@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.6 2005/02/02 19:23:17 jolan Exp $$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $!lY!lxY!lpZ!lhZ!l`\t!lXZ !lPZ`!l@Z|!l8Z!l0Z!l([ !l ] !l[!l] !l[!l]H!k]|!k\!k\T!k\t!k\!k\!k] $OpenBSD: modes.c,v 1.9 2004/09/16 09:55:09 deraadt Exp $$OpenBSD: print.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $!~8!~0!~(!~ !~!~!~!~!}!}!}!}!}!}!}!~!~!~!~!~!~!~!~!~!~!~8!~!~x!~p!~h!~`!~X!~P!}!}!~H!~@!(!(!(!(!(!(!(! !!!(!(!!(!!(!(!~P!(!(!~!~/tmp/EdDk.aXXXXXXXXXXt€$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: editor.c,v 1.101 2005/12/05 21:30:40 miod Exp $!!x!p!h!`!X!P!H!@!8!0!(! !!!0!(!!!!!!!!!!!!!!!!!(!!!!p!p!p!p!p!p!p!h!`!X!p!p!P!p!H!p!p!!p!p!@!8 abcdfiklnoprstuvwxBDEGHLPTUXYZ0!TTBlTXHPXDTB2l0@!xLFLBlFHDHPHdDTB2l0@!pnKBlLdOXHPODTB2l0@!hnLLHLdOXOdODTB2l0@!`(8Dܜ8܄ܨ2l0|!X(0$ܜh܄ܨ2l0@48v,.? ;@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.17 2005/04/05 01:18:53 jaredy Exp $"< "<"> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)4X4X"r(a4XyN"{"zb4X@yNh"z"zB4XyNx"z"zXc4XyNp"z("z"yd4XAyN"y"ye4XyNP"y"yp"yPf4XyN"y8"yF4XyNX"x"xg4XyN"x"xp"x8h4XyNT"x"wHAyN"w"wi4XyNL"w"w"wXj4XyND"wH"w J4X!yN`"w"vlHL4XyN|"v"vm4XyN"v"v"vn4X"yNl"vh"vP"v0p4XHXP4X"v q4XyNH"u"u"ur4X"yN"u"u`"u s4X!yN\"u"tS4X!yN"t"tu4X"yN"t"tx"t`V4X w4X"yN"t8"t"sx4X("s"sX4XAyN"s"s`y4XyNt"sH"s z4XyN"s"r"4X"r~4X!yNd"r"r?4X#4XyN"rx"rX.4XAyN"rH"r0yH (press RETURN)... (interrupt to abort)"|"}"}P381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $"P"""""A"B"C"D"E"F"G"U"V"a"pb"hc"`e"Xf"Hh"8i" L"l"n"q"q"r"s"v"w"x"u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $"("@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $"`"P"@"@"0"(" """"" " " " " """"""""""x"p"h"X"P"H"@"8"0"( "!"""#"$"%"&"'"(")"*"+","-".""""""`"0""""""P" "" pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL"" """""""""y"""4g"4g<"4g"4g"4g"4gٌ"4g"4g"4g"4g"4gd"4g"4gP"4g"4gހ"4g0"4g "4gP"4gټ"x4g"p4gÜ"h4gt"`4g̤"X4gX"P4g "H4g$"@4g("84g"04g"(4g" 4g"4gX"4g "4g"4g"4g"4gT"4g"4g"4gh"4g|"4g"4g"4g"4gx"4g "4g"4g("4gt"4g"4g"p4gP"`4g"X4g("P4g"H4g"@4g"84g"04g"(4g̤" 4g̀"4g<"4gt"4g"4g"4g"4gH"4g4"4g"4g"4g"4g"4g԰"4g"4g"4g"4g@"4g"4g\"4g<"x4g"p4gۘ"h4g(S"@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. "h"`"P"H"@"8 "0"/sbin/dhclient-script( 0(EHC P E(  0(EHDHC ;Zx0N@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.26 2004/07/09 18:49:57 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.18 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $$OpenBSD: buf.c,v 1.16 2003/10/18 19:15:43 jmc Exp $z$OpenBSD: cbc.c,v 1.13 2004/05/08 07:05:19 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $#$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $# #(H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.30 2005/11/09 20:03:29 otto Exp $4v#($OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $#!#!#!#!#!#0x ... ...#Fh#F`#FX#FP#FH#F@#F8#F0#F(#F #F#F#F#F#E#G#G#G#F#F#F#F#F#F#F#Fh#F#F#F#F#F#F#F#F#E#Fx#Fp#GX#GX#GX#GX#GX#GX#GX#GP#GH#G@#GX#GX#G8#GX#G0#GX#GX#F#GX#GX#G(#G #Q#R#R#R#S@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.37 2005/11/12 13:30:46 deraadt Exp $ $OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.51 2005/10/28 19:10:57 otto Exp $#\#\#\#\#\x#\h#\`#\X#\P#\H#\@#\8@#\0@@ @%s: can't read disk label; disk type must be specified#f#fX#f8#f(#f#e#e#e#e#ep#e`#eH#e(#e#d#d#d#dx#dH#d(#d#c#c#c#c#c$OpenBSD: mkfs.c,v 1.49 2005/12/19 15:18:01 pedro Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.19 2005/08/30 21:00:05 jmc Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.26 2005/12/22 17:23:27 deraadt Exp $#tx#tp#th#t`#tX#tP #tH #t@#t8#t0#t(#t #t#t#t#u0#u#u@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.17 2004/07/01 18:25:47 otto Exp $#w{}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. #}|\|`#~#~ P################(# #########p#`#P#8# #0#(# #################|( _@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.32 2005/06/30 15:13:24 millert Exp $#@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $##################°# #˜##€#x#p#h##`#X#P#H#@#8#0###(# ##################0####BKMGTPE@5MS7)  8 BxxxxxxxxH.xx:xx:xx:xx:xx:xx.uuuuu|R####۠#ې#p#`#H#8# #####ڰ#ڐ #ڀ#h #X#8 #(# ## ##ٸ#٨#ِ#ـ#X#H# ##xx:xx:xx:xx:xx:xx##X#P#H##P###P###P###P##P#P#H#(#P# ##P###P###P#x#X#P#P#8#P#P############ # # # #x #h #` #P #H #8 #0#(# #################### #p!#`"#P##@$#0%# &#'#(#)#*#+#,#-#-#.#.#/#x/#p0#h1#`2#X3#P4#H5#@6#87#08#(9# :#;#<#=#>#?#@#[#\#\#h]#X^#@^#0_# _#`#{#{#|#}#}#~##(#0#X$ %?##0#(# #######################0#x#p#h#`#X#P#H###@#8# # # # # # # #### # ## ## # #H# # ###X  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$ @0123456789abcdef 0000000000000000}$ $ H}4(܈<~ x4܈<~ 4܈<~ 44(ȨdȄ`Ȱ$ 44 hd8DLT\p0|@0|@<xp8U$9.shstrtab.init.text.fini.rodata.data.eh_frame.pltpad0.pltpad1.gotpad0.ctors.dtors.gotpad1.bss.note.openbsd.ident LL``T&UU!UU%4@@X+45D>DGdPd Wd^dgt {xl44a  ln}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X " X_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#A< r m & ! P K  _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID { v   P _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin"vm,%KB k f  u p / * Q L  _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & Q nobody*Unprivileged user/nonexistent/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  _rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) [[ $_f == xserv39.tgz ]] || continue ( cd /mnt/usr/X11R6/lib/modules ; rm -f *.[ao] */*.[ao] ) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp set -- $(disklabel $_drive 2>&1 | grep '^ c: ') case $4 in ISO9660) _fstype=cd9660 ;; UDF) _fstype=udf ;; *) get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype=$2 ;; esac mount -t $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs } install_disk() { local _drive _dev _fstype _fsopts ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _dev=/dev/$_drive$1 [[ -n $2 ]] && _fstype="-t $2" [[ $_fstype == $MDFSTYPE ]] && _fsopts=$MDFSOPTS if [[ -z $(mount | grep "^$_dev") ]]; then mount $_fstype -o ro,$_fsopts $_dev /mnt2 || return fi fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=39 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_dmesg "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_dmesg "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b ttyD7gttyD8gttyD9gttyDagttyDbgttyCcfgttyC0gttyC1g ttyC2g!ttyC3g"ttyC4g#ttyC5g$ttyC6g%ttyC7g&ttyC8g'ttyC9g(ttyCag)ttyCbg*sound0+mixer0,audio0- audioctl0/randoml0srandom1urandom2prandom3arandom4 lkm5tty00m6cua00m7tty018cua019tty02:cua02;tty03<cua03= apm>apmctl? pfc@systraceAxd0aaceBrxd0aCxd0bDrxd0bExd0cFrxd0cGxd0dHrxd0dIxd0eJrxd0eKxd0fLrxd0fMxd0gNrxd0gOxd0hPrxd0hQxd0iRrxd0iSxd0jTrxd0jUxd0kVrxd0kWxd0lXrxd0lYxd0mZrxd0m[xd0n\rxd0n]xd0o^rxd0o_xd0p`rxd0paxd1abrxd1acxd1bdrxd1bexd1cfrxd1cgxd1dhrxd1dixd1ejrxd1ekxd1flrxd1fmxd1gnrxd1goxd1hprxd1hqxd1irrxd1isxd1jtrxd1juxd1kvrxd1kwxd1lxrxd1lyxd1mzrxd1m{xd1n|rxd1n}xd1o~rxd1oxd1prxd1pxd2arxd2axd2brxd2bxd2crxd2cxd2drxd2dxd2erxd2exd2frxd2fxd2grxd2gxd2hrxd2hxd2irxd2ixd2jrxd2jxd2krxd2kxd2lrxd2lxd2mrxd2mxd2nrxd2nxd2orxd2oxd2prxd2pxd3arxd3axd3brxd3bxd3crxd3cxd3drxd3dxd3erxd3exd3frxd3fxd3grxd3gxd3hrxd3hxd3irxd3ixd3jrxd3jxd3krxd3kxd3lrxd3lxd3mrxd3mxd3nrxd3nxd3orxd3oxd3prxd3praid0arraid0araid0brraid0braid0crraid0craid0drraid0draid0erraid0eraid0frraid0fraid0grraid0graid0hrraid0hraid0irraid0iraid0jrraid0jraid0krraid0kraid0lrraid0lttyD7gttyD8gttyD9gttyDagttyDbgttyCcfgttyC0gttyC1g ttyC2g!ttyC3g"ttyC4g#ttyC5g$ttyC6g%ttyC7g&ttyC8g'ttyC9g(ttyCag)ttyCbg*sound0+mixer0,audio0- audioctl0/randoml0srandom1urandom2prandom3arandom4 lkm5tty00m6cua00m7tty018cua019tty02:cua02;tty03<cua03= apm>apmctl? pfc@systraceAxd0aaceBrxd0aCxd0bDrxd0bExd0cFrxd0cGxd0dHrxd0dIxd0eJrxd0eKxd0fLrxd0fMxd0gNrxd0gOxd0hPrxd0hQxd0iRrxd0iSxd0jTrxd0jUxd0kVrxd0kWxd0lXrxd0lYxd0mZrxd0m[xd0n\rxd0n]xd0o^rxd0o_xd0p`rxd0paxd1abrxd1acxd1bdrxd1bexd1cfrxd1cgxd1dhrxd1dixd1ejrxd1ekxd1flrxd1fmxd1gnrxd1goxd1hprxd1hqxd1irrxd1isxd1jtrxd1juxd1kvrxd1kwxd1lxrxd1lyxd1mzrxd1m{xd1n|rxd1n}xd1o~rxd1oxd1prxd1pxd2arxd2axd2brxd2bxd2crxd2cxd2drxd2dxd2erxd2exd2frxd2fxd2grxd2gxd2hrxd2hxd2irxd2ixd2jrxd2jxd2krxd2kxd2lrxd2lxd2mrxd2mxd2nrxd2nxd2orxd2oxd2prxd2pxd3arxd3axd3brxd3bxd3crxd3cxd3drxd3dxd3erxd3exd3frxd3fxd3grxd3gxd3hrxd3hxd3irxd3ixd3jrxd3jxd3krxd3kxd3lrxd3lxd3mrxd3mxd3nrxd3nxd3orxd3oxd3prxd3praid0arraid0araid0brraid0braid0crraid0craid0drraid0draid0erraid0eraid0frraid0fraid0grraid0graid0hrraid0hraid0irraid0iraid0jrraid0jraid0krraid0kraid0lrraid0lraid0mrraid0mraid0nrraid0nraid0orraid0oraid0prraid0praid1arraid1araid1brraid1braid1crraid1craid1drraid1draid1erraid1eraid1frraid1fraid1grraid1graid1hrraid1hraid1irraid1iraid1jrraid1jraid1krraid1kraid1lrraid1lraid1mrraid1mraid1nrraid1nraid1orraid1oraid1prraid1praid2arraid2araid2brraid2braid2crraid2craid2drraid2d raid2e rraid2e raid2f rraid2f raid2grraid2graid2hrraid2hraid2irraid2iraid2jrraid2jraid2krraid2kraid2lrraid2lraid2mrraid2mraid2nrraid2nraid2orraid2oraid2p rraid2p!raid3a"rraid3a#raid3b$rraid3b%raid3c&rraid3c'raid3d(rraid3d)raid3e*rraid3e+raid3f,rraid3f-raid3g.rraid3g/raid3h0rraid3h1raid3i2rraid3i3raid3j4rraid3j5raid3k6rraid3k7raid3l8rraid3l9raid3m:rraid3m;raid3n<rraid3n=raid3o>rraid3o?raid3p@rraid3pAconsoleB ttyC memDkmemleEnullFzeroGstdinHstdoutIstderrJksymsKdrumLklogMeepromNopenpromO st0Prst0romQnst0romRnrst0omSest0omTerst0omUenst0omVenrst0mW st1Xrst10mYnst10mZnrst1m[est1m\erst1m]enst1m^enrst1m scan0 scan1 audio mixer soundP audioctl44`4p44444 4 l 4 4444 4444|'4-45 4E4tQ4^ 4d4i4xo4w4~ 4 44 44,4 44l444 4H4@444 4H448)45 4B4 J4 O4U4[4g4q4{ 44d4 gcc2_compiled.filestore.30bootstore.31prom0_fakesaveechopv_putcharpromdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.68toppaniced.24pos.36LstdLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9putchar__maindvma_allocprom0_icloseprom_ioctlprognameallocprintfprom_sinetif_debug_udivpgshiftmemcpynbpgdevopen.udivtwiddlendevskprintnprom_bootdevicedvma_mapoutobp_strategydebug_rttbzeropgofsetcputyppromvecloadbootblock_countioprom0_strategyvprintfdvma_initdonottwiddlecloseallprom_initpanic_uremmemsetmainblock_tableprom_open.uremblock_sizedvma_mapinprom0_closeprom_boothowkdoprntexitstartdevswprom0_iopenobp_closedvma_freeprom_bootfilefreelistfreex 8`@#`1"" $@``T@.#(1b@`"@H*/+.0"c$  0  " x."  *." |!`." @㿐@l.!)@2"0#,`)L@ 3))" 3)10%0/)+0)0-)'05)7.90 ;0#t@}b@@( $(( c @ (!p@ ͐M!p 2%c @8@ ĐL 2@ ܐP@@ːx`#$c4b1   @'.x? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1?)@"h1?㿘 #@(1)@"x1㿘@E " ܒ㿘 @b㿘.#(` @e. "`0 #t@ #( $#(㿘.c( ? "c(.@c`㿐%.@6?41!'@?)@\"@  2'0)1a@R")11#.b!@ 2b 20!@"')b @>"!'@Ab 0 0#t 2 0"x㿘0x` 20."x#,"`"`"`"` "`"`" @`  "ct? 0 t ?0x 㿘  ; < 㿘 . @@<   @1"&  ?  㿘. x`0@|0c$  $  0. c@" 0"#,JJ`  -2*@0#,@ (*`J@ @ *`  .cP0"# J  *@J` )*@c$ 0`"#,``*J@ -& @00 *:  c` d a #(J@ s #(J@  #($#(#al @ ##(J@  @㿘@ . x`  @W`x$` $`%00#$ `( $ 0c €  #̒`$` $`$@ ) @$"02 @ǐ $`&` 2!00.` @"@} ) @ #0"@.` @Ԑ.` @ϔ . "` x.`  $$ 㿘#0c$`   ``*  `c$   '@`2`0`,6 * '@ 㿘  & `& $& (   € " '@ 㿘 ` @+ 0#$ `( ( @0@ 㿘   2  @ $ ?/`$ *㿘0#$` `0`4 㿘0#$` `?`8 ? 㿘  ,`)@N#(?@ `?㿘 ,m`€s㿐0$ ` #$    #$O!. x#?  `$ *$`P x`/`$*O O /O㿘㿐0#$ `      O ? X/O O /O㿐0#$/  0T@㿘  㿘0#$`t€㿘@.@e㿐0c$    #$X#$ p@X. x` . #`#`` .   Ћ@+@ `` bb* * * * * *30c$` `€ 0 )H @@c$|@㿘0#$` !.`@)@Nc)@c )' c@ ) @cȀ   !`!N@J@2J`N` " 2 㿘0#$` €) 0#В@ 㿘!.#ߖ ??" #.㿘)/ ̀ ?N  @  0"""$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` )@ː#+  " * @7 $`0 "$`4 " @N$` @ 2 &  %  *@  㿘#/`̀  @ 4 "$` & 4$`́㿘. |*`@ .* 8@!̘ ..!T        * P@i` `. @ . |8 <?*  И آ&@  ` . а@㿘?(.,10\&#$ H L` T ` X P d l$ p  t @/ .@㿘0 c8@i 4 4 0@ ct*@ xG * #8@  #8#8@ 8?@?# @!a%#8?@?# @!a#8?@?# @! a #8?@?# @ *0 `*#8@ @ϐ @㿐`*@Ð @?@ %?# @! `  a `  `  @`@`쀢 *@?  ?# ! ? ?# !!*` !*@!*,@`@2,@`@} `@Ē`Z*`  @p@ ` "`,@?`` A*`,@` ,``,``,``@X``@`@5*@ @  -*,@ ,` ,` ,`  ?`@*@* @-``? ? 0"c4* @!@K& @  ` @  ! ??#2   @A :d뀤 '@`,    6`,`  ̘D  "`,= x*@`,*` 0ct@ & *@ 0'@ E   2 `, "`,`@"'@`, @ 2`,*@!? P# 2H  C*!(*!0*!8 @    d d @ "@  @@ @X @ E   :    *"@ @X!P   @@ "  @$" `,   @` %   0 d"#0  "  40ct@  *@,!X0`0, * @m@0ct@ ~ *@!x00ct!* !@0ct!*!0ct!*!@ i @0k`0@ `7E    @ " `("L@ 5 1* ? )*!!*!8 @Ր    d   @ @` ?$ @ @E  `0Ѡ (0*@!0c0 4 4&` &`6`*@r6`,@? 0"c4*'@@! 㿐` @*0@Oฐ`@@༠@ * @ @ݒ@x` * d, `0 200@"x @Ð* @ @' ?  "? 6"?% 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`@@$,`& 㿐   <P @5 40*:  8  20 @8 0<D @L@ @  Ȁ)n 2; @G0$  " @g  d  *  0 @g$ $  $@&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @  " *@B<@@` ڐ2 ``@Ӑ 㻀@ː Ц @ &`@@$`   `  @2 %\F!T@  0@@eg0   @$ t,   $@  'a L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@, W(  2LL@@5 $H  E;@t%( 8@l"@2 0 K䰒 *@O`  d*  0` @KO / ' 'ݒ L@  @   0@+ @%@" Ё㿘 &     . @ "  @0  .  "  @0 @@  а 㿐 @ @&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  "`"`"`:`8㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  p[ j1!1a"'А $  $ $ ''X@Ғ 2V?.a??"a4` $@!#`"#@ #\ @  !0*@W!;?#0#lcp@#l*`4cp' @2 `*@>""?1'ܠ 1a"@~܀ ?1"(1`x(@t܀  ?1b@܀ ? ?  M1 1a?@G 2B?@@> 29?.a0?"a6 l"&#`a#@b#\ @    0 H"ct''@( ?@I ?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ x.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ ( ( @ `  -``( ( *"8@     2` * @h *`  * +` **` +   h  (@ g@ e@ `-`  ` րϰ    *` *   *  M `/  M /" M MJL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` *   @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐^  [ @4 U  @P2 *@    @ t,`  ( 6h" 1  '"@@''   b 4  @   " 'w@ N@B< 22&     ":?"   ? @ : ` :?  $"`"`"` :`8   㿘  ,  ". /.".+."&  "!"..S 0N L ?I 0F @͠L@ *L0: 07 0pؒ  @ Ő@ q 8 'p@ t    $ #`a#\b` @  ? 0 H "ct؀`0@   "#t?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ ($` 8 @ mt$`     h #`ab`$#\ @ ? 0#t x 0  &,& &&& D& &(&$@ ;㺈 ` ($ a b????#\#`  @ ? 0#t `  dh@ d .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @L ,? L `" H0"#t?@T@Ք0 *"@@ 0 H"ct?㿘@Ȑ .0 "ct!0"!6 & 2?0cx"cx0 "!"0" ?㷈0#x#x` *@ ǐ"h N  m `/2N N /" N a  0 ] @H x  <$N O  N  /  .ؔ A.0 0x" 2;x@ @  $+  (@C;@?O`/ x@/ x@+ x  @$ x N  x&`  @ x@  x㿘  "& @ x&  㿘' #0!0%*@    ? ct2  !l @   ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  .0؄( 4 "`8"` <"`@"`D :`8 㿐\@?<6   '?'?@ ?1p '?` '?`@"p"?'?Đ #`#` #`#`#\ #`c@$ #@? 0` @``2*"@"0 H"ct?㿘!0$#t@I 1 p@ 2?`2 ?`*` $#t"@h ??"@?21t0( 2  2 2 *?1 t # t t0("# t" " " 㾐a"@2 o'Ô?'' "p #\#` ""   C   p'–0 !0#t@d?*@" H$#t8G8G8H88H88H 8G8H88H8H88H88H88H88H88H88H88H88H88H88H88H88H88H,8H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88G8H88H88H88H88H88H88H88H88H8H88H88H88H88H88G8G8G8G8G8G̝㿘`Y1!*` €1*0"1*-#1**#(1*'#@1*$#P1*!#h1*#x1*#1*#1*#1*#1+ 1+  1+  81/+ ДP@ @ Ё//@**@"㿘#//!/"a$a \P'P'T'X@W$!a! *`2*& +@* hJ?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 `b\4 `4 #\" .@U +@ ? 12a a2  a @ 0. ? @ .??"b $`㿘. @k 5㿐@0!"#t  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` ."    1`'"'ܐ@,ܖ@ژ( @?+ @:x@ް yހ( (  s?@n?2l?2` 2g? 2c?2``<`]@l 2Y? &U?``  2M?` &@ǐ  4 & ` 2>?` "6`` %+@ 0? ,  $ $ ' '`'''4 @.  ?$$ $ $ $ $$ $ $ $ ` ??㿘\   )0 <++`%#t(?@ @`@,`4 2 #t   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘/!1,@  .  @{ 0,@@ "@p  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "< N ,N`$* `.! ؒN*`? @ . ɒ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` Y+` ??㿘X  @,   .b@%  "` ?` ?7/.8 :  0 *@ `  *@`*@`/*!8" @ ` ?  2  㿘/aP'H'L'P'T 'X @"aP@H+@!4㿘+!㿘1"0 , @` @ , 㿘@@n㿘@ 㿘 D " ? 2  H10 L&#t@e  $ #t `$ D?$ @ L$ ?$  @`$㿘אԐ* А* ̐?. ?$`@㿘."  , @     & &"   & T`?& & S`?   2?  ?B& @     `* ??w?2? o  e  "  D Z   D  ?& @㿘@h?7`5@ X/!T. `%"   >`P>@>`>`>`>` >`(>`0>`8>`@>`H+ ?@, @ `@ &`L&@Z&`H0 @ ܐ`@ X@ɐ?㿘 0 "ct?1"0. @ /. !T @  L@@ X@㿘/!T.   @?? ?2%  ?% @%   T "<   8 @a    "@"% %% %  "  @* 4 0#t`% D " %   &   B @ B = = % DW  D  L!0$#t@ % #t % D L%@* '% @  P@Z" % P  P ?% @ @   @+  = =   @; % P @ 2   D 2   2x T  P@)"  % P&㾘 0 1"0- @/@8!T-  `T @?2*$`(&$`" ` 0o l0k @ F`2.``)  @ ?V @ `L  <`P<@<`<`<`<` <`(<`0<`8<`@<`H+ ?@ @$@$`L$`H`4 `5`@1`@ f )`' a !ɒ: @0  [d 4 `0 ["ct??.ⰔⰖ ? * `:```? .b "b"    .Ⱀ?"  Ⰰ@ @   @ *0   @ *`㿘1. "0 @  @  0 $"ct2  " @      @ $0"#t`0 "#t?㿘1. "0@ @  0 "  0  [ :@B: ["ct? ?   ` 㿐1"0 @  `  ` 0 D"ct$@$`$` '? 80@`` / "`J .`)$@&$`  ܨ@  0"@ € ` ` ܦ `" ` @0"#t$@?㿐1. "0 @@  0 ,"ct" @ * 2`      0 "ct B< ' 0 "ct&?8f8gL8g8hP8hP8hP8hP8hP8hP8hP8f8hP8hP8g8h8hP8hP8g\8hP8g8hP8hP8h,㿘'H'L'P'T'X"Ē@ H㿘"Ē@8N@`N@`%` N@`|`!p*` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈+!(@ @,@Ԑ  ?L?㿘."` /!d+ a@J@ n#!dl  (.#@ ."@  'h@@B`@ `   +$!Hƒ  .א 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hb4 j4 h"$@#\ ./? hl'l+Ґ!p ` `4` 4`  $4`㿘.Q(㿐g0-"#t(2*?@ 2&?`(2"?`&2?`  @??.#.*@ *`@ `u  ??㿘@ /`(+`&'` # `Y   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  : : *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  8~8888888888P888|88l888x8,88$88d888p8x88 ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8 * " <" 8 㿘 N 12:?@ 5?2 (1? $ "x$ ($ 0 , 2 ("$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 +-ሒa  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4>  ( 2   $ * $ ($ 0$ ,  (&@@    4"@  ($ 0%$ , 0" @8 4   "@@   4"@ ($ 0$ , 0 ( $ 0$ 0 , (@@$ , 㿈 ɺ $ Ŧ  "? 2  2? 2  $   8< `!\*` € ` $"&  @?*``` * 4 D  y-  u-4 $  m * $  @! $& 8  $ ¢ "k&  @?*``` ?c4 4 *` , $& 8   $   & & & &$<$8  @ $& 8 $`";&   `$@4 $"0&  @?*``` $4      -4 $  $ $"0&  $4[ `$@` 4 "&  @?*```?c4  -$@   $@ Ā88 ܒ@%"@$@@%'@"&  @?*```  a$`4  $d4  $\4a򀢠 $$hh\@-" p"&  @?*``` h *@*`3 $h4\ hp0lT-"(*`0  $h $T$L$l @"   -c"0-"0&  $ $$h`dh :pT * ?L * @@7`񀢀7  "N&  @?*``T*?L * @@7`񀢀7  @   ".&  @?*`@ ` $@4h*`3`i$h !  @   "&  @?*`@ ` $@4h` *   45 @   "&  @?*`@ ` $@4  4h @   "&  @?*`@ ` $@4  4h`d Q?? ph?*`2`?$h`dh *QT "0 $L$T$ll` pT@H -` l*``p$P$Xd  @7X y- $T * ?L * @@7`񀢀7  "t&  @?*``T*?L * @@7`񀢀7 - + 7*@* 7 2` "H&  @?*`` 2 L* @@7`7$@4$@4$@   z$ @ u$2-  $H$H @   "&  @?*`@ ` * @? @$@4 $@  $X * ?P * @@7`񀢀7  "&  @?*``X*?P * @@7`񀢀7 ` , 7*@* 7 2` "&  @?*`` 2 P* @@7`7$@4$@`@4 $D `$H$H @   "&  @?*`@ ` * D? @$D4 $@ ,D"@i $u&D"0 4($ ""@@ @&@8"$@% @?.@``@ 2 $H  C.@$` 6`8  ":&  @?*``` &@B > $@Β&@$& 8?c4 4 *` , -"0&  b$   $ ?M?& & && $8$<(   8   ђ  $3?  '  B& @B > >   $ @z"@$& 8 <@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?  ` .?`   @. @+  ?[   $? ( @ 4"@  ( $ , 4 "$ , $   " ? $ " ? "?" "`0  @  @0#   ( @#@㿐 P?`$ 2`0J 2 < D?   h <  8 " * % <%% 8  ;*  8  <2`?% 8 % <  % h@```@ @B  " %`%@=` h?` `3  =`=`  % "? $ 2 ?   <`?㿘 `"h?`$ "d?`("`?`, 2`0Z? 0  2 4Q?   $ * `( `0 2 @`0`,€?0=@' >`> `> `0> ` > `(> (`0> 0`8> 8 L%0@ ,@zА" ?%0@$`L PzВ"@ e0@ $`P l:А" ?%0@$`l $ * 4~$`4& $ 㿘?4`c @@c@@ ? @ ? ` " ?@@`?c@? @ܒc* @! F?"P  ![@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ ϲ`##񀦀ðL(7@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ β`" !?@@`!?J#F#. @㿘?!? @#   0##6`6 ? @#  @& & 8& #…8& 8& . @'X'D'H'P'T /```0 TH) @ ( 6T  ?, "?8 2P @ // 70 0P&@00P T:     + "  *   /`.  b``(/`  D X 2?7   ``0@`  DH) @ (@(0@X6 0  HD -X '--h⦲!}'-?$' P( D'      ?e ° ? 'X) '@ /67/. @/7 `/7, , /`7 @(3`0,626  ( 5@FX*`H(@ X" '@ @ + ,(& *.``@ . & 4`D, @eE P- (P(P#8z0 @//+` '7  P  /7 (3.0626 ߀P  T&@.$%- $h     "@(  /h ( 00? # . 0. 㿘.# `1/!h㿘`._ # `G8/!h@6  * `@@  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6  ` /!h@6  * `@ 8`  `2`` 㿘  $ 㾘;;n # '  x*`"``*ߒܐ`ɐ.6 > ʐ`.6 > ޒ㿐    b`  ?   b`  `V  $D`  $$`$: 7 y  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  -#x4@   "  d`]4 6 6 ,@ ,  @  "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d , 6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@%!>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x dvma_mapindvma_mapoutboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenode %x property %s length %d > %d Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.2read header: %s ELFunknown executable format %d+%d+[%d+%d]=0x%x boot: short read read phdr: %s Can't find entry point. %s%lu+read text: %s +%luseek to section headers: %s read section headers: %d %s%ld [lseek symbols: %s read symbols: %s ] bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_read: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.2.30123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %s`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@ 8% 8(8)8)8)8*D81x86d868888$888>8@8A8A8A8BD88 88 888 88 (8888888x8p   8p@` 0123456789abcdef/8ư8x8x(8(88X8X88(88,8)8@68PC8N8W8xb8`q8v8888T8888@8@8088x888 8"\8$8+t8+8/'8//80`888889889F8:S8<4`8<8Bm8Ey8C8Gd88H\8H\8888I8J\8J8K@8 8R8SP8T$8888U8U8U8P8V48Vx88V8WL8W8T8`@88a8a8bd8c(8d8e8d8i$8iT8j$8j,8o<88mH8m8U8mLd8o(x8m8mh8m8nt8n 8m8m8n8nP8nD8nh8n8n8n8n8o8n8o8oP8o,8rh88pH8pdU8pxd8rTx8p8p8p8q8qL8q(8q8q@8q|8qp8q8r8q8q8q8r08r$8rH 8s ,8u88t8H8sU8sd8ux8t(8t8tT8u8t8t8t8t8t8t8u8ut8uP8uD8uh8u8u8u8v(,8yH88wH8wDU8wXd8y4x8w8wt8w8x8x,8x8w8x 8x\8xP8xt8x8x8x8x8y8y8y( 8{,8|98`D84D88D8LK8 [8$d8Ls8h}88D8(D84D888(8\8v8 8x8|8@8888`@ 868e 8& 8. 8:8D@G8P8GdY 8g8Hp8DT8888U 8B8I8 8h8881x 8t8a8Q\888}T 8l884)8o/8+98@C8bdJ8R 8Y8a`8|e8|m88$y8o 88T$88 8p8h8l88 8RP 88-l8h| 8 8 888 &8 3 8l98G8dM8]S8X8`8uf8(p8x848x 8x8 8 8$ 808.8{8>8$8 8A8A#8 28B;84C8K8VR8P\8fd8Om8Xw88$8V48=8 8c( 8Ő8oP848BD8zT888Z 888888+t#8-87 8x?8)H8Q 80W8U] 8pl8K@t8y8U8sl8/H8 8@8)8i$88k8% 8 08QH8A 8 8L 86d 8 8o %8Vx -8 88. J8h U8, c 8( q8 {8sl 8v 8t 8/ 8  8 8 8 8p 8( 8*p 88 8SP 8\ 8 x 8p !8f )8V$ .8l 3 84 88) B8 P8 V8 f8 k8( t8iT ~8*D 84 8 8$ 8o 8Y 8T 8rp 88 8 8 8 8 ( 8z 8T 8Z|  8, $8 2 8 788 E8 N8D `8` egcc2_compiled.open_countnetif_promfilestore.30bootstore.31prom0_fakesaveechopv_putcharsun4_idprom.86dtabstringbuf.96promdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.109elf_execaout_execelf_seekread_inodeblock_mapbuf_read_filesearch_directorypnmatchdirmatchnfs_getrootfhnfs_lookupfhnfs_readlinknfs_readdatarpc_getportrecvrpcebuf.24sputcharsbufsbuf_endsbuf_lenrarpsendrarprecvbuf.39numberdigitsetherbuf.30paniced.24gz_magicget_bytegetLongcheck_headersstoppos.36arpsendarprecvLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9Lmul_shortwayLstdfixedtablesupdatewindowsyncsearchLetextcrc_table_emptyfirst.24make_crc_tablecrc_tablegf2_matrix_timesgf2_matrix_squareputchardvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopyloadfilecd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenrpc_fromaddrrpc_portstrerrorrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openerrnoocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodeinflateGetHeaderfile_system_cd9660promvecssymxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbootfile__ashrdi3crc32nfs_statinflatePrimenoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpcd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypecrc32_combinedomainnamelenprom_open.urem.remrpc_pmap_numxdr_inaddr_decodeobp_recvdvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumgetpropprom0_xmitadler32_combinekdoprntexit_divesymufs_writegetpropstringstartfile_system_nfsbcea__moddi3arpwhohasufs_stat__muldi3netif_closeinflateSetDictionarystrlenopenreadether.umulhdrinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freecloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefree04 `@# ` "" $@` `T@  p b@"@H*/+  "b   0  "# "# * "#!` "#@㿐@#  a"a @ "  "8@c@  @   " @@㿐 c@T    "P@c# @ D ?#c' / - + ,`2 h@k㨒   # #@^㨒@a#@`b@S@?@2 @a aa @F`#@Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @"1?㿘 #@(1 @"1㿘@ʐ " ܒ㿘 @  㿘 #` @ "  `  "  ` ""J  *@J` )*@㿘@  #` @ "  `  €b  $€b 2$   " @ɐ"0   $  $`$` 㿘# b `   ``*  `b    '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 "   @@ 0(@  㿘  @ $ ? `$ *㿐 " /  0T@㿘  㿘 " `t€㿘) ! ?N  @  "!Т!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ "+  " * @7 $`0 "$`4 " @$` @ 2!&  %!  @# 㿘# a  @ 4 "$a & 4$a㿘 #*`@   #0@ \   #         #H@y` ` #@  #8 <?*  ` آ&@  `  #`@㿘?( ,1 \&" H L` T ` X P d l$ p  t @  .@ dd ? * `:```?  `h "`h"     d?"  d㿘 a'H'L'P'T 'X "a@/H @#h㿘 #p4 (4 4444444444 444p4444 44444̝㿘 'H'L'P'T'X#`@ H㿘 #`@8N@`N@`%` N@`|`  *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈 #x@ @,@  ?L?㿘  l`  !  cJ@ #! @ @   @ *0   @ *` ( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" %s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx44,44444444   444p4p44444p 4-4 D84A4L4Z4 He4r4\4`44 4h4 44 l444@4p44444444*4034:4A4xH4lO4V4]4d4k4Pr4,y4 4D44t44044,4@44|4\*434h:4A4H4O4V4D]48d4\k4r4y4444ELF@4,4 ( @@,T0a0P xHP rHP nHP jH`HzHP ^HP RHP XHP RHP NHP JHP FHP BHP >HP :H  H H H  H  H  H H H H H H H H HP @HP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H0P  HP  rHP  nHP  jH`HzHP  ^HP  RHP  HP  RHP  NHP  JHP  FHP  BHP  >HP  :H   H H H   H  H   H H H  H  H  H  H  H  HP qHP  HP ! HP " HP # HP $ HP % HP & HP ' ޡHP ( ڡHP ) ֡HP * ҡHP + ΡHP , ʡHP - ơHP . ¡HP / HP 0 HP 1 HP 2 HP 3 HP 4 HP 5 HP 6 HP 7 HP 8 HP 9 HP : HP ; HP < HP = HP > HP ? ~HP @ zHP A vHP B rHP C nHP D jHP E fHP F bHP G ^HP H ZHP I VHP J RHP K NHP L JHP M FHP N BHP O >HP P :HP Q 6HP R 2HP S .HP T *HP U &HP V "HP W HP X HP Y HP Z HP [ HP \ HP ] HP ^ HP _ HP ` HP a HP b HP c HP d HP e HP f HP g ޡHP h ڡHP i ֡HP j ҡHP k ΡHP l ʡHP m ơHP n ¡HP o HP p HP q HP r HP s HP t HP u HP v HP w HP x HP y HP z HP { HP | HP } HP ~ HP  ~H ġHP  vHP  rHP  nHP  jHP  fHP  bHP  ^H H HP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~HP  zHP  vHP  rHP  nHP  jHP  fHP  bHP  ^HP  ZHP  VHP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H 0P  HP  rHP  nHP  jH `H zHP  ^HP  RHP HP  RHP  NHP  JHP  FHP  BHP  >HP  :H  H  H  H  H  H  H  H  H  H  H  H  H  H  ޡHP  HP HP HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP mHP ҡHP +eHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H > ;8;;;;; ;(;0H )@`  > !  > ;8!5 > ,0+0;"+*+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >  9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->  %)> Ǩ!t %"+/> -> +cP> #В`"##t@> !#;x ;"`;" @`@^Ҋ@@2 @ 0P -@ @ @"P/> P->  %)> Ǩ!t %"+/> -> +cP> #В`"##t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @t x ``-`ׁ @  tx ΁ )>!4@! P->  %)> Ǩ!t %"+/> -> +cP> #В`"##t@;x;;>!<!@ ;`#h#l;;;;@``htx ;`#h#l;;;;@Ț``htxm )>)"@)>)" P -@ @ @"P/> P->  %)> Ǩ!t %"+/> -> +cP ;`@;h#t;x;;;;;`@\;`htx' /> -> +cPۜP -@ @ @"P/> P->  %)> Ǩ!t %"+/> -> +cP ;`@;h#t;x;;;`;;@p;`htx -?P -@-P -@ @ @"/> /> /> 6PP->  %)> Ǩ!t %"/> /> /> P;x> #ؒ`"#خ@;,/,;@ ;`,;h)> ##pH  p@  "`@`E <0x  +?P`-@-?P- %0P -@ @ @"/> /> /> 6PP->  %)> Ǩ!t %"/> /> /> P;x> #ؒ`"#خ@;,/,;@ ;`,;h)> ##pH  p@  "`@  0@@ސ`x) `E <P -@ @ @"/> /> /> 6PP->  %)> Ǩ!t %"/> /> /> P> #ؒ`"#?P * * ;`@;h09P -@ @ @"/> /> /> 6PP->  %)> Ǩ!t %"/> /> /> P> #ؒ`"#?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@~`h ?P `*  P -@ @ @"/> /> /> 6PP->  %)> Ǩ!t %"/> /> /> P> #ؒ`"#?p " ?P "  ;`@;h@`h ?p " m @/>  @̀->  $)> Ǩ!t %-> +cP-> Ǭ VP @ H ,@`#> a$` (08 @̀;)> !,0+0;"+0+0 `# @ 05-! % >&t 8 >0-@0=`"-@-@0 `# @ 05-"Y  -> %- +cP ;`@;h #t;x;`;;;;@;`htx -> & 0Ʀ! H,@` !`hpxX (08@HP @̀H,@`%>  $!> !`8 (0 @̀@ @̀  H ,@`#> a$` (08@̀؀2>?@ @̀;'> ,0/0?"/0/0 `# @ 05-!$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#> a $`!> !`8 (0@̀ -> Ǭ  @wP-> "/> 4ΐ  ! H,@` !X (08@HP @̀> ǖt `?* `"" * `@"> ǖᓒ  * `@&* *  ֊@* "``'1@'0@ )>+>%@#' $(   ǒa ǔ  ǔ  c  mt@ >   >  @@   >  @@ #>%>( a@%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c@> "! *> "!(!`> "!,H(  /  > ==> ǜPH > "!0> "T> (a@ W"@!> $#H``> "c !>%#!>'"$ $ >& 2> " > " > "!> "!<>#"">#"">#"#D>#"#l>$"" >$""H>$"">$"">)"">)""0>+" ԁ@@曐d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P    "%> > > "  "> >@ >  !>&c# !>&c# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * > ǁ >@ *> ǁ >' p@5" > " > "   > 4``6 > a > ǎ  !!`>  @f> #`"#> #ܒ`"#܂ >  > > !쁈`耒2$j0>'@WQ!h>'@WN!r>'@WK!switch rqswitch wchanswitch SRUN> > : H> " (o!쁈`j>*L"2J "2 J    "2 J  J " > `+  @ #@"   *@ * H1  (1> "!P `!쀠"I"j > !`"!j ` *@  ( !> !` (08 2㿠@> a` Ъ@@>`€"Т@: H" H*/  dh> >(`" `2 `2`2" " ?" ?@>(`" Њ@" "@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*> a>)` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >*L "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a> a """"""""""""""""@2?# * 2  ac  @ a> ?xx @ 3 > ! c@  Њb@&""""  > `@ @> c ``44: " longjmp botch@" `&"`㿠>+@S&!6 0㿘``@`€Ð  ``€  `€ <`㿘``€  *`,`€ ``€  `€ >怎㿘 ͖  Ȗ Ö   ``€e ```€ ] ``€W @€` ```€ J ``€D    .@€` 2```€ 1 ``€+ 耤 ``€"   㿘M e  ` [ V  Q L ``€ 0DXl ,8DPPDp||X(` L4X4d444-.D.t....5H5H..///05H1<242|233H1<5H5H5H5H5H5H5H5H5H115H5H5H5H5H5H5H5H5H5H5H5H5H5H3|1000045H5H5H5H5H5H5H5H5H1 666666|6|6666|6|6|6|6|6`666666|6|66666666|@777:d:;P;<  >4CC>>??0?L???@ACCCCCCAABBԝx!> !d a@.!B !H!  €* 2 aS 2!H!H`€ * 2 ` 2!H!H`€ * 2  "!d!H `@  7@$a @2 !d6!V6!X6!Z!d@ &!d!H`  !^ /     6!l6!n6!p 6!r  6!n6!r6!l6!p!H `@!^ ` : ` ">  0  > !H @ >  !H!H!P> !X!`!H`  !H`! !H`  !H`( !H`  . `!L <.!d  ">  "ah  d!L .!d> !  >  ! > !2> > !!!H `v€a id+ &> @2"+ @> > $p!@> > $p ! @> > $p!А @8R  !^> 3  @8I !^    !H av€a  ̀id+ '> @#+ @> > $p! @> > $p!  @> > $p!А > 3  @8 x !H`!L€  `*`>,! €> @7 >   (">   (" >   <"(>   < "0>   <"8>   <"@.!^.!d!H `v€! >  @7H *@$!H ` €!d* 2``2   >  @7`  $ <.!d *@$!H*`"  !d@ +.!d  !H>!x>!`"!^@!^ !H`  Q d!H!   " !H B   !H`  ; d!H!    !H @  !H`  ` ## d?< !^!H > €bx0!^  !H`€  " !^0!H`€  !^  !H`  !H`  !H% @ d!H`  !^ 5 !H`( `€ * 2 `  ! !H`€  * 2 ` !H @`€ * 2 ` @!H .!H!H 0!^  /( !H!H @!H `@ !H `"!^@!^ /  # d? X> !H`€* 2   7@!є J!^ @7/b <)!777777@! 耢.7" @/"?#@! )!@" !H> #`#\@6K 0!H`$  !h "!^ !^ /#( 3``$ &!`$ 6!6!77`$ @!f7  !> "@6  77@!R 耢@> Ŕ!d  &!d!d* > &!d @5 @ 77@!7 Ґ!!^  !d` ` 477@!&  7@!  @!d2  ` ꀥ   %6!P6!R6!T6!P6!R6!T !_> #x> #!P> !R8#\!T #`#d@5!^ "D@!P!R* *`!T  !L 2 > 2 @5 !H`€  > @5 !V> !X   !X!Z@5  7@  5> 6!\*` @5o2@" !H @ > !!^  .!`     !L `  &!`@5F 0&!`㿘@" !^   2!^@" !^ @ɐ0@㿀!^!L   2!d !d2 @2   !H `. 27 ` 7 `  7 7  @ ;7ߐ 67@2` `72 7@ ) 耤ΐ 57@2`2` `@ 722   7@  耢 3> @3`2 23`#\(   `@4  37 `7 7@ 耤 > ` `@4 0 17`7 7@ߔ 耢@ !^   2!^@y !^? # S!! @7777777@ ^ R!6!!!7777777! ! @77777@ > !6!!!77777@ 耢,6!!6!!^ J? 7耢 7 7!^?  7ꀤ @g @> @4 !  .!㿀.`* !L *  07.`  7 @C @>   71@3 ,*  2``d !d 2   `.`,  8@77ꀌ 77  2 * @7> 2 #\#`В @3@ ' 8@7777@ 耢$*  72!`   977 7 7@Ҕ @2!` , *  @2  !2 ! *  `@.!!!  `@.!0` 㾨'D!L> '|"'@'|D 0"d2` ` @ J `D  !^` / !_ |?# @3DD@!P!R* *`!T  ||@ 7@|@|!D2d2 `2?#| @3|1 * 2 '@ 1 > D' @3$$1 | *`  1  > D'@@2  1 |`  1 `> D'h@2  1 | `) |D  ^) 1  /2DD  !h 1   @   D @ 0 @  1 @D ^ /D @h ` 1 @`  D D  1 DD!P!R* !T*`  '  8 77'77@Д D !^ `/ ) DH ` !l'D H `!nD !H `!pDH`r D!L ?h }?p zpp/`'\t*`l'Lh2 7 'X'/`Xt\2'H'dHpt*L3 h'<'8l'T+8'$<*`3 2 'D p@ $ 3 '4    37`p7 ',  3'`7 7`p p7 7`  'P'@'0'( 1 g> ) W) G) ) ) /) ) ) ) ) ) ) lt#\4w) 7 ) o) ) D@1' D>  '@1? *@1 D!a @a> aa1 (1 $ 1 & @1 2 D1 *1 01 ,1 .1 41 6D @1'|  @ ) )( (ad2    0?# @2 *`@0Dd2    0?# @2 *`@0Dd2    0?# @2 *`@0D!d2    0?# @2 *`@0   ) ) (  ((  0 * D!d2    0?# @2 *`@0   ) ) ( ( * Dad2    0 ?# @2 *`@0 Dad2   " 0"?# @2 *`@0"Dd2   $ 0$?# @2 *`@0$Dd2   & ??# @2 *`@?#0&(  D!d2   3 @2 *`@3 ?#0  Dad2   3 @2 *`@3 Dad2   8 08?# @2 *`@08 : ;) ;) :(: ;(;Dd2   < 0<?# @2 *`@0<Dd2   @ 0@?# @2 *`@0@ B C) C) B(B C(CD!d2  " D D?# @2 *`@0D| ` 7 77  7D7777@Ɣ @;> D7!!7!7!!  /!! `` /!;> b > @.>"㿈!L c7! 7   7` 77@7@ ?  " @@ *  `@.@!L (? (㿈!L d7.`# 7`7 777@d @`?@%I 㿈.` j7耦  7`7@G @5  3 /`*`-5*0  0    5`- @   -4`, @ @ -`,` @ 6@   @ > "aL 'd'`>'h-B5> @w'\\@Yd 2  @\@ d2`@ `\ @/xd \2 d@2   x@P'\x"@|'p\"'t沐"'p'tp*" * " *  * " * "@*`@ t*` @ :`Dx**" "@ * *`" "@ * *` @ * *`" "@ * *`##@ + +` @ + |+`  @> h'\#\#`@/B \А"?@hb@@ b?'h a a?` aa aH 0 '\\a e6a 2@ H /d * % a   a aH 0 e6@ ?D 8a;ʀ@8a'\@ I#\a  a  a?` aa aH 0  '\\a @ha <hH /d * % a   a) aH 0 "h h#;ʀ('\he6@ ?D 'h;ʀ@h#'\@ I*h\@'hhʐd2   2? 7'\@ @\?d*a^  /d 8 d *  @#@ ?"@d d ?# + #a^ 22aPCaR* *`aT  %        '\ ~ \a^ ~`'ld@ ? "@* *`  *`d "- ,`+`(  l5`   @ 5-  @-`6`. .- .`d/   (  ?`+`(  ,`5- @ 6`.  @-5`- .`-`    ?`d 03  @ " **  '`l/`d#d "@+'\\@ \d ?#d@k ?d ""d?c !"a^`/ ]7'\7@ \ d>  @-ed   #\d> b$ 2`  `#\@> *  @pd#`  @-G'\d@3 \ ` *`  d*  (#7+ d *` d*  (@``@2@d` @2@aLd@2@@2 @  @2@$$ d@ '@d  'h'\@+Sh\d `/`d'`aL?`aL ?`ad2 "@" @@" @@ ?@ ?  ?  '@@`'@d  'h@+h > " > @*"Ё >,* > "> "> #> #>  # >  #0> #8> #@> #X㾰> 'D!L"''2     ?2`   2`  @D ?@ 0g` "@ 0(" ? ((!  ` @*<  '!D '@* @ C `@  !   2     ! '| '||*, ' @* *` (`(@@ ?'"@*` *  *  *  : ?'t`v'  @r 'x @l ` 2`D' `ǔ  'l?h,`'\'T( -'d'<T'4?P ', ?`\?0<'L l?Xd?8'D'$- L  , @ ?h?H?(-`4 D 0 ?@0 h, L?`H, (2 T*`P$@?h+` 3 ? @-T5 `,@.`D @$@ *32?`.`` @h?`, @?h.`h 4L@?hD*``.`h-`?`@`   ?`@ $ `-   0@3 ?h5?`* *`   @2+ 2' @2# `2 d22` 2`2t`!2 > D' @+ @ /'`?`8`  q2`D' `Ք $ q7  *`D7'7@;7> #*` ** * :  @*D ?o!@ og`S?%* *  *  *  : ' ~) x5 R`~ o7  *`x7D'77@ /'`G?@` 2>,!*` €+ &'> &@* +  + +    D'H; @*  !  ) > 'Dx@*{ !'  ~`~2 ) D6'  >   D@*b  /'`  >  D'P@*P * *`   >   02  !-,`+`(  5   6`.   @-5`-   .`-`    9 +`(  ,`5- @  6`. @-5`- .`-`      @#9   @" * *  *  *    !: 'D' @('D'@) > ?! 3 D' @)  q7 *7D 7@7 /'`5 | *  (@ q?  0(#!> " > @'U#`> 'D"!L'2        ~_ [ pe' ('@ @ϒ+ '@̖ * * `( '  D'' 4 ?`2   *`` @ $D?`2   ``@  ?`'D'  2    ?2   @ 'u`> Dp@) ? +`(,`  5-   6`.   @-5`-   .`-`    ?`+`(  ,`5-  6`. @  -5`- .`-`    ?` 02  @' * *`  '`/` 8' ' (!)  **@ *` `(*"`( *  * ) *  ( " ( ' /''8+  * @`@   @' 8*` *  ` +` *  @x!  t )  ,#\> #`,'D@()  (*` * *@ *` *"`, * * )+  *  (+ `" ( * *  * ( ` ?  :"(, *  ;> +  *  @2    2 D `'@'ݖ* * ( ?"( ( % (  ۬  @t'6+  *  ,> )HD'@' t 8+ @ *`     @ 8@ @`@@2`@2 '> D'@' M'0*` * * )+  *+`@  * :+`* * @ *` 0 ;+`+  * (  * ( ? "(+`*` * , +` +   *# , (D`"(' @% '*  (@ "ؒ"@*` *  *  *   @ 2```@ < 'D @%k@ > `@   0&'> " > @$֐#㿀> "'@8 @ ";!L!L2`  2@ p""@@28?``>,!*` €> #> #> #>  >   (>   8> X@@ > `@& ?@2`  ?2`   ?b > @$y p> 'D"!L'@` p$'@  ( p#@'@@ =  "7@@ `!q#4 @ !c2`4  D4 4 4 4 4 $ ad2  @  @@?# @2 *`@3Dd2    3 ?# @2 *`@3 Dd2    3 ?# @2 *`@3 Dad2    3 ?# @2 *`@3 Dad2    3 ?# @2 *`@3 Dd2    3 ?# @2 *`@3 Dd2    3 ?# @2 *`@3 Dad2    3 ?# @2 *`@3 Dad2    3 ?# @2 *`@3 Dd2    3 ?# @2 *`@3 Dd2  "  ?# ? ** @2@ 2@ # Dad2  "  ?# ?*  *@2@ 2@ #  n7Ȓ ! 7ʐ @@7 D777ր " @@2`  i p"f'@2   ? ( @ @'x't#D@Ӕ'x $  +@ t* @ ``@   @"    `" D> >  `@%U#\p@@ `??'''p'h'''l'd@ < <*pd* t ''d l*` h* @ @ '@ <  7` a7 `@ !7!2  7'777@ @D n  77ʘ @ 7`D777ր   '@2`   p"'@@2    @ Da@-'|  *      >  >  #\D   +` ( ,`     5-   6`.   @- -5`  .` -`    ?@ <  3@  a3` `@ !2 !3` 3`3`3`3`  #`D@@ n  77ʖ@ 7 D77l7ր " @@2`  . p"+'@2   &@aD@|  *   ` >  >  #\D@$< @2   BdU?   +` ( ,`     5-    6`.  @  -5`- .`-`     ?dx @ ( 7'D @"Jdx `$ 2@> D@# @ 0$'@> " > @! @> !L"'@ ;< <  7@  a4 @ "!2 4 4 4 4 4 ` !4 !d ` 2 4 4  @  ?# @2 *`@?#0   !d2   2 @2 *`@2?!d2    ??# @2 *`@?#0   !d2  2 @ 2 *`@2? n  77 @@7 777@ @> @#O  > @! 8> b   *'& & ,` d2   2   > @#*   ^  ,4 2   >   @# m  ``m L2   `7   } T& , N2`  }I 2`    & ,2  e h   o"2`0  2߰ h2`  2ٰ h2`  2`   -% 2˰ h /(`2ư h-*  (  2 2 > P@" @ & , e @T@ > ~x Ԣ ^       @Ų`?# 2  : @ 9 @   -`,`,@4` ,` @d2  "` `?  **` 2 2 $ d2   `, ` , ,  ` , d2  ` 4 @2 *`@4 d2  ` 4 @2 *`@4 d2  `4  @2 *`@4 d2  `4  @2 *`@4  ` `$   * ? # '? ?   d2  "@ @ *  *@ 2 @ 2 @ d2   @@ *  *@ 2 @ 2 @#$?ؚ`H`l 4 *2   * * `@ ,@ > `@A@ 9' @ ,` ^   ,@   ,@,@ ^ "    2  J`   dL̑-*  h"    4`   d,` ^ "L    4`  `  4` ,` `>  @ 7#* `4`   4`\    ؀ "   *@`22 ?*"@0\" 4 > $`H`@`g" `.\@*ؑ* &"@@!  & , f& , > J@ $  2   #` @@ #\H`l g4 4 > @!㿈 >,!* €> @ ْ ?!^ 7耊`7!L `7 7!^   7 7 ! 2* ! *  `@.!@  @2ΰ?>  @  ư ?# :..`@  777@ ϔ @2?> H @ ! *2! *  `@.!   !\  !ؚ*@ * +  2 > p@ W {? !^2 ` `7!L `.`7777.`  7.* @ 777; @ R !^ L UD!^ > r8!^ "3?/!^ "*?i&!^   b7 @ 5@? !^  ~ @   ?p> "'  . Z?.!!`B 2.>!! !2@    < !H`€4  `!΀ "! @ N "! &! @p! ! .!!^.> 2@  !^2`@p d"!^ . 2` @@2"!H!2   2!H!2   $.`> 25 @j !H!r €!p* 2  !H `@!H`  +"!^ /!H`€!r!* 2`  7> !@; !^!7!^  02/!H!_ 8+!H !H`€!p!H`€!p* 2 -`2 @ #$!H@!H `@> @ "`€!p-`2@ 6!2H!H 2E!H!^ /(!Hː d!H`€!p!H` ` €-`2@' !^ /!H`€ !H`€ .!.``B >!,`> #\@23  @4 !H6! `@!H`  ! |"4  6! L?# * !d!  ?2` 7`  ``"@!d2  " ? *` * 2 2 !d2  &` @2 *`@!d2  6`  @2 *`@!d2  6`   @2 *`@!d2  6`  @2 *`@!d2  6` @2 *`@!d2  6` @2 *`@!d2  6` ?  **` 2 2 &` ` ` *   *  `Fp@-r  , r !d?2  ct* @2 *`@3@ r rt*2@r  rt, @ @&r, r! *6!@Ζ !@!d2  " ? *` * 2 2 !d2  &` @2 *`@!d2  6`  @2 *`@!d2  6`   @2 *`@!d2  6`  @2 *`@!d2  6` @2 *`@!d2  6` @2 *`@!d2  6` ?  **` 2 2 &` ` ` *   * @5>  #\@! !d %> #h> @  /'> %>  ` @ @6  @2` @ @/@ 4g @ ` , >  x@a!H > @ ` > @ْ ` > @В `> А@ǒ !\`  2`@ 4* @`> @ `@)!H  (! *  ?`"*` @ 4 @@  > `(@  !H > `P@ !H`!r02 ` *2 @!ؑ* "@`  $`,` !2` `$``!*  .! $`,!^ " ` `"`  6` ` @"@` ,`X@> @`, 2 !^ `X 2!^ $`,!^ >`$`(` "` `X 2`"``, 2` $`,` `4 ` "J> `   d!L̑* *  @ " ` ! d  !  .!-> `@2 $`(` , "$`(`$`(` @> `X 2`$`""`$`, 2` $`,` `4 ݩ`  6` > `$x`@Ȓ @"`$`  (,`X $`,`, 2 `$> @  $`,`$ $`(@ `, 2`$ $`,`$ " !d!H `!d 2` 0`, 2` `X (` @" `X `6   W 0  . ?` ( 8 >  2 `$#\`( #` `X #d#h`,#l@f! "-!?6!-" @ 2ɒ @@ -`2  !H`!r!H`€!n!6!@&6! 6!6!", `!B@g>! , " > @ 㿀!^   2 '!H ` €* 2 '.`4 >  @@?ߐ#@`?>,"<*` €! 2*  ! *  `@.! @: @4 @  @. ?> )> &(!H`€!n> H@ƒ 0v> x@ 0o> @ > => > @ !H `€@h!> d0.`D> @@.`> @ !L *#!L* "!L 1"(@{ !L  "!L* #!L* "> H@f !L *@"!L "!L* "> h2@P ! 2* ! *  `@.!'!#'!N '!'!'!'I >  @,!`B  >!!H `€!L2` !L "!L pa"! .! @^ !L@2    !\  !ؑ*@ "!\" ,!\&!؀> @ ! !L.! "!L pa"1 ! !L.! "!L p"  ! !L.! "!L py" ! ``!L.! k" @ !L pb^" @ |!L@  ?  "@M!  !L.!  ?"!L @#> Ȑ@v Y!H `€,.`2 `,>,"(*` €> > @X # >  > H@N  @ @" @ Z?> `@=  > @6   @! `!L`.! ?"!L@ 0!"@> 4 @ 䀊!-   :  !H`€.`4 ``` `$!%> @a @ !&6!!`B >!㿘`>,#<*` €> @ْ  !`B >! @" "!d  2  "> @  > `  b+'>,#* €` b2  > ``2 ` @ , b *` 2` 2  > #\@  > ``2 `p @>  @2t` a>  @2k` ">  @2b` $> Ȑ @2Y` (> ؐ @2P` @>  @2F` @>  @2<` @>  @22>  @2,``> ( @2#` > 8 @2` > H @2` > X @2` > h @1` > x @1` @>  @1` >  @1>  @ > ``2 `#\ږ  >   2   @Җ  !2  d  !*  .!,`b  >   2   @  !2  d  !*  .!,` >  ( 2   @ !^ ` @", `*!L * @`(  !"`(, bӐ `>  &(``2 `Hk  > ``2 `pa  > ``2 `W  > ``2 `M  > ``2 `C  > ``2 `(9  > ``2 `P/  > ``2 `%  > ``2 `  > ``2 `  > ``2 `  > ``2 ` @ R, > ``2 `H  > ``2 `h !^ ``2 " $@(,   #\>  >  #`> $˔,&( > ``2 `p miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#96:\ :ts=3500:\ :pa#12288:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#12288:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#4:nc#544:\ :pa#4352:oa#0:ta=4.2BSD:ba#8192:fa#1024:\ :pc#4352:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx  > ``3` ` > ``2 ` > @ , > ``2 `X #\@  (.X&, > ``2 `H  > ``2 `{  >  ( 3`   `@s !^ "(, `$!L `?ȑ*` *  *@ 2  `* *  @ "  ! d  !  .!, "&,b >  P 3`   `@9 !^ ", `$!L `?đ*` *  *@ 2  `* *  @ "  ! d  !  .!c, > ``3` `x `@ V,` (  >  @  !L>  Ȑ@ !L@2    b700@Ӕ ! !L.! pb" @' ,`+b'  >  @ǒ , b  >  @ , b  > `  @ , b &,b > @s"@㿘.`6``=!\@ !ؑ.` ?` **> X2@ 0'2  + 2 !ؑ* "@`$&`(  .`X!H 2! "!!?6!!B@>!㿈!̀   = !@"!H6!5? `@!H`  !̀ !  0 0! 76!7 !2!Ж`6!7!&!!Δ 7?6!ΐ@ 㿘!^ >  > "@!^,  2  ? ,  `  `? `  ! --!H`2`45`` 2!H6!.!! .!!H `@١#h> !^" `'`>   > " ^@  > 6@&!^-   ``2  ?  `  ? ! > 6@@ "   +-!H`@@4@4  `6!.!! !H.!`@!΀   <! ,`! 2 "@*`" * *  @̒Οʀ  ΐe!2   !!!2  2!H!2  )> !̔0@# 0"&! ! '> %> s X@ i ! `"Ā`# !> .!!̔h&! @ !2  ! .!"   *" @ 2@  `} |"!^ > #> ΐ"8-  `2 @> Ж@-ƒ @`@1 4`@ "R ``DE> @G`@=> @". ``@`@/> @` @!'> )> ' $> "!> !> !(> !@> !X  >  !p> !@-k  > @l " > @7!ȁ㿈!^  i!L7 @ *  @$㿘!    < @,`x! !* `!^*@  .! .`*  !L* ??c#    2` 2` @ > $ ؐ @ m`  2` (7 $ 9'䀊 _ 87 ?!a @4  @7@7@2 7 2 * @7 ? * (@4 > 2 #\#` @Θ   $ '.`,` 7 䀢  !2 !@ *  `@.!`2,  *@ * .`$ @4 ' @``  *  2` 2`  `!!  `@.!0` p!^ a.`* * "!L*  H $!    k$, 4 4 , , , ! ! < ! 4< !h !4?* 4!h @  @  !h @&!h`!h#&!h!h" > !  !$8@7 !L! !L :!h!> !  !$X@% ! !L: !L : .`*  !L* @@` @* @ *@*  $@!^ <*$* $@!   4`,`,` 4`,` ,`   *` `  "` ` !h @21@@ !h @2(@ %7 @@  $@`* @2  *@ * $@ 2  * * @$@@!> 3` #\ ` 3`#` ` > #d ` @#h@ `2 #l  @ @> 3` #\@3`2` `#``3`#d`#h   @ `???ì#c !)>  4  $ , 4 4 !^  )  $ ``2!d 2    ` 2!d` !d? : @2       * 0 *   , $ , #\ 2  #` #d  Ȗ@. 㿘ː!2   > x@ !\!d2 "!\Ґ!2   !  0.!!2   > @ !\6!5 ,`2   (! *  ? 2`"  $!\@!ؑ* "@ $ " $ (!H 2 $$ ( $ ,@ `*`!\2  Ϣ 㾐!^> " '!       @  `!S@2!d P=`!d2  2p?> @ > @ a?  @b `    @ ` > @i @?> @_ 6?!^  @$!^ 2) @ # `  @Ē    ` @@   @ @H  > @ #㿘!H    !H`   !^ `  `@`!d2  2 ` f 8`?`f a `&&6* 2 <   !H  Կ !H`  Է !H  ԯ <<6 *`6!H  ԟ !H`€   6Ԓ !H`  Ԋ <!H`   ?# @ `*`2 @6㿀` !L2 ` @ ` * * $@!h(2 ``2 * * @$@`?,` `c,` `,` ` @ * @ @$@!^  2`  4 ` @ $   @  $@` @2  * * @$@` 2  *@ * $@` 2  * * @$@` 2 *@ * $@` ,`` * ` *` 4``!> `*@ 4``> * @3`$@ `#\ ` 3`#` ` @#d ` `#h@ 2 #l!@ @!3` #\@3`2` `#``3`#d`#h>   ` @ %> ` 2  * * @$ `, ` `*` 0 $ `, !^  `  ,  2`   p,2   ($ 4 ` !4  $4 ` h4 `   4 `   4 ` @  4 `2     4  4 #\ 2  #` #d Ȗ@  <2*  *  @$ , 4 ``` 㿀.`*  !L* 2` `**` $!h( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> #` 3`#d #h> 2 #l@ ` @ !> 3` #\3`2` `#`3`#d!#h  `@ Ғ  +>   `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d `Ȗ@ F <2*  *  @$ , 4  `i 㿀.`*  !L* 2` `**` $!h( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> #` 3`#d #h> 2 #l@ ` @ !> 3` #\3`2` `#`3`#d!#h  `@   +>   `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d `Ȗ@  <2*  *  @$ , 4  `i 㿈` `/``+``(` `  `-   5`@ 5- @@@-`4,- @ ,` @ @  @L >  '(@ 7   @ > ^  /E<?` `/`` +``"(`! `#  `$-   5` 5- @@ @ -`4,-@,`% @ @   @  >  'H@ ^7    @ #?@ >@  $@2 > @2  $@" >@"/`  $@)    2`2  <?#?  >   2`   2`2` @  > ` > ` *` `+ `@ ` #\'@ h` ` * @6h$2`` ` * @6`.`.h(2h`.h@2``.`6!d0@ 2?0(2 ` * `*  +     +     +    +  !d0` 2?0(2!d0` 2?0(2 ` * `!*!!d0`" 2"?0(2"!d0`$ 2$?0(2$!d0`& 2&?0(2&!d0`( 2(?0(2(!d0`* 2*?0(2*!d0`, 2,?0(2,!d0`. 2.?0(2.!d0`0 20?0(20!d0`2 22?0(22 `4*4 `5*5!d0`6 26?0(26!d0`8 28?0(28!d0`: 2:?0(2:!d0`< 2<?0(2<!d0`> 2>?0(2>!d0`@ 2@?0(2@!d0`B 2B?0(2B!d0`D 2D?0(2D!d0`F 2F?0(2F!d0`H 2H?0(2H!d0`J 2J?0(2J!d0`L 2L?0(2L!d0`N 2N?0(2N!d0`P 2P?0(2P!d0`R 2R?0(2R!d0`T?0(2T@ 8`H㿐!H !n€6!!7!7*  7! &  `6` 6@ !d0 @* `* `* ` ** `* `* `*!d0 @* `* `* ` ** `* `* `* @* `* `* `* `* `* `* `*!d0` (?0((02!d0"` ` ?0((02 ` * ` * `* `*!d0  ?0(2!d0 2?0(2!d0 2?0(2!d0 2?0(2!d0 2?0(2!d0  2 ?0(2 !d0  2 ?0(2 !d0 2?0(2!d0 2?0(2!d0 2?0(2!d0"? @? @*`(2 2` "!d0"? @? @*`(2 2` "㿐!> ϐ  0>_.!bܖ &  0&!,&!( $`$`$` !\! 4 4` !^>_# ``& !)4`!L 4`  4`!^ *@6!  2!^ ᬐ """ `  2 2$ `22 ̒  *@6!"!^ "A!L'H /d * % !  &!&!H 0  t!^   2 !`' e!?` &!!&!H 0 B!g!> !H /d * % !  &!&!H 0 !^&%"`*' , 2$!L@2`  22`    2  2 !d2   2`  2!2`  4 !?` &!!&!H 0 4`!>Ӑ"@  !^   ``"@ 㿘 <?#@@& <@\㿘  !^  > !`I>`!  h# C#!2 (@*`@!L*` @ 5(! : .> !`<! ?#! a `;# `?Ȗ*`2 (* @ @ " 2  !  !*  `@+!* 3@㿐 >a ch@ a`   $,4 H /d * % a  $a$aH 0  a2   4KaaH`   a2   & a^  aH`   aaH   a?` $aa$aH 0  $, e a a^  0,a` aH`   aaH   a ; a?` $aa$aH 0  2a@a a( "$a(a,"$a,$a?` $aa$aH 0 > P@   !2` /a$a@a `a *` ? $aw$aa$aH 0 0m? f"0a g e"U Ta h"9 Na  h@ #> ɾ @ $aa 67aa> $aah@R -a> `  @$a@F a( "$a(a,"$a,$ >    @5h>cc4@֔> !İ @֐ $a?` $aa$aH 0 㿐А f  g e 0  h 0    "`5 "  `!H@  ` 2 ɾ#蠄?2!H`2!H` 2   "`,`,   &`,㿘 @  *&    @ h *@&  @>  ` @  * & @l7! `  $!> @ @͐@>  "' H o*@ e a  $a$aH 0   a\ 6 aؖ*@ * * 2  "iad  >  @Ua?`o$aa$aH 0 f"@ >   @<a?`V$aa$aH 0 M" & aH@ D   >  H@ @*@-& '->    $` > aH > p @ "  a\8 aؑ* "@ *  & ,& a@ْ  @* &   h@ #> % @v  &  " a?`$aa$aH 0 "@& @  @ , /  4  ` , ad2  "?# ? ** @2@ 2@ $ ad2   , , ,  , ad2    4 ?# @2 *`@4 ad2    4 ?# @2 *`@4 ad2   4 ?# @2 *`@4 ad2   4 ?# @2 *`@4   $   * ?# ?1?`   ad2  "  *  *` 2  2 #ad2     *  *` 2  2  $`?؆aH`al4a a/> @ a?` $aa$aH 0 " > @!؁㿘H /d * % !  &!&!H 0 !H`  !?` &!!&!H 0 㿘  H /d * % a  $a$aH 0 I f)>  g e"P ,Ua h"2 Oa >    @t  B h>ac@ @ #> Ƽ '@^ a ` ?a( $aa,"$a($a, &>  >  @  @E h>cc4@> !@  &   & ,la?` $aa$aH 0 㿘H /d * % !  &!&!H 0 !!( `'&! $ !?&!` &!(!&!H 0  C"@!( "` > P@ݒ 0!?` &!!&!H 0 㿘! !(  &!( "@!( "` > P@ 㿀`>]!x.` €!^ r!d/m?>@ .`*   !L.* @*` @( `&  "# 2  ` ` 4*`` " P` ` ` *`0  (  ! *`@ #  @  " >  ( >  " >  ""h> "x> "`.*  > `#\#`Ȗf> _ > @) 0%!> ` ? &!Q8!!0 ? @` &!>daX@! &!@ > :H!^ 2!d/-> .!L*  (aВ @ > #\2P` > #> ##`#d#h #l #p@Ԓ 0Ѐ> @͒ 0 '!L ">   > )"> %"">  > "> ">   (>  8>   H>   X h>  x D$ > @ !d2  @2     !  &* *  (  ( @2`@2 `@2`  @"    M  (* *  (``@2 2> @7 03<.@ @ *@ &@ >`>`&@"&`!H `€!^     !H ` €* * , > ȗ23 @  㿘'P'T`'X!d /@ >  @!@̒P> @!D     pÄ(ƈ̜̜@̜̜̜̜̜̜̜̜̜̜̜̜̜̜̜̜̜̜̜̜̜̜̜```X88ބ޼lܘ@d8    2     2 㿘 0>|c<@6"耢 2"  @ϖ &"" 2"  @ύ &""耢 > " 2#> @/!0D > > !@' 0<!* # > #@!# @   `.  . #*"@ *`"  *  , @ n*  . . &  @."# 6 N6 R>Ӓ H& d& \& h@s > aĐ*"@ @ړ*`㿘  @!> !!> ! @۔!  ."`  !! > !@˔! ."   !#` W> >f",*` €     `  #` &#  #` &#   #    &#. .     .     `   `   `   `  # @f! `   `   `   `  #  `  㿘 @> "(@: > a!> ! @1!b  ."`  㿐> !`> "ܐ"@@!> !䀢 2"> > "`bX#\ L  @   $!"܀ 2 Ȑ & & & Ȑ @ " ""??06 ."܀6" "`, @   "$?   $ ,  "`, @ސ    @ $@" ,@ѐ`,   2 ?ڬ@ې!&"&"ب  #   :   : `!`*# *** @`! ."!> ! @!  ."   #  a0 I§#0¤"0 ."@㿐` `,  ̦` > !` > `/"`I`J@g ."`` 2#`А"@ > ǐ @ #> ! @ # @8`# 2 !!> ! @="e  ."`            * # @  ,`"* #@ w* &`#  #  2`   `2 #"?#  #          ` "r`I# Y`/`@ &#&#`'## @ `  `  @2 #  ` #  `  # !!> ! @"~  ."`  !!> ! @"  ."`    @0`@@`/!!> ! A@w" A ."`  A0۠  # "    `  ` `@`I.`,`,*`J *`@  `..`.# p 2o  &#&#' ## @ `  `  @2 #  ` #  `  !!> ! @"  ."   `!"ݐ @6"."!a> ! @"  ."`   !!> ! @"  ."`   @0E @g ! > @͐"!!> ! C@Ŕ"А C ."`  C0)`!"ݐ @6"."!a> ! F@"Ԑ F ."`  F0!!> ! B@"֐ B ."`  B㿘H /d * % > "`@ &` H 0㿘> #쀢` `@? `H / * % > @ "`H 0` L@ >|`a|@:`  &`  㿘  ` !> ! `> @<"! >   " @2``*    @,`   4$  @g  2@ Ò$ > #<$ H /d * % ` $ ` "` $`` $ ,` " H 0n 2$ N  $  $ @ $  $ D  /  $ @ $ < $$ D, HH /d * % $`$ `"@%`  $ b܀`@OH 02  @ " @̐ @   @Ð 㿘> !`> @#"" !>  @ "`@ ֐` ""  a @n#@ #贆2  㿘> !`> @[#8"܀`" > @Ɛ#P``` `*  ̤   ` @  ` "`  @  !H /d* % ,       &> $  @j   H 0@@ $  <$  "` $$ , " > #$   "$  `      `  H 0w@=,`I  2 H 0h@ *`  *`2    *`22 > @#x,  , *# ,`JH 0      , @``&    @``"`& `@"` $` & 0 "@> `#@d`@`2`㿘``/  *  ̤> a  > @N#@   .`/  *`,`,``  4   #&`@&`<&`D&` &` $,     Ô   2, @ , $  Ȁ@2 0 &@ " & &  &`` `&` "܀ 㿘` *  ̀,      > a  >  ,@#@``H (2  , `> *`4 #2@ђ  , 2 `H, X` @  $ , $ ,`H > 2`D`D$ (Z0Q$ ( a `$  (`" ,> @  ,`2> > 4@ (@ 8@7 Ȁ@2  ,"܀ & Ȑ ."* , 2 ` 2  ` 2 4`, " ``"` ` "` ` `"@@}  ڒ`@`;%㿘`  `*  ` 2,``  ,`  2  > > >  H@2`I*"`I `J*`  "">  @ ?*`  ?&` @``"`& @`"㿘!> ! > @ !!> ! @$  ."   "Ԁ    㿘``> 0"&"""@@L  @€ #` * ,`  '>  @€ , &  % `   @€ , @ € "  '>  @€ , & "@&"  > ` > !> !"@  """ @ > !> "!@{ "`@ *"> @s! "㿘!> ! > !(@g!   > #> @@\a &@> @U!   `@ # 2   `   & 㿘c   bc   bޑ* * > !8@'`!> E ? `*   ̀`@*``       `` `    ,bݰ `.@  > !x@`!> ,b$` ````+`cy`@ A . "* c@ 9* & cc  ` 2`` "?c  `  `  `    !> ! > !Ȓ @%[!!> ! @%[` ,b`   bb @ ` @! > !Ȓ @x%]!!> ! @p%]` ,b`   bb @` ,b4b< $bD>$b! > !Ȓ @T%f!! > !@L%f` ,b`   bb`@ ! > !Ȓ @7%j!!> ! @/%j` ,b`   bb`@ 4b,bݰ 㿘> !`> "@!" 2"> "@  0!"܀ >  @"8"&" `."! > " @"p"݀ !!> ! @%  ."`  ""> @ܐ"0"` > !Ȓ @є%!!> ! @ɔ%  ."`  "" 6"`A3.""܀ " "  ` ` `  ( ` ` ` `    `  @`?`!!!> ! @%Ȑ  ."`  0"> "@q "܀ &"  > !@>  ` " *  @ ̀"N>f"T* €!"> @L""Ѐ 6  @^` "> "@@ &" ! "Ѐ $D" ( ."!"> "@+""• @"{ !"L!2"> ` "@ !b> @# !! > !@%  ."`     ,`    *  2    I   J*` ",J" ?*,J,I *U"> ` #8@͒ "ݒ `."  ,  #`     `   `  0"> ` #`@  , `$,!" > @#"!"> #@ "!"> @#  $"Ѐ`." !$ !"> @y#"$<"$D!"> @n#<&"D&"!"> " @a#" `  " `G!"> ` `@P#" ` O! `,"   `,,# "   `|"@]` > @2 "݀`2  , `,! > !Ȓ @"&a!!Z> ! T&ad @ {  @ u!-`@*`@*`" #@ j ,`"* #@ b* &`,`"* #@ X* ,@]` >  @ "݀`21  #@6 #,   ,  `,! > !Ȓ @ ϔ&~!!> ! &~@   ."`  "" @`."6" ,"ݐ ."  `+ #B @  ,`"* #@ * &`##    2  "? #           ">  @ f @" ` 2L,  @, +@ # @  ,`"* #@ * &`##    2 `` "? #              ,@\` > @  X!!""> @  @\` > @  ! > !Ȓ @ &!!> ! @ &  ."`  "" @a`" 2> "`2 >   S""  > !@ Ȓ !6"  @"!@@  ! > !Ȓ @ &!!> ! @ &  ."`  "" @` > !Ȓ @ &!!> ! @ &  ."`  "" @` ."6""䀢 !!> ! @ v&ѐ  ."`  !!> ! @ f&  ."`  "ݐ ."&"㿐> !`> "!x@ M""݀ @"؀ "="!!> ! @ >&  ."   6")&" "> ! > "!@ (&!!> ! @ &  ."`  "" @"."ݒ@ 6"! @ &" 2#" "    * 6"6"6"•&"@"""є ǀ""""s  "” """ Ȗ   " *"*`* "`* "*  "* "݀`&"  ,  , #N @  ,`"* #@ * &`#    2 #  #  `"?`#  `         ]"    `"* *"*`"*  "* I&""܀ > !ؒ @ Z'$ ` " 9*@ > !ؒ @ K'- Ȗ  I"* J"* (&" " ."*@ ` *  ̤  ` , , *@   "  *@ *@  "."*@"&"# 2" ""!!> ! @ 'n  ."`  0U#@8 " '" @ `  `  @2 #  ` #  `  !!> ! @ Ɣ'w  ."`  !! > !@ 'x  ."`    @x> !`> "@ ! @ 2 w  € . @€ # ` .  @€ .  @€  . `$`" @ 2! &" >  "h  @ b  , @€  ! > !@ P'  ."   f "܀ >  @ ?"\  Ȁ  > "0@  0@Y  @( @€  ! > !@ '  ."   3 "܀  2  "`,  @"-""݀  ."ݰ "> "ܒ "Ԑ"P@ " @€   ! > !@ '  ."    "ݒ ` ." € "A  @?2 >  @ Ð" @ 2  2* "܀ "& "؀ 2""Ԁ > " " #\ @   2    ?D#\> "@ " B>  @ #H"؀` > !Ȓ @ ~(A!> ! @ v(A  ."`  "" @` > !Ȓ @ b(C!> ! @ Z(C  ."`  "" @`."6" ` ""6" >  #h @ > ` @€  !> ! @ /(K  ."`  !> ! D@ (R  D."`  D"ܒ?`q>f#*` € ",`  *  ̢` 2  2 4 `8*`` " `"  "`  "@ @ `2"݀ "> @X` > @ΐ#` "ݑ*  ̒ `." ` ,`"݀ 2>  @# `> @#ѐ> @#@ѐN  T"`,W& "ܒ?`h>f"*` €>  @#t "Ԁ  > @ (> @ HX""Ԁ   € >  @v ` ?#>   € @j` ?  Ȁ "6"怢 6"6"." > @S @u $ " & &  $ `$ & "Ԑ `.">  @6 (SI   $"# "" >    "#\@ : ." > !@ ` "#"ݒ`."!> ! @)  ."`   "܀ " "# 2""ݐ .""ܐ >   @! ﻰ 0  2;> 2> @G!@`   *  ̀`$>f"*` €!> ! @)?  ."`   ! ` 2 " I 2"> U!X > P!p `  > !Ȓ @@)N!> ! @)N  ."`  "" @`@."6" ` D #,`,`"ݐ ." I` > !Ȓ!@o)V!> ! @g)V  ."`  "" @:a > !Ȓ @S)X!> ! @K)X  ."`  "" @` > !Ȓ!@6)[!> ! @.)[  ."`  "" @a."6" t&"# " # @€  f @€   >  !  #`#\@ a> ! @){  ."`   > !Ȓ @)|!> ! @ߔ)|  ."`  ""`@ 6"."!> ! @Ȕ)  ."`  !# !# >   !  ` #\#`@ !&"< &"D."u&" " @ a > !@)  ."    "݀ W  `.">  "x @y  "> "@o "" ?,H""@ @ > "@^ >  ! "Ѐ $D" ( ."ܐ"@J &"!> ! @A)̐  ."`  0> # @3  "܀ 2> 2"> @#   "0 @z @ >  0! >  0>  0 @> @#0&" @" > @#H /#  2"!> ! @)  ."`  "ݒ` ."! > !@є)  ."`  $ > "݀ 2 ">  #` @ "ؐ""ݒ@ ߀ ."Ȓ`?   # @  ]&"> /#@@ @€  !> ! @*  ."`  # W/@ &#&#`'## @ `  `  @2 #  ` #  `  !> ! @K*$  ."`  ! > !@;*'  ."`    @ @/!> ! @!*+  ."`   &" @> "@#!> ! @*1  ."   "#@8 " '"̖ @)&"> @ # 2"!> ! @ߔ*: ."   "#@8 "' "̐ @ &" ~$     `  @2 #  ` #  `  !> ! @*G  ."`  ! > `!  @*Q   ."   `   @S  @> @l "ݒ`."!> ! @a*W  ."   &"@U rR0  ."* @*#@  2В@@@ '"@  ? @ 2 @@ @$  $  㿘` 'А @&`&`  Ȁ@ ;"܀ !'!> ! > !Ȓ @*!!> ! @*  ."`  ""`@ 6"."А"@@ #@ P'>  > !}'@ E#`@˒0 tp  `` *``@S   €  @ >  X>  h "> #\ Ȑ p#`#d"Ԓ #h"ؔ#l"#p"#t" H#x #|@ DH /d4 * % @  > @ h 0!> @! $,h Ȁ  "Ԁ @S+> @s!`  `*  $ H 0㿘> #}H /d * %   0*` ̠ `(6 2  2 4 `8*` " `"  "`  "@ @6  `ґ*`H 0> !ē*"@ @*`㿘 @€  . @€ # ` .  @€ .  @€  . `$`" @ 2! &"> !`>  "h  @ 8|LLܝ㿘"`6" L "d( 4"" +> .`4 @ ̐`, 2 .* 2. 0 +> @@b8"@"> > @"H@"P ?%#4"` @( "d%2  ?# @2 *`@"`(`"d!.`2 2g"."g >  "X#@> "X ." ."2@T'0> 4a@8  "&@:@??@ # @2 *`@&@:@?@ 4 (O >>>?#bp"$$$4T$ $@c@-"`(`"d " >>@ 3 @,>>>"!c\,&"<&"T&"X&"\" > @""?`6*`>}!` €"@(@i"`(`"d 2"@???@A "D   " @ @ " "`@  "`@"`@8"`! (@"d!2 "` &""d ( 2 @  "` X"d2`@  㿘"@ L" ?@A?" @?@Ɛ@< 㿘"` " "d ( 4  ?# @2 *`@> Ϫ "(3> />  @  @ " @ab @^   &"h@ 6 +  ?4 @ +     ?# @2 *`@ 2`, > (* > @0">  , @p㿘"` " "d (#2  ?# @ `*`2 @"`( `"d  p5> 2 4`5  (3> />  " @b @    @   ` &"h,`(* `@> "耥 ,`> #> #(> @ϐ#>  @㿘 ?"` L"dc# %     * 2` 0  ʐ `@$@Ð"  "`(@ "d 2 4   !4 " 2 "`  ?#4 "`(`"d"2  " , ``$ "?   `* `$ "`# "d ( 2`@ l "` X"d2`@ a "`(@"d!2"      "&@:@??@ # @2 *`@&@:@?@ 4 " 7 ( 4   ? 2`*    ? 6 ?# @2 *`@44 4 "@"@{"` ( "d!2 6 *  x 4  6 *  p 4  ?h 4 @"(@   4   H4 @ T`@ {@U5T"`  L"d (!2"` "dR`T `T!?0(R`T `T!2㿘"(@I 㿘"` ( "d#4` "   @4`# 60  @4`"`%  X"d 2`@ h"d"` (  2@ [l#   @4`㿘"` ( "d$4`  ` ?# @ `*`2 @`   ?7?# 2 , @4` ' . 4`2#"@k("`@"d#2 "   `?# @ `*`2 @`  ??? # @2 *`@4`  @?# @ `*`2 @@  `?# @ `*`2 @`  `?# 2 *@ 4@ 6 ?# 2 *@4`"`(`"d!" 2@?b 0"`(@"d$2 `;>}!t.` € "   *`   4` &"  4`0   ?# @2 *`@4` #"  ?# @2 *`@4` #"  2D"`"` (@ "d#2   @?# @ `*`2 @@  `?# @ `*`2 @`.`  ?# 2 *@ 4@ 6 ?# 2 *@4`-"` (@ "d 2   `?# @ `*`2 @`?` *.`? # @2 *`@.`4`#"`(`"d!2  㿘""`  "d@>" "P&`"Lg&`"( &`" S O P> "`1 (@"d##2 `?# @ `*`2 @`"` (@ "d! p2> " * 2&`"`(@ "d$2 &`@  ` ?# @ `*`2 @` (""``  &`&`> "#0@w ("`(`"d!2 㿘 Tb` $@ @bd!4  ! 2 !$   2 > @Đ#` € @ @ & € ! " `e$@ t`& t!4  ! 2!$    & & $ !?&!@ICz@`  ?# @ `*`2 @@ 0  b`:@??@ # @2 *` b : ? 4 T$}6 T % ?@ꢒ  € #4!4  ! 2!$    & & $ !?&! V@ b:`@??@ # @2 *` @b:`@?@ 4 < @H/` /b`  @ 6?# 2 ,@4@ ?<#4 b l̴>    /> 2   $  ?  @ @,`H /f * ' T * 5 @Q   "% 8@  <"`< < 8"`8>  $@}#  ( $ 0 , @? 4 ?# @4 $ 0@fH 0 2 fb>    /> 2   4 `  ?,H /f * ' T * 5 @Q>   "% 8@  <"`< < 8"`8>  $@#  ( $ 0 , @ 4 ?# @4 $ 0@H 0 2 ,2H 0 p & p@  b    b    @ ?# @2 *`@`@ː!4@  "!4@s!4㿘"` ( "d$2`  `?# @2 *`@`"`(`"d!2 2   " @@ 㿘"`6"d   ,`  `@-& )"`` " `c& " %8%&"&"@""" Đ & @` H4  ;6   &""    `2"㿘?"` L"d# ) &+  @2 *`@4`  @/ T {r4T  @Ԑ "e!h 4`` @2 *`@`  2㿘"` L "d"   ?# @ `*`2  @"    @~@2 `l g@z 2`h`l 0$`l`< `$`h @ђ@`  a "   ?# @ `*`2 @    @@Y0B  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0 ?  $㿐""l* @ L"` "d-"@H /f * ' > "@  > 4 `` $ 2` $ 4 $$ $ $ H 0 2$ L ""@2" 4@ʒ "`  ?"@&"  $4 $ @Os$ $ $ `) ܑH /f * ' > #@a $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(  $ 'H/` /"`  `$>   B""l* @ 0"@H /f * ' > "@   4  `5$ $$ 4 H 0 H 0@Et 0"`  ?"@&" 쀢`+`*H /f * ' > #@ڒ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(@8"   4 # "$   *$ $  4  2$ *@$ %@&@`[  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0 Đ  $H 0㿘H /f * '  L@   H 00ra2@a1@Sa @a@"4T] 0!5@a@"Q 0 !6@ 0JT 4T ` -@0<" @6Ҁ%82 \ 2.$\0,@  2T@PT ?!4T `@`\0@@j 4 T @ @  H 0㿘H o*@ g3 H 0㿘> cx @  `$ 㿘""` "d@8Ӑ" " 2 "`(`"d!2 4 4   4   @4  ?c?#     * 2` )  $  ?#c %     * 2`   "  `@$#  P4 . 4 "` ("d 2`@x "` X"d 2`@l!h 4   x4   p4    4 @㿘#.@[ ? c  . 2 @ 2  @ . 6 㿘?"`#"d c)    * 2`    `( d2`2">   #   >  #@ 0 㿘"  "Ő 2' "`` "d?# @2 *`@2  ""` ` "d? c *2`   㿘H /f * ' > " آ"l,@ ( H /f * ' > "@A $@ 2   5 @"@@"@ " @2H 0@ "" ?"$ ɓ,"&" 4@Y H 0㿘H /f * ' "l 4   "@Bp$ &"@h&"H 0` d? 0* ` ?0(2` d? 0* `* ?0(2"`*` 2`"d? (0 "d 㿘ʒ  ƒ  ?㿘  * ͒ @    >㿘"` "d`($2"d2` ˔  ǔ Ô  x u T o  * 2 I  c  , { *  2 8 Q 0 "`(`"d!2 㿘"`! "d@($2h t  p l h  d `   "`(@"d!2"` ( "d#2  ?(0"P" ߒ` 6 ? @0*`2"`("d!2`㿘 ?#c #  `  * 2` 0 `  $PPPQQ Q QQQ Q Q Q Q Q QRRRSRRRSSSR|8(4 4th> b"'!&+Ȑ  0@O&<` 77€Р "" > @_#Ԕ r@@G> @Q  Xf ?& 0 4`T`$&%$`` "$``($`d$`a $a!"> c@Q "> `@K "> ` @E )+) d<6+6+6+6+`# & 77Ȧ 6+6+6+6+6+6+6+6+€ 2 6+?# @ `*`2 @6+ "$+  b"F^"ܚ+: @"_ &+`&+ "e@$+ &+"D!  `@#&+#'&+#c   @+!&++ &+# aj $+(&+"&+ "&+&+ !@$+ &+"$&"<!O 77€  !̀ "`,+ &+!`,#@c#X@( T"<aƐ 77€ " ?# @ `*`2 @`8  6+耣 +>>%> 3> '>  +耣  6+ 6++>>%> 3> '>X@ U   @ Y ! @ T + $ @ L + ( @ D +!" @ < +耊 #  @ 4 ! @ / + $ @ ' + ( @  +!" @  +耊 #  @  ! @  + $ @  + ( @  +!" @  +耊 #  @  ! @  + $ @ ݖ + ( @ Ֆ +!" @ ͖ +耊 (  @ Ŗ ! @  + $ @  + ( @  +!" @    @   @ @ݹaa$a@4a@r +`&+ᤒ @¡bXb b& €@R " > @m (++2d+6 ? @0*`2++4h+6 ? @0*`2㿘+  0`T #+ 2d2@ + `4`h+  ?<#2 #+ 2d2@+` + 0`@?# @2 *`@+ 0`@#+` 4 h+`67 ߐ#p2  @֐#+`4h+@  !2 @#+`4h+@  "2 7 +`#+` " D@?# @ `*`2  @#+`"D#+` 4 h+@  (2+ @  @#+`4h+` ?2 @#+`4h+@  $2 #+` 4 h+@   2#+` 2 d+`6 *   2a  @n ++*` ?(0 +*` P!" 0`€ +̀ "*` "H /f * ' > "@}  > 4````$ 2` $`4`$@$`$`$` H 0`"lH /f * ' > #@T $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` "$` ``@ D ?`c *`2 @ '2%>  2  " <  >    >  ,,  <  @Y 80c, D * 2`   @L h0V  (R" ` @ G$`\$`    @ D 2<l4 #?4c 2  H /f * ' > "@潒  > 4````$ 2` $`4`$@$`$`$` H 0`"lH /f * ' > #@攒 $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` ޔ(`  $"`$`@$`+΀ =?c * 2  >@  > 2`*  @ﮐ 0 D’"`< <@    <@; > @ l$`@u$` 08 *  @@=?@9?c * 2   > 2`*  @a!0k$`$` s o  k "``  @ D )l`@;c$l0u?c 2*     2`* >  ʔ $`"$`  `@ . (h $h , @)  % 2$+` @=+`+@ ݔ?  > !X@ @;l ($l ?@=!,@=?+΀ 2 <@ < "+@'+̀ "`@:0@嫒 0 T`2 T2 R t" t p" p㿘> !*#"@ @Н*` 0 Td%H /f * ' "<@  @ H 0> !@ 㿈" 0`€ * `2  @ ?a# 2 + b. d  + @ 0]`[ * 2` ?  XB?,"ܪcР   +$`5@  @ `*`2 @+` + 8p@ @2 *`@ 8p@7<@8 7@? $@ˢ`#p #t #x@ @ &`x㿘+Ƞ???## +` + @ `*`2@ @ 0 @ #??2+   > !@͒  <#+`  +`6?#2 .@2#+`+`6?#2 .@2#+` +`6?#2 / @2+` +?#@2 .`@a"c?#c2?# +@  +  `0`  2 +  `0` '  @  * 2` @ 4h 2@  U ??2+ 6   > !Ȓ @% <㿐#` + 5 "#1c?? @   @  6+> "@ 0`&+ ?c "< (777€㿘#`#++  *  ++#*@ 㿐#`?` @@"ܒ< `(  < `# 77" @` !@ 2ذ ` @ 8 2а +@  #+` 8p@?# @ `*`2  @#+` 8p@$  #`8p?# @ `*`2  @#`8p`@  6@6``#` 8 p*?2` + 2`?@+΀  "`@ $]6`#`X? @"`  @<*@F 0I@BD@D `?# @ `*`2 @`>!|*` €         ?#  *`2 @a?# @ `*`2 @ 4` !*  2 !4 4  4`4  h`?` * 2`  "  777c ?` ఐ .<`"fcీ"U``77` @ `*`2 @` I>!*` €          0* `( 77` !*  $2 +䀢    #    ? #+΀ "`?`?# @ `*`2 @7$ 7 < `# 77`-7 `*  *2`"ܠ ` Ȧ̐@Ԓ &   7Ȑ|$7ʒ/`€ 8```[ ` @X 8 Q #+` 8 p+`@?# @2 *`@2#+`8p+` `?# @2 *`@(2@`#` 8 p*?2`+  2 " @`!!@   㿘68>       @Ꝑ"^ #`+* +`6?#@2 .`@2#`+, +` a?#2 .@a"?2cФ#, 70+`+ @  * 2`  `0 @ `g 2+` < 㿘 8  #` 8 p7 ? + ?6 㿘n 6 2 #` 6 l7 + 3 #+` 6 l+`  "42#+`6l+`6 V"x31 6 "+M @  #+` 6l?c * 2` 4 #+` 6l@"4@ #`6l?c * 2` x #`6l"x@r 㿘"@  @ >  "8@xt a"?cТ#+` + 0`@  ( 0`@  `v 2+`6+K <`#+` " D@?# @ `*`2  @#+`"D&#+ `4`h+@  (2 o 6 4 :  $ + 6l2@2+ 0 d@毨 0<` 177  T@ "`€02 T"5 T!  ,*  @ @    `   @w dbܑ,  7㿘`?  0@ 0@"` @"W<4@ ^ 06@"`@"`. @"`  @o@"\`  @@ 0@"X`ఐ-@"` C%@*@"` @@R 0@" ౐@%@"` @〢@"` ` `@ ` " \ 0` @  `*`2+0@ `  *2+&  * 2` 6+Ғ * 2` 6+` * 2` 6+` 2`*  6+ڐ++@ s * 2` 6+` 2`*" 2`* "’ 2`*" @ `z * 2` r6+` * 2` i6+` * 2` `6+ * 2` X6+ * 2` P6+ * 2` H6+` * 2 c=& ` * 2 c2& ` * 2 c'& c  D0   * 2` `? # &#  & *`2@ > "`@i  0> "> c'H & *  0H 0B @~  0H 03!@ <3 a2@a1@ @c  !@ѐꀦ@ 0a @Ka@b 0a@ca@"O a@7 !耦@ 00a׀@aҀ@0!@ "!뀦@ 0a5@a@ϰ 0ڐa@ a怦@a瀦@ 00 !6@{0!逦@` 0T 4T ` "@@0Ҁ%8 \ 2$\0T ;PT PĀ!P΀ 2<  !777"ܐ  Ā!΀ <  77"7`€TT"@TT @"TT@dTT d$@E@ි 4XT @T \P @ÖI#$ B"= !8@ "D 4 ?a!7@0c"ܐ〢@@@W"܀@BR"#X; T +N7@ @ʒ DE#( D= 7?# @ `*`2 @07#7` @ * &7Đ#   @ `*`2@  77!#` " `d * 7"`€$c@? $  ?`-_+ ` !7"+4 `}"܀K`% G+  ``C@`=j"܀`〢-b"ܐ@7zc * 2` 4q #` "<@  @ 0^"`€V#`P + 2 ?@- C-@ @<@% 5%@C .C@('@+`  "`€ j T $ T @#` @ , =$@o ɔ$ @ T  " `!<!A"77"`€ ʰ ?# @ `*`2 @ Ȓ@  !c@/  ! Ȁ 5  ɐÐ@⩒ Ȓ@    ?@L &4 < `77 Ó*`7 "T`v@0pc@ k@g@bc@ܒ \@ђX@ܒS@Β N@ْJ@ /Fc@ @`;?# @ `2 *`@< 77 +T '"@0 !"77"`€ 2 ?# @ `*`2 @ 6@ޔ H 0 > @"X+ 0 H'H /f4T* 'T @ @ؐĐ +!?# @ `2*`@ "<777€7+Β 7ڐ 2`*  77+ژ<  2`*   777+Ԛ<  2`*  `777+ؒ<`  2`*  777+֔<  2`*  777+ޘ<  2`*   777+<  2`*  ` 77+h# < C @ `2 *`@777€+ @ +<`-  2`*  777€+ <+  2`*  777€#bh  ?@Β &<* 4 bæ7j7l  n%7h € "'#+΀`"  +ڀ `# @ ?@঒ &<`4 * 7B F7@7D €!+#b  &@ ?< 4 * 7b7 7"+?#  2 bܕ*< 777`€#b  ?@V &< 4 *7 b 77 € <`77"   €+΀`T!< !777`€"< 777`€ت+ e% !?# @"ܒ `2*`<@   777€7Ȑ < @ `*`4 `@77 ȟ€<`6  #6   € , 'c!4 +!777 €+?# @ܒ ` 2 *`@<  *777€#b +И `@ ` &: > "@ߒ &+ &: > "@ђ +@ &+@K r`@zH 0> !T*@ #"@ 5T@ß*`x> "!"'  "@@"`& &  & " " ?>?c #@& @6 " 2`2`* / //?c 2` ,   ~〤   ئ@y1.@ .`.` ?* .``> "@ 4  *   @ @y58@4 4 4 .`.`.` .@@y' " > @="p> "'b?  @ȴ```2 @* // /?c 2` ,   〤 `  ؒ@xƐ@x @?> "@ 4  *  @  @xΖ  @8@4  `4  `4  `"   > #\#@དྷ ?  > @Ȑ#HP Y  T$U!4 @ ! 27!$ I  & & % !?&! =@> D(7븀 & #Ԑ@ Q 2`  T!2`  @d> @m#`@,!4 € ը@ Ѩ` h h   5@!"݀@2 g ΀  ( 77Ȑ Z `U #`2# "`` `( 77Ȑ 9 5  `. ސ* &  *?b#777 ?7` 77# @7b,!? #   b4 @- b(ܐ:%   * 4 7ܤ  D @ ` @ <\ <#b(  @-–?# @ `2 *`@!7ܠ"  D @ `?@ D5 <?c 2`*  7΀`##` b(> #@ߌ <b(  @-!"  D @ ` @ . < @ù@+ T d6 R6 T"@!  @ > #@SP+ : `@ D+Z ?# @ `!"ܑ2 *`@(777 @ D`@ <@!  @ >   @#ذ 㿘@H+ #@* 0쯒 " +А` @  T4 R {4 T㿘>  @# "@ t & t㿘 @"+ɐ+ " > &+@""X㿘@@s "<!  77€?# @> `2 #*`@ < ! #쀢@"   " @2 `#&쀊 #Ȓ > &#Ȓ &)# '@, "<! 77€?#  @  `*3 *2 *`3` @ 777@ " 77`€? @ ` 2 +`@  2`+  ( * ("@* *`@ *`*  2*  #777`R& #v"2I@’ &<a$ 77€ 8O @3K .0K -,K (K K*`KА Б* +`K" " (* *?А  *** +  *@  *`K ?А &&#  >  ( @0' >  >  ## c#\#`@#dc@@@  d#h d@:#l>  P@ݙ㿘+?`#`  @>!*` €        ? ` ``" ` `"   +ڀ " `@ 4`@ * @++@< @6+6+  㿘+ +΀b+ +#`2` +6+ ?c "  O "+ F " +A  6+ 6+ 6+΀  6+ڐ 6+1 +  ``>"*` €      6+ "++΀ +؀+ڀ@"@+`@ $ d㻐 2+ؐ &`f&` 2:+<!D &`"77"`€ , ?# @ `*`2 @`"```  &` `  &`` &`  &`` &`` &` &` &`+΀   < <!C"77"`€ ?# @ `*`2 @` &`㻐+  ?  c n D?#  `   f-   * 2` 5   < #5` 5@"`€ 2Un 2O?# @ `2 *` @<  77 7"`€ 23L 2-?# @ `2 *`@ < 7 7"`€ 2- "   "  "@ 㿘+`3 &` > `&`@0 ?`c     ,  ` @ `*`2@  "z `  㿘`6+` 6+"@ +"`+ "`㿘`2 `+@ O  2++*@&+   &+`"6 !"N2` @ 20`2- "V`    ?"@ *`:`!"*`2` 1 >@ "   "V>  @(  㿘" >@ 0 @ "+.`#+`  @?# @2 *` @#+`  @` *`:`?" 6`+@ &`&` 㿘  .    2` >4*`2H"2B"2<"26"2?c 0(2„ 0(2  (2` I2b2?#(020b2"?(0*2b2?#(02bb2?#(02b (2 2  㿘`  ` >"*` €T""z6`?# @2 *`r@E"B"?"`?`#   2 3 ** b˜b 6 b6 N6 `?# @ `2 *`@*"6 "6 "6 "6 "6 "6"6"6"̠"6"6.6"Ȓ )6`?# @ `2 *`@̔ʐ 6 6  `?`#   2 *bД *3 bΔ 6 6   2"`*``8*`2`@ 4\hP㿘@ @    ?@"@&@@$@㿘**`` &㿈!> "' ` / ` * ` * ` *   Җ " > @c 㿘 #Ԁ`>  Ȓ@?@"+΀  4!&$ " p!"? x$" >c@㿘  %@> @ %(@ǒ  6`' " ` " ` ?#2 *`@F6 㿘  '@> @!'(@֘ 06!?# "    * 4 F6z 㿘 #Ԁ`> !(@ػ̀ D4̑H /f * ' @͐ "$'> @Ɛ  P@؜ @ @ @ `$$+ > ܢ"H a   2?H 0㿘#ԤH /f * '  }  @w?;c#c 0 Q P$  0   @6> @@!p   4 ` "`$ "  @4 $$ "@$ > a@ .",  @> @!    4 ` "`$ "  @4 $$ "@$@Y  @2 0  @@̒ H 0㿘 #Ԡ@H /f * ' ` "`$  "@ 6  &" $ $& "Ѐ  > aĠ"@  @H 0㿘 # 4?Ϣc @ < *`a  **2 ` "`$` "@ `"  "`   "@ @ "@| @y aА?$aЁ㿘```cԠ   @ q D @  L @ D,`!ԓ;` ,`  g `;`*  `2@ `g;`* ` ?* `@ 0 6 4& & "$ `&  "` "& & !В$!А* >ax@> "Ē@㿘` q`` @Փ *   " ` `  `` @  `?    #Ԙ'L  'P 7@Ͼ`> @Ȑ!0/?#  @ `*`2  @*2  ?'L'P`P` L@ϛ> "@֣x  P`  x   "  -> ̀ ` Ѐ'  > @u"0H /f * ' H 0> Ƕ`{ Ē@B-`2   "+b +䀢 e``c ` 4 " ` ` W`  'P @  `  @y  $@`" `  @4@"@x$   > x"P@|2  `@`' ` @ `   " `x   @`` @@4$@ > "p@2`` "  `   > "@Ԓ%(@Ӂ ,6!?# }ߔ  }۔  }ה  @F2`. 6* 4 'L2L,`'L2`L 'Lx   $&JX> ")#Ԯ''L'P * ?# @ ``*`2 @ ?'LP'PL ?'L'P Ř ! /  b  "@G`> @Q"Ȥ"2  "Ð@I ` ">  "@9b 3    5 b ` , :, </"      " : " : " :  < `, : , < : < `, :, <, < , :& : < @, ;`, :?  > @# B  4 6  :> #H# "      &>  # 2   > #@Զ   4 " > @Ԫ# > ǐ 4 ⸠ < @ >  @ԗ!"(@D "F6'L#?c|  |  |L2`. 2L- `'L2`L * 4`'L2L+'L &b > @o @㿘#Ԁ`M    @7> @A P0㿘#Ԁ`2 2 ` @> @& x0 ?* 0# 2`㿘 ?`,# @ `*`2> @ @  ` l 2k @> @ ` @2` ` P"=>  "+>  0   > I`$ @'> C`"4>  & )> 8`- 0> 2`> @Ґ A`@ΐ =`@ʐ 9`> @Ő!4`@!0`@ӽ! ,`> @Ӹ!0'`@Ӵ!@#`@Ӱ!P`> @ӫ!h`@ӧ!p`?# @> 2`!@ӝ ` ` `2 *`@>  !@Ӓ ` ` , `< BđH /` * ! `?# @2` ``P( `` "!`0`"0`` `"0Ȕ 0  0 { 0 H 0@l㿘A "    > " }Ѱ @"0 㿘 @ .1 H / * !  ` > "`}Ē@`;> ϐ" .H 0  H 0 㿘`?c * 2` Ԩ !@ 0`T T@Ґ`> !@۔0K` " @    `"  `? `T 3@˱ > @һ!0+H /` * ! ` "`T > `T  @ː> @Қ"s H 0@Y aĠ}#"@t`?# @ `*`2 @48H 0`  +` 8  沐 @/  / "6aa@a`@z$a` $`b"&` $`&` 2" $`a$``T d$a`@`? `> #cԀ @  ".@`*`>"  € @ x  H /f * '  2    Ӕ     UH 00ݠx  ֲH /f * ' ϒ 2  7 4 7 67 87 :x/H 00 @& x  H /f * '  " а H 00'  H 00| 4 > ⸠ |Ē@gH 00h @ cx<  ]̒ ` ?@W4̐'I  x( I 'H /f4* ' &   "Ȓ yQ  47  7 67 87 :/x@   @H 0   w> @ "8 㿘@  Xy >>>?&% bhx""&!&!&!$6 & & 0!D &!D  0& @(@"\ 8&"\"\ @!  @ @" #> @ @@@" > @ " >     &"`&"d &"` &"d &"`&"d"\@!"p@ɟ!> @Щ"`> "d @У"> >"Xd @Ӗ &"L> @""` *&"|"d *`&"*  * &"&"&"x㿘H o*@ g@ H 0h ! 77!!+`!*!+ !@ !  77ސ 0@A7"X&"h"|&"t@"`3`7&"pzk&"l?* "X@""d 3`7z`7?* "7"x "` 6"d  ", "X"|@"3`: /7Ԑ7/7֒П "` f"d  0", "X"@"3` /ː7/77Βȟ "d f㿘"  㿘"  { d" `""P@"P" l"x"X  ", 2"4  z d"  a" "€ !"?"€ !" !B 6  @ ;6 @ 0"$> #@ϡ "$`@㿘 > ? c'>  2Hb H /f * ' V* 4@$Ȓ  ""8@ <"`<<8"`8"($@Ǣ $0,@e4&0 6> "@ǍH 0N@H /f * ' V* 4@${  ""8@ <"`<<8"`8"($@U $0,@4&0 6> "@@H 02j ; <b" <㿐H /f * ' > "@ń  > 4 `` $ 2` $ 4 $$ $ $ H 0 2 | @߰ 0w 0 $ $ $  '􀦠m>   &ܑH /f * ' b@F   4   `5 $ $$ 4 H 0 ˤ 쀦1H /f * ' > #@ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ( ' $ 8 $ " $&@㿘%Q 2    &  l `&  @z 0@ 㿐"h; 2  > #0@  > #@@   &    > @#` ` & , "@*`  " :/77 "` " "|,  "  " @&"h㿐T"l`@ ;:6  @> #@ʒ  @> #@ 0@h80L "(`"@@  &  >  #@͡  `&   & ``  "   &   & "d " "t?&"t"t  , " " `"  0@m&"l"t "6 㿘"€  ?L "  "  @   & (  &  >  @@#'   >  @5# `&   $>  @(  `&   """ A 㿘> `( @ϔ  t`& t㿐 T $@ @hbp+> b,@b  `@ Td6 Tbt@bp!4  @ !  !$€  "=$bp  & & $ !?&! "1$bp < ",@,@b*`  %  6 R0 /77b b  Hbd " bt  $bt T$6 T$bp㿘H /f * '  0@–   H 00`a2@a1@5a @a@"TK 0!5@;0 !6@7 0@T 4T ` k@r02@  2TWT ?'4T 2 @V0 @@Ɗ 4T @   ", "0@㓖 H 0㿘#㿘 T!'<6`6`6`6@! @O  @J 2 *2 @  *@ 6@ 2   T = 6 T T<"6 T6@6`6`6`㿐"T's@㿐"T's㿐"T'@zx> #"L"P# #"'2 #@ &#> t x# ?`@ ." 4 @ ."& 4." H I.">>!``>>0&"&"&"&"! ""?# ! $!&"`-&"#   ", , #\#`@$ #\#` @  *` ,@ `` se  ,"`>Ő!&"@ >  @<  " * @"*`  &" > @@  h> # "P "L## ! ' v8#,v4 !,v0# `' !]b `Y ",  `/>  v d  c   , ,  H,, @, #\#`@:#\#`@ @  " I,, , #\#`@#\#`@@ b   ,b > @ 㿐` ""P @#> ((( ( (>(  (#` d`e` " @? ` +@@`2` 0S /`D/` "=@`0  /  3@   /   2  3@  / ׀> @ȱ "@> @Ȭ 耦`2`  / @3@` @``>  a@ @㿐.`2 @@ L P $@,`4 #\#`@.&. 6 #\#`@ @㿐# ? "L@ ##\"P#`@# ?# @ `*`2 @6 \ "*@ 2 *` 2 *` *`; *` ` *@ 2  3@`0 ?  +@`` "\*@ @*`*` 2*` *`;`*`   *@  d2 2 0  *  `@?㿘@㿘#    "P *`t"P *`t?<"P"P* 㿘>> `>"  8!$&"@&"D>>&"(&"Ht㠒 @jԐ???@ "0   " @b @ "0@~ 㿘" ?@ ?㿘@ "  㿘@ " "8&`"<&`㿘@ ِ" 㿘@ " "P "P `@(㿘# > !T> !8t㿘# > !T> !8t#"<0"P(㿘>>"b>"  8"&"@&"D>>&"(&"Ht㠐@ ???@| "0   " @ @ "0@ 㿘" ?@ ?㿘@ g"  㿘@ " "8&`"<&`㿘@ Y" 㿘@ " ##(㿘> apt$㿘> apt㿘`M   : ,@Β 4: ;?> 3`+  +`@ b * 2`*` B *2 *  `C + 3` ; 2`*  *`rڒ :@ `B :  2@  B * 2`@ , ?㿘>   @ 6 > !D>a  !D `@ 0 2` @Uu   @Uo  8 @@ <@ T@ l 㿘 H /e`* &` `" 0 - @"(  ` (Ȁ @&(ȑH 0㿘> ϐ  ` A * @`;H /e4`8* &`8  @u$`8H 0 p>>#t`X$ $ Ѐ $ l$ p@#  c$ $ $ `  $ ` @  $ `   $ > #,%$ $ $ H /e * &  ,` @D@`l@I  ``cd`$`$`$`$` @ ` . .... `. `. ` # ` $ ? ` `` .` d.rD d.r?  d ` ".0   ``,` ,` ` .,`. `  ,` 2  p`2 p @" p p $ p ?$ p`h H /e * & ` ` p   H 0M <,`. ` 7H 0> > א"$ p !@c " ` p $ p `` @cH 00 ` 2 p  @ p > בH 0 h> א ؓ*` €㿘> # . @>  8 h*  H /e4 p* & p"   > ǐ . ,`Đ <@E*` p@ p l @q$ p. H 0@ 㿘   8.  , , `   d 2 d. ,  d, qK qH d ,      0  ,  , , , 0,   * (㿘> # . @> 8 h*` 㿘> # . @> 8 h *` > ϐ * 8 @ 㿘> # . >  8` h`* @ @ 6@<  ]@ "h `y@"/ `x@- 0`z@`{@ 0 k@ -  j@0\@V 0sl@m@ 0k  @ , ,`c   ,  @, ,`R  *@, ,`J *   `` 2`@ 2` 2a D 2` ` 2`/&` ` `2 `2 `2  &@   2  @ 2 2 2 2 ,  㿘l> c * `(  & `$`"``(@ `  # `@!   "# ```` `2` , , ,  `$@@ %, p +>  `$ H!a@v  ??$ p 2 `,,= ,,  , , , "` 2 `$`,`$d ! ,0$  ,`,`@@   2    , , @-0), `$$`($`$   @  > h`ؑ* `@€  *@, ,@ P l> > " c'*  H /e * & pH 2M  4I  @@"V "@ V  H 4 p & p@9 H H "1 @׸  p & p 2  , ,`  H @H  @ ,@ & @ 0 H @ H,@H 0␀  , ,`H 0 > @!H4 p( p" pH 㿐H /e4 * & &  & & H 0  > "> "`2> > ""#\> a@X 㿘 r l  @m l 8H /e4 * &    H 0 U l "$&  $#& & & p 2 H 0 < l@@    . *`H 0 '> > ת#0`   "    `& ` & > !ē*"@  T@*`   h @ * €@*  l@ 㿘 8  { `/ `2  *,   `& `& > !ē*"@  T@*`0 ,   @@ . , `&  * .    h> ג`ؑ* `@€    *@. ,   @@ > h ؐ *` €` p  ?$p `$> @H> h ؐ *` €   H ` @ `H 㿘H /e * & `  'm ` ?.@`  'm ` ?H 0㿘H/ / .`.@: .` .`.`.` .``H 00l㿘 . ,   , , ,  , m= d 2  "     .  . . . .  `,  `   ,  `2  .   `,  !,  2  ".  , ,  2  ,   Z,   `, `2  Z .  `B*`>  €> @ǐ"< > @" 7 > @"82 > @"P-  2  &  > "p> @"  2  &  > "@ `. > @"  @`. & > @"     . &  ,   T, . >a, @a>` <@\> lbx@W(  &(ȁ㿘 L ,` ,` ,@,`,` ,` `  ',` ,@ ``  'Р'lg  `  ? lY d `  'Р'lQ  `  ? "  @@`  > # @& 㿘> !> (a> @ #80N#> >    @`  ` `(@ 2 > "$c8%#40"c0c`@   )>   > (  " 0> (!!%#4 @w$ #>  $c,> @ː#h0@{#4c,"! ""> "@"> "#8##0? 0   ` > 0   㿘#`c4 `  > @  #0> #,c4@ " #0c48"  " @8 @ ` > > 4 8  ` ј ` c4 aaabbbb(aamTmlmnottt(tt(}h}`" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @GV  &` &`&` &@`6$ $$@  㿘  @G4 &   "  20   " "  ``X"\2 XP<T"T\"< \T 2"\`P"T`P XX "`XXP2 T P""`P"X  "\"\PT"PT XX XXP2"T"P"> T" P\2P \"\"\3 2"\`T"P`T XX "`XXP2 T P""`T"X  "\"\TP"TP XX XXP2"T"P" P"X`X"\"X \ݘ  2l\`T\2P \"`\`TP"`TP X`X X`XP@2"T"P" P"`X`TP\ TTn\"k \\2`\2"\ \PT PT XX "XXP2"T"P""T X`T`\ \"`\T2 \`TP"`TP X`X X`XP@2"T"P"m P \"`\`PT"`PT X`X X`XP@2"T"P" T"`X`PP\T" \\ \ AX"T\2`\T2"\ \TP TP XX "XXP2"T"P""P X`P`\ \"`\P2 \`PT"`PT X`X X`XP@2"T"P" T"`X "\2`P2"\㿘`P2`T@`T =P "T P 2TX\"X "& P 2# T# PX" `P"P`T"T`X"X`\"\`X`"&`P2"`T"`P`P" X`T 2" X   X 2 X``X`\"X "& P2# T# P` 㿘@   @ET  P T&`\&`X&`T &`P`6$ T$ P$@  㿘  @E2  P T  T"  X P P P2 P0 P  X" XT" X `PT`h"l2 h`<d"dl"< ld 2"l``"d`` hh "`hh`2 d `""``"h  "l"l`d"`d hh hh`2"d"`"> d" `l2` l"l"l3 2"l`d"``d hh "`hh`2 d `""`d"h  "l"ld`"d` hh hh`2"d"`" `"h`h"l"h lݘ  2ll`dl2` l"`l`d`"`d` h`h h`h`@2"d"`" `"`h`d`l ddnl"k ll2`l2"l l`d `d hh "hh`2"d"`""d h`d`l l"`ld2 l`d`"`d` h`h h`h`@2"d"`"m ` l"`l``d"``d h`h h`h`@2"d"`" d"`h```ld" ll l Ah"dl2`ld2"l ld` d` hh "hh`2"d"`""` h```l l"`l`2 l``d"``d h`h h`h`@2"d"`" d"`h "l2``2"l㿘``2`d@`d =` "d ` 2dhl"h "& ` 2# d# `h" ``"``d"d`h"h`l"l`h`"&``2"`d"````" h`d 2" h   h 2 h``h`l"h "& `2# d# `` 㿘@   @Cw  ` d&`l&`h&`d &```6$ d$ `$@  㿘  @CU  ` d  d"  h ` ` `2 `0 `  h" hd" h ``d`x"|2 xp<t"t|"< |t 2"|`p"t`p xx "`xxp2 t p""`p"x  "|"|pt"pt xx xxp2"t"p"> t" p|2p |"|"|3 2"|`t"p`t xx "`xxp2 t p""`t"x  "|"|tp"tp xx xxp2"t"p" p"x`x"|"x |ݘ  2l|`t|2p |"`|`tp"`tp x`x x`xp@2"t"p" p"`x`tp| ttn|"k ||2`|2"| |pt pt xx "xxp2"t"p""t x`t`| |"`|t2 |`tp"`tp x`x x`xp@2"t"p"m p |"`|`pt"`pt x`x x`xp@2"t"p" t"`x`pp|t" || | Ax"t|2`|t2"| |tp tp xx "xxp2"t"p""p x`p`| |"`|p2 |`pt"`pt x`x x`xp@2"t"p" t"`x "|2`p2"|㿘`p2`t@`t =p "t p 2tx|"x "& p 2# t# px" `p"p`t"t`x"x`|"|`x`"&`p2"`t"`p`p" x`t 2" x   x 2 x``x`|"x "& p2# t# p` 㿘@   @A  p t&`|&`x&`t &`p`6$ t$ p$@  㿘  @Ax  p t  t"  x p p p2 p0 p  x" xt" x `pt`" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @?~  &` &`&` &@`6$ $$@  㿘  @?\ &   "  20   " "  ``"2 <""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@   @=A   &`&`&` &``6$ $ $@  㿘  @=     "     2 0   " "  ` "@0 @ ""`" `" ` " 㿘> b`> B:`% L㿘> `B :> 0  > c  ƒ > c  " 0@#㿘> ``B :` `> 0-> !`+`^ # &```> !``   &```@#*` ( > 㜅(" "" " 㿘> #  $@ @* & \̐@ $&  & #&  @ x> " '  \ "\*`Ԑ ``" "` \ >  `B :"` ѐ ` >  `B : 2  a> "  !xB` : > @֐#  H@  ؐ@  `H/ `H     /`` '/`''''>  Ē@l` "qd`> B:` L;?O H H `@E J  ` @2 J@2 J@2 J @" J &` @@<@8@4@ q` Ā *N**`ʐ 2!x`> #@A!x`> @:  * N ** > @A > "' 2/C bX @2'am "''> b`> B:`Ȑ#hp& 2ibb`> b >  T@ &> `B : _?@ b `b* xbX`@2am " 0" 0  > T#h > #` > @ ( @  > @ > @ T*?> #"`pb\* y`0`> b "b> " !pB`"!p: Ѐ`  X > ?`B : b > @ H㿘&` C (> #`R> @t `> @q `` @`H> @j `0` @`H> @c `D`4@`H`O > @Y > @V ? U +> #`"> @G > @D `` @`H> @= `0` @`H> @6 `D`4@`H`O > @, > @)  `?@`@!> `  > "!`>@!|B:!`&`>  LS "!x`> @` @``O`> @ > @  d.?> `D&```&``""`" !l`B ; #!l@}& `"X`2`O`I 2`O`O  .`O 2`O @Ĕ `O .`O 㿘> > "a@ +>)> '> Đa !@L H /* ` ! l`@@ 䀤@ @ > > !a(h@#(  > > > !a(@ٔ#* a a> !@! `> aa!@> !c!耤 @ $ Y @4$!> #0! 㿘> #h'? ;> ")>  X`0 t#@+2  0> @j<#|  0`"b?"b 0a 2 b 2@OI Fch> pB$p<ؐ T@K` > @j+#|䀠"  I2 X "X\ \X X`> > 0>  " t䀠""X X`> > 0>  " t""p 2    H  D  #` #d!#\ Ĕ 4#x#t#h#l#p#|#@z  N    >  L> c     O  @  . N㿘> ""@^"Z N "  > > > !a(@Ҕ#a?  "a b 2 @N  ̀`" a?  "a b 2 @N  Ȁ` a? "a @Nx @G @{  `"  "`> " H  "@! "> @Or> !@m> l`B "l:㿘??3 > cx ' #x `N  `> @i#| #x?u > c 8 ?@#x> @i#| s#x?? $#x`#x>  D`$#x> @i#|㿘`$ 2 @s7&` `?㿘 $   @sv&  $  2" Ȁ2" ?" 㿘.`0]> ` 2` @!ȓ.`2``Q> @!0M     * ` 2 ` " "@ $      *  %> )>    2 @d  .@^!耦8 @Y  倢6``> @N!㿘 I ">   "> >  :"> > @8! > @3" @/"  @+"  I@&"   Hq!> @"  0  Hj#> @"  D 4 Hc b(  @   ` >  "> > "P@ `> @"` (  @  `  `> "P@ `@"`>  "h@ 㿘  > @ܐ"  > @֐"p  > @А"x  > @ʐ"  > @Đ"  > @"  @> @" @ > @" > @"xؒ"? 6" !!@"` "`@ ؀" "]" `a0'"] "]@ ܀" "d" da0'"d "d@ " "e" ha0'"e "e@ 䀢"  ," la0' , ,@@g  耢"  (" pa0' ( (@ - -@ 쀢"  \" ta0' \ \@ 0@> 0  "  X" xa0' X X@ ] ]   " |a0'!0 2k! *`   `  `"  a0"  `*`㿘 $`$@2I `"F `` > 0<0`"3 6 $ ` @25  `@20  `@2+ @@2&  `@2!  `@2  `@2  `@   ` HH`  @ > @"  * ( (*`00*0?# 3   +  + 2 㿀c> b '@_ 6@ 0R  `*   2 66@ * / `*  2 *  2 *  2 *  2 *  2 *  2  * 2 * ,/`2 2`2w6 > @""Ё㿐 ?'L*  * @' * * * LL `2 `2.  `. . .L@?L @ * 2 B6@㿀!> "'  -@* '2 * !2 * 2 * 2 *  2 *   2 * 2 6@" > @"p\> ` d o' k``@@*`` 6@/ @24 Җ 7@@4 @̖ ` 4@* @2 Ö 4@  `#U *   2 4 @ *  2 4@* 2 1  @*  2 *  2 *  ~2 *  x2 *  r2 *  l2 *  2 e4@'``0@Ж U* 2 O 35Р G@ґ* A2 ԑ* ;2 ֑* 52 ؑ* /2 ڑ*  )2 ܑ*  #2 * 2 4@ > @Ȑ"X > 2 , b?Ȭ '  Z`#\  @'s 2 @[ I `  0C`E?4 $;7 `@/` /`/`/`/`/`/`/ [#@ Đ " T .@.`.`.`.`.`.`.`ϲ` $ @$ 4 @ @mb > @F#p'D/ex> | l'L'P*g'`j' 7f  `   0``( @}  "> @ t D `  *` D  2`" > "`*`  "@> #Ȓ $   $ $ @$   " `   , L4$ P@$ L ,,,PސPPڔ (` c-`  $` ,` f\4@`4`$`$` 4`  ,`,`f`P”   O> a"@Y4` @@ /*@@ $ ,> " e` 4`4> ",e,4     ` @0> h`  '//'P P{  4` ؒ  @6 >   (@64`  @ `,,    @j > " > @R#㿘沒 @ @̰  `  *` "  "`*`  "@   0 ` @bp 0`@?ז    `0&@@```` ` `  " ``@ `? ?/>,( ( %@     `? `? @  @ @  `?@ @ `? 㿘.`.. 2`2ė2㿘     㿘     㿘 @Ԕ   㿘 @Ȕ    @z    @ @ 2 ba" ba b<"  b<2 㿘  2 2 Ɛ 22   㿘 ? > @#(a01&2 "'> *  &@c"  &  bp " & a$? &  & && a$h&@@."* @&㿘."> * c ** `" "  & dh&@dx@&0? & 2'&@a0& "  " 0$@*#@@*#@`*#``*#` `  *#`  ```" 0 "  " "  "" " "  '"/@0@ " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "@` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"@`` @" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"```@" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"`@ @` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "` > a8" @`''XP'\am L Jp /ؒbX @am "''>  b`> B:`Ȓ`#h -'@ ` "( 2@`$ 2 @`( 2@`, "@` ^"!x`N> @.#P z> @'#p= `$ 6 ,   "` . 5`  X`4 5  (  `  \`4 5    `( 8'\ 'X ` 5  " 5 ?X 5 `>#P*` €\ @\X" @ H    @  =  9 5 ! #\X \@X$(`?\@ X$$`?\@X$ @?\@$\Xݘ@\X   \Xu@ $``    `H,\X@j < \ XC 0 (`$$ $  ?$, , \?$, ,H\X@i 2 (D 'X '\HD   "       )z@   > #` 5  > @#x 7 > @  b > @# \> `'l''f'Lj'P'T@y LP>    2 2@ < #԰'T//ǔÒ` 7䀦``7В  , -`4 7А  KLt 42`  7В  =L d2@@ɡ,-2`4 @ڒ$@ * 2`@7А Ȕ  *`2  ?*` 47А  ?*`2  L am `'>#d*` €LP 2   @wT@rT@mT@hT > " > @#㿀h> -c"* `@? ^`7f'''`' b\     a@ `0  0p`C @p{:p ` 2 ]`v'耢 "dn' d`"  Z@"hb' e`" $ [@" $lW'耢   Z@ ϐ 2F  $   Z@! ";  $ 2 $ @g= Z "0  $ 2 $ @q Z "%  $ 2" , Z  `" ,`             P 2 ,  ,耤   - *` (2 *  `耤   ` '耤`X `$    Z@ ` 2F  `$   Z@  ";  `$ 2 `$` @f Z "0  `$ 2 `$` @p Z "%  `$ 2" `, Z` `" `,` `   `  `   ` 2 `,  `, x'耤O` $   Z@  u $ 2 $ Z@ < j $ 2 $ @fv Z _ $ 2 $ @p? Z T $  ` Z ```      ` ` 1` `-  -`*`(2  |3'b<  L0 !`" [  @h@i( !0'b: 2'a  0 耢  c 耢` `"^ b\ L  2 `"  b\    㿀h\ `dlp* 2 *` 2`#h#\#`#d  *#\#d#`#h * 2 *` 2`#h#\#`#d  #h#\#d#` "\?`>#x*` €#\#`!h-#d!j [ Z3`#h#l > #`> !j#@!h} $x!@ `$ 2 Z Z  " ` 0k` `X f` `\ _`8#`0W $ 2 Z Z  " 0L `X G``Ә 0A`\ =`8`(ɘ 07Ô 01 Z 2( !m  2 !j!@ Z!j-!h X2" "@`!h?c 8" 5!h 250 㿐`\`[?#&`&` &`" `Z?`K> #D> #܀  `@`D `D`@`Z  *:?@*'*2`'2@WV 2 @'@W 2 *2@W 2 @@Xf 2@ ? `&`@`&`@`&` H> ."6' #\  @  Ā$ @   " ` `` 8  ` (  @&" > @#@>  z> b. 6' 7#\ @]  Ā$       G   (  &" > @m#X>  > `x"``'` `0+ؐ@ * /"@%o  @&x -,`@ߒ *   / "  " " " @%U  (,`< x ^$@?* 2  * 8 Ր?"8,`.2 2`@8 @ *  > @  㿘 & "l  H  0    И \ !@`@& @`? @ D 'H'L Zl'Pd'7''''@''耢  > " 8 B: 8>  L @$'#\ ,#`#d #h#p7P#l t :'̠  뾔#` P#7#\ ,#`#d #h#pP#l R '̠  뜔#` P#\Ԑ ' bb`2'% <'Ѐ 5> pP`C @l:p ` 2 ]`p' L dg' "d`  @"eh['e  lR' `$  @U 2G  $ @ ; `$ 2 ` @bÒ 0 `$ 2 ` @l % `$ 2# ` "2` 2 ` 2`   `Ֆ   `," `-`p' " `*.`(  t' `T  @ 2I  T  0@# < `T 2 `P @b] 1 `T 2 `P @l& & `T 2$ `@ "2`D 2 `H 2`L  `@ `0n   `\" `]`x'  `Z`X  |' n` \ "v0X 2 0 i h " H0o'  2L%D H@  ; "T` 2L%P TL  &"(` @(@3b<  LŖ쀢 !`@c@d !0': 2' &&@h" "_`20'     x@h'''7`B > ^ Ԁ`"& bb "" b^ Ԁ  @L Т b^   #`#\P#d@oܒ b\ hbX c` L   P.3`#\#`.3`#\#` Ԑ '"X` ) &` T@2  #\#`#d#h#lm H#pP#t D#| @###x``4*   2 5 ` "6*  2  "7  "\`2 Lc 쀢   ( B: (7 "c`2  `2  X B 2` *`&@'؀"  x`B :x ``B :`E7bX  am ؔĖ  h B/: h` > am L   ꬖ  ꤔ  h B: h> !@h C!  ( B: (7؀`"`X 2`t 2> Ր#h`> apؔB?#ap;`@ِ T؀@j`˰ `X `t > ܸ#h`> apB?#ap;`@ T @+& & &  " Ȁ`" a "a ̀`"a "a` bk. M b^ . L b^ @. L . IL. H` . J  q 46 0k`6 D  b&6  \ 06   S 46 M`6 D  D6 0 > 6 0.`2 @ & &  2&  bc !> @ " &   '& !>   `&  2. `*  6  * @?: 6 "   &  . . # #6 &!& &!. NҐ؀`& `X "`X  ̐ ۔& `X "`X X  @3q   ( B: (N7 X 5 0Ԓ  #\#`#d@4 !!x`> @| @3{ ̀`" a?"a Ȁ`" a?"a a?"a> .a@"X@ P> #ْ "%@3Đ X`B :X7N ̀`" a?"a Ȁ`" a?"a a?"a> @ul H "@@;R  6!  V "c`QԐ `. L  P. 3`#\#`0 . 3`#\#`@i&  i2* 2 * 2 6    #\ #`#d#h #l#t#p#x#|# p`B :p7  @  X`?@D'H Zl'P'X'7'''@"'耢   > " 8 BZ: 8>  @''#\ #`#d ,7#h#pX#lP g <'Р `汔P #\#`& 7#\,#`#d  #p#hX#lP B 'Р `挔P #\#` ߖ  b  '$<'Ԁ {3> pP`C @f:p ` 2 ]`^' dV' "d`  `@" ehJ' e  lA' `$  @G ` 2G  $ @{ ` ; `$ 2 ` `@] 0 `$ 2 ` `@g~ % `$ 2# `` "2` 2 ` 2`   `ǖ   `," `-`p' " `* `(  t' `T  @ ` 2I  T  0@ ` < `T 2 `P `@]O 1 `T 2 `P `@g & `T 2$ ``@ "2`D 2 `H 2`L  `@ `0`   `\" `]`x'  `Z `X  |t' n`" \ dbX " bHa0e'  2$D H@ , "T` 2$P TL "(` @{(@)b<  L쀢 !0#' 20: 2' &d"h" "_`2d0'     dh'''7b`B >b ^ $ b   ^ X @Ԛ b^ `   #`#\P#d@j "\`29"X 4 ` P/`#\3`#`/`#\3`#`    "4*  2  "5;   "6*  2  "7,  "\`2Lj (쀢  b ( B: (7 bc 2aNa'a bx`B :x ``B :`E7bX  am ؔ ` b h B/: h> m  `  b b h B: h> !@ C! b ( B: (7؀`"`X 2`t 2> #hb`> apؔB?#ap;`@ T؀@u`ݰ `X `t > #hb`> apB?#ap;`@ TŰ @i& & &  " Ȁ`" a "a ̀`"a "a bk. M b^ . L ^ @. L . I. J. H ` 㰔6 0 4㪔 6 D 㢔%6  㜔 06  ` 㓔  46 ㍔6 D ㅔ6 0  6 0 . . > # #&!&!. NX؀`& `X "`X  А a& `X "`X@"X@ P> #婒 !b X B: X7! ̀`" a?"a Ȁ`" a?"a a?"a@I H "@7%  6!X@+  @`?`@`D'H `Zl'P''''7@'耢 ' '> " 8 B<: 8 `[  :> ) ` @/`?7 ` /π  >  '` /ϔ  *`  /ǀ7֐ '>  @D'֠`,*`2 #p7P#\#`#d#h#l h d `Ⲕ `"`S "b`,`Pt ` `2` 3 @`< "b`ꊖ  3'֒*2 `,#h#p7#`P#\#d#l & " `p `" ` "b`P`,2  "b`X  ' "b 2'%`< E3> pP`C @b:p ` 2 ]`(' d ' "d`  @" eh' e`"  `[@l ' `$  @ 2G  $ @T ; `$ 2 ` @Y 0 `$ 2 ` @cW % `$ 2# ` "2` 2 ` 2`   `젖   `," `T`p'  @ʒ 2I  T  0@ < `T 2 `P @Y7 1 `T 2 `P @c & `T $ `@ 2`D 2 `H 2`L  `@ `0H   \ xZ' f`ϐ @2K0 g`ǐ @2C0 n`" `\ :bX "b(a0;'  @(@)b<  `LΖ쀢 !0#' 20: 2' &d"h" "_`2d0' И    dh'''7b`B >b ^2  $ "b   "^ `@  b^    #`#\P#d@f "\`"`Ln s쀢  b ( B: (7 U bc 2a Na'a bx`B :x ``B :`D7bX  am ؔI b h B.: h > !m  `2  b* b h B: h> !@ C! b ( B: (7؀`"`X 2`t 2> [#hb`> apؔB?#ap;`@_ T؀@r`ް `X `t > >#hb`> apB?#ap;`@B Tư @& & &  " Ȁ`" a "a ̀`"a "a bk. M b^ . L "^ @. L `[. I. J . H  6 0 4  6 D` &6   06   ڔ 46 Ԕ  6 D ̒`6 0 Ŕ 6 0> # #&!&!. N؀`& `X "`X   ߪ& `X "`X@"X@ P> # "b X B: X7j ̀`" a?"a Ȁ`" a?"a a?"a> @ H "@@3m  6!`@r  X`?@D'H Zl'd'''@'耢  > " 8 B: 8>  @#',#\#`#d#h#l#p  ? `. `,. bP",#\#`#d#h#l#p Ú  `  `  bP,ϖ  b  b 2'$<'Ԁ 4)> p`C @_m:p ` 2 ]`' d' "d`  `@" eh' e`"  [@l' `$  @@ ` 2G  $ @@ ` ; `$ 2 ` `@V.@ 0 `$ 2 ` `@_@ % `$ 2# `` "2` 2 ` 2`  @ @`   `," `T`p'  D@j ` 2I  T  D0@ ` < `T 2 `P `@UD 1 `T 2 `P `@_D & `T 2$ ``@ "2`D 2 `H 2`L  `@D `0   `\" bn`xI'" \ "a0bX "b(a0:'  @;(@(b<  L~쀢 !0"' 20: 2' &&@h" "_`20' 遘   鵘 @h'@''7"`B =""^`Ԁ" b " ^ Ԁ`  `#`#\#d@c b\ ;bX 6   ``` `0 P H`t ``"4*  2  "5 ` "6*  2  "7  "\`"LT 쀢  " ( B: (7 bc 2a? a'a "x`B :x ``B :`E7bX  am ͖ؔ ` " h B/: h> m  `޶  "ޮ " h B: h> !@q C! " ( B: (7؀`"`X 2`t 2> ސ#h"`> apؔB?#ap;`@ T؀@u`ǰ `X `t > #h"`> apB?#ap;`@Ő T @4& & &  " Ȁ`" a "a ̀`"a "a bk. M b^ . L ^ @. L [. I. J. H ` { 4w  ` h 4d ]  W . . > # #&!&!. N2؀`& `X "`X   ;& `X "`X@"X@ > #ރ !" X B: X7 ̀`" a?"a Ȁ`" a?"a a?"a!@#  H "@@/  6! p>  @?`Z\'`''''9%> p`C @\i:p ` 2 ]`'耢 d' "d`  @" eh' e`" `[@l' `$  `@@ 2F  $ `@@ : `$ 2 ` @S*`@ / `$ 2 ` @\`@ $ `$ 2" ` "耢2` 2 ` 2`   `@=`   `,@" `T`p'耢  `D@ g 2H  T  `D0@ ; `T 2 `P @R`D 0 `T 2 `P @\`D % `T # `@ 耢2`D 2 `H 2`L   `@`D`0   \@ xP' n`" -`\ "A0 - * ] & i "d?#@ (  @)(@b<  `Ll !0' &$% "_`20' x耢   欘耢 '''7`B < b^ #` `#\ `#d@` "\` `L:   ( B: (7  \> `  `Zb'H'``'L'P'T/' /`@ m`Di@7`7`@ ``D\@7`7H`L  m& ȆN H 2J bl b] 2J b] 2 J L 2 JH@ਤਦ 2DJH@ `  `@  ` @#\` #`#d#h#t#l `Z#p#x#|#`@`D̀ l ` @f ` @` 䀢 "ښ   *` ` H 4 4 JH@8 `  > ` @8 ` @2 ` * 0 `2@"` #\#d#`#h#p#l#t `Z#x#|#Bk   ` @  5> p`B :p5 ` * 0 `" `@`#\` #`#d#l#h#p#t#|#x# `Z`D `@ `#\ #`#d `Z#h#t#l#p#x#|# " "``" "` "`` "`*** *  5> p`B :pְ   `  ` 2  ` ` '`X 2 " 2PT@$   5> (`B l:( "` 2`@m"$`` "@`ख `  '`T ` `!   ` P2 `ZT , /`  2 *@  ?2    *@4 , ` 2   $ ,`  * &  /`* & $/` 2  8 4  ` `"@ ``H `C  '`T ` ` `2  `  2   "   #` 2   PTp  '  *" ?"%@A !ۑ* @ `   "`X 2  2 " #dP#\T#`@$g 2°  /`2 @ *4 $ 4$*  & $ `     , ` " `   , ` "% `    , `2 `  䀢`" ` ؇   5> h`B C:h2 `  , `  ,,> #"a  (    *`N      *`N ` (    *`N ( *`N *`N ? ?  `?"% [A! U> #`> @D H_ ` > ` `;``#\``T@3 2 " #dPT#\#`@# 2  /`2 @ *4 $ 4$*  & $ `     , `  ,, )>  %> `  ` ` @#\#d#`#h#l "mL #p`H#t#|# `Z#x`@`D 4 $$Z5> "axU> @Ð w ` H`;`>  >  #h JH 2> >  !#l> #\ `T@@  1  *#  2 ?"%@ 3 A!ۓ*@  4 $ @  5   6 #\> !@s  5P`B :P  H 2$@H(@ H,@H0@!H` `Z 0`P`#``@#\ P ``P`#``Dݹ#\PT@c   PT@Z  > " > @m1!88\>  Z   b/'`/ @ 0 D,@7`7 @ # D@7`7䀦`  1&  N `| 2 bl b] 2  b] 2  2e  `J@````  2  *  >  + > #"a      *`N   H 2   $@`  (@ `  ,@`  0@" `2  0  Z #\ P`#` @   Z #\ P`#` D`@֙   > @lq!P8\>  [ @'D'`'T': 0 @` `        *`    2 Z Z` [/` /a@LD D8@`7\ 7H@$9 DL5`747\`  I& Ś `N `> ` bl b]  > b]  > ` 2 > # #a* N  @` H 20$@`(@ `,@`0 ʀ`+ Z  "°  ` ܥP,  0 2` T2*0  ܽ`T@Ȕ   "  ` |P,   2` T2 2@զ~   ܎`Tp   /ꀤ 5TT#\   @-  > #`> @F!hS ?@ `24@> `B :E   *  @/''d'#\ h ( @  > > #`' > @!" "npT/?' 0뀢 3 < +" , 2/ *` 4@ `B < #\  @  !x  > @א!  3 *  * @/뀤뀤   +` :~%`#\  @   > #` > @! /a`/`ԐL А8ӽ`7\7HԐ$Ӵ АLӰ`747\`  & > `N :`2 `J` bl b] 2 `J b] 2 `J` 2h `J@````    `퀊 2  ` 䀢 "@3    >  *"@ <*> "!x`>  `!@$ Z p@> @" Z iD> @"> "(@` 4@ P`B < P   `H 2```$@```(@ ```,@```0@& `2`0`#`P#d#\#l` #hВD  #`P#d#\#l` #hԒ4   ꀢ  T@  @ T@  (@ݖh #\  @v  > #` > @"8 /a`/`ԐLҭ А8ҩ`7\7HԐ$Ҡ АLҜ`747\`  Ү& * `N &`2` ` bl b] 2 ` b] 2 ` ` T ` ` @` `H 2```$@```(@ ```,@```0@6`2`0`#`P#d#\#l` #hВڃ #`P#h#\#l#d` Ԓrꀢ  T@.  @) T@#  (@h #\  @  > #` > @А"`ݰ /a`/`ԐL А8`7\ 7HԐ$ АL`7\74`  & n `N j`2` ` bl b] 2 ` b] 2 ` `  ` ` @` `H 2```$@```(@ ```,@```0@z`2`0` #`P` #l#\#d#hǚ T #`P` #l#\#d#hٷ T@{  @vH #\  @  > #`9 > @'"4 /a`/`ԐLF А8B`7\ 7HԐ$: АL6`7\74`  I& Ś `N `2` ` bl b] 2 ` b] 2 ` `  ` ` @` `H 2```$@```(@ ```,@```0@р`2`0` #`P` #l#\#d#h T #`P` #l#\#d#h T@Ҕ  (@͖h /` /aԐLд А8а`7\ 7HԐ$Щ АLХ`747\`  й& 5 `N 1`2` ` bl b] 2 ` b] 2 ` ` _ ` ` @` `H 2```$@```(@ ```,@```0@A`#`P` #d#\#l#h  ؏ P` #d#\#l#h   ꀢ   > T@;  @6 T@/  (h@) > " > @g"@> "Z`['/ /@ D7 7@ D77䀦`  &  N ` 2 bl b] 2  b] 2  2o  `J@````  2  *  >  + > #"a      *`N   H 2   $@`  (@ `  ,@`  0@, `Z    #"P  B@ @ m     "P  .D D Y  " > @f="؁㿘_``)E * 2    277;  7`27@> `B (: @   !  @     *`  (   7` 7@> `B : @ؖp> "'@} ``` & * /"*   / "  " " " @   @Ѐ` `8 ?"`8 b > @e"p> "'@> `` `  * /"*   / "  " " " @ @ Ѐ h " 8 ?"8 > @ee#`> "' '  ` >  2`L> @# ``* '9&bl` `沔 @  2'b] @ `? (' > #cؤ@~ ܐ ,  /$ bl @؀`2`X> Ēa4`T "`T "`X4 ,`<*0a8  > #`> @ِ#h02 А  Ș PȀ 2$ a@ @     2$    `ǀ @Z "bl  > #`> @#80 @ " ` 2@`0`  ` `@ "@d `  ?"` `@ " @d ` ?"` `\ 83` "`@ 2 >  4`" x "x6 `@*`6  > `a,  "a, > c`0 "`0` 9bl@> Đ!4 L`" Lbl= `\ @: &bl@]t -'  " ` @4'2bl> Ēa4`D "`Dbl 2&؀`"`8 ?"`8@bl@4  > @c#X> "' '  ` >  2`L> @~?# ``* &'bl` `沔 @̌  'b] @ `? ' '|@}T Ԑ ,` /$`$`  $`bl$ $``L   *   @AH a8  > #`> @y#02$ Р   Ā  `Ȁ `̀ "a@`̄ a@ @   ` Ԁ  ` ؀ ` ܀ ` k  ` ` F @_ = "5bl '8 `> #`1> @##0-`? ?  P4`  \ @[s bl " bl!`B:`bl    \@” bl 2&@bl > @c 㿘      :  {   @ !  o*@f*``ca@  @]  "$ ]   @ N"@ & &  @c  "@& &  ;@  '3@ * ,6   &    0% : 0 > `` "`> c` "`> Òb` "`> (`B :(  4` &  > > "b>  !h!@''@`7N 'H'8'D:   ????????????А  '!x > @~, (K  2G `X 2`H`L 2`H2 ऐb!x`>  P@~`(1 !", 2> @|w x  @N x  @ ,   ` 7> b`B :7Nf ` ''Ѐ   ` ' `  // ` /`??'` HD#\#`@?7> `  x  8c8 #\ ' >N  `"    b H B: H7N7>2 "@* "@'䀢`" #\ @* 2``7>N#`#\8* `7>8 >> Đ!̒HD#d#h#l#`#\@87>p #\ ' >#N W rv  r`" P  2Y7>r  t"@ `  7> b`B :7N#\8* `j7>8 >> Đ!̒HD#d#h#l#`#\@89|7>P #\ ' >ΚN  >@ j N`"    N7> bH`B :HT7N#`#\8t* `7>8 D>> Đ!̒HD#d#h#l#`#\@8˜17>Ȗ* `7>8 `O 2 `O @Z 8 `O *`O8'@'H L8 >> Đ!̒HD#d#h#l#`#\@8K7>> %8 @  !8 "@ M @ "k`8 7> b@`B 7N:@x  > @|\ 8 > >  @b2b쀢 b" " ܒ * " #> 뀢  8  ̀  "\    ` `  *` 8  @ ̀`"@ b^ H@HD#d#\#`O @O< > `    `  `@  B@ :> `    `     `B 8>@ "\`> @`?(x`B :@@ B :Hx`B :H@ B :8P8̀x`B :8̖ሔ@ B :8 䀢H`B :88@ B :8 耢"8H`B :88@ B :8 J@ (`B :8@ B :8@ ̀`!!@  J   J @2 $ 2'' $ 2 T8  J@ "\ `?#\ ,#``?@@ T >8  J@ "\ `?#\ \#``?@? P> @@& 7> bl 8>b > @^ ȁ> > b"!h> @!@''``7f '\'P'X:   ????????????L  '!x > @z   2{  X 2 H L 2 H2 ऐ"!x`>  @z (e !"`` 2`> @x! '  7V "`B :7f   @f  7V@@ `''Ԓ  ǁ  /'/ > *  ( '?` $ /(@뀢 3- < +") , $A>9\X#\#``M* 2``f7V  `B < _7f#\  f  !x > @z!H 7VJ  3 *  * /뀥뀢 c : PPp #\ ' Vf  |  *` ("   27V|#\2`*`"" ' @* 2``7Vf#`#\PJ* `7VP P> "H\X#d#h#l#`#\`Pں7V #\ ' V_f [    *` ("   2]7V  `"@ `  7V "`B :7f#\P7* `n7VP P> "H\X#d#h#l#`#\`Pq7Vh #\ ' Vf  V@ m f  *` (" :.   f7V "H`B :HT7f#`#\P* `7VP DP> "H\X#d#h#l#`#\`P17V* `7VP `O 2 `O @VД P `O *`OP'`'\ LP P> "H\X#d#h#l#`#\`P7VP VzV  `b쀢 b" " ܒ * " /V +뀢  %P ! ̀  "\  @ ` `  `  `  *` P  ` ̀`"` b^ \`\X#d#\#`g @K V `    `  @ @ B@ :V `   `    `B ;V` "\`V ``?(x@ `B :`@ B  ;\x@ `B :\@ B  ;PWP̀x@ `B :P̖ሔ@ B  ;P 䀢H@ `B :P8@ B  ;P 耢H@ `B :P8@ B  ;P J@ (@ `B :P@ B  ;P` ̀`"> a@  J   J 2$ 2''$ 2TP  J` "\ `?#\,#``?@ " > @[6!` @ 0`05  3? x `x.  0'` # ! ?`  ?`  ?`   ?`   ?  I `I\ H `HW"G ` K  I?4`4D 06`?  =?@`@8  6?`1  /?<`<*  (?`#  !?8`8  ? `   ?4`4  ?`D`D"  I `I\ H `HW"@GD4`4K  I? ` D 06`@?  =?,`,8  6?<`<1  /?(`(*  (?8`8#  !?$`$  ?4`4  ? `   ?D`D0`0" @8 2@ `8 @8?2  ` (  ?`   ? 㿘 h@tX`h   ?`" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @  &` &`&` &@`6$ $$@  㿘  @] &   "  20   " "  `㿐'> > #\ap    @i #> > #\ax`p 0  @i %> > #\a 0  @i !> > #\a"Ē   @h > > a#\ #  @h `p@l#c  @l  c @l 0"ĒcP @l > c"c" > c"c" 㿘> > c "%> 3> #` > > b @sL">  ""@@sG@ ` > ! "  (> > > !a@q > > > #b'> +> 5> /> -> )>  @s ""@@s@c  @2 @> ᨒap@ql  @  ! 2 (ᨒaX@q] (!x㿘!> ! *@oT > b!x  > > b@r"!> "@rޒ"@!쀤@'> > #` "l @9!쀤@ l @ l *@o% "!x` > > b@r"l> #@r"@l@> #`  @l@  @ 㿘 ! 2 , , ?%> #> ` "` "@ @j a ,? $a0(&!> #> %> '> `""`"@ , " >   @8> a(@p! @j" l ,?$ l@U ` * `2 "` " `" hȒO => # !& ( `>  "` "   " &  "` "`" `>  "` "   " &  "` "`"& 㿘 ! > > ! `"  "`> "#  ">  p@j$0!s `"  "`> "#  "> !@j㿘?  3  * @ <"*`3  'P <  ! "  > > > !a@p!M   "@ & & @ 2G ,!>  p@hH  &@ p@h@ &@@> *`!@2 $@` " @`" @ ` * @`2 "#@"`(@" ,> @a!@> ##`"@㐐 "`@ # @"@"` /` ` ` ,2`*  ` @  ` ` *  $`` `> > > !a@o!x2 2 2@ @3`# @+  ,* @ "@ 2@ #+ @" ",-\4 @> #` > > c@q"> #@q 4@% @5 * 5  N/` #-,2`2  @*@ @> "  -> )> '>  * !x` &#@pՐ,`2`@pѐ ,` 2 * #@#@ `"  "` "@> @h! > a?` "a` * 4@7 $ *2$P `@ `! *`!2@@ ,`&@ ,"`@"`,@ , & &@" %@&@ `! Ԗ , `8)> #> > ` @` * " *$2 @ # ` "`` * "!x`c@pW"> ```` * ?@ `$@pH `2`"ax  ,> > c@p9"@> `$ 8@p34 @4 `$  `,2 > > > !aH@n!? c *  $ ax  > > c@p">  X@p @s ^&@!> @&@h<! > a?"a  @@h/a !?$!@l`2 @ $ @ $@&@ +  4  @  " &  &   @& "!x`> > c@o">  p@o0 > @g! > @" 㿐@` `* *`"'P    ! 2 > > > !a@m" 2r ,!> !@f-  &!@f% Y&> "@f > @g!M&l  "l> *`!2 $` "``"` *` `2"#" (44 " ,`, $ ,"`"`, ,$> +!> ##`"㘐 "` # "" > c > > `@o!"-`> -` ȕ2@o2   -`2 @     (   > > > !a@mX"G-` 2 $@@ > #`> > `@n"->  !` @nݛ3`P`#`> > `@nѐ"> -`!0  @nț3`5 ^> #`> > `@n"`- 2 > #\!X@n%5 @ C@ * @w  % " @> > > !a@l"t `*`@9@ @   <` ` @`&  ` "@" `> > > !a@lє"" 6`+6`) #`> > `@n`"`- 2 > #\!Ȕ @nU> "@d /> `l "`l44  $" %$ - 4@ > #`> > `@n0"> -``! 2 @n'44 g `;> #`> > `@n" > `-` "#\24@n4 % ! @     ` @`&  ` "@"56`> > > !a@@lL"+ )> #`> > `@mܐ" > `-` "p#\ 2@mљ4> "@dw > `l "`l44  $$ "$ j-   @'> #`> > `@m"`-`>  - "#\ 3 #`@m3`4 `""`"@> "8 <  @6 > > > > !a@k"#`> > `@mv"`-` >  - "#\ 3 #`@mh3` 4 `"  "` "@> "Ē@e> `l?"`l@P-$2 @*2$P 2 `! *`! ! Q,` L` $@G> #` > > `@m+"> `"@m%$5& '@P ,`( `!$ P  ` `! *`! !`2> #` > > `@l"> `@l# `! *`!@ 㿀> `c' @*  2 *`,`apBa@: "ax> > "@kc0> @k#@$ > "ax> > c0@kڐ"> #H@k֒5 ?@#> "ax> > c0@kÐ"> #X@kbX&K> aq  ' `! , `$2  /> > ! @bN  >  6> (`B :(a "a$ $ > #` > > c0@k",> #h5 @k2 & "I` ! C``' L `2Y bj> a  ' !, $2  ( bXbX$x/> u*!bX3  & C0Y` L `  *`  "& bj ! K bj 4 bj `"bX  *,bX("bX@)*4,  4 2t  4 `"bX  *,bX&T  X 7 XO  6> (`B `C:( b^ ?#d`#\#`5  6>  `B : !x  > > "@jԒc0> @jѐ# 5 6 `B < `  b^  #d`#\#`@=  `> # @'Ԁ`apBa@8M `B : 6>  `B  :  6> `B :`"  b^  #d`#\#`@<  㿀> #Ъ \ @  Z!pB!@6m `2 `` ` H> `2  `B> `( >>  2` 8 @2 2` `  ,  *`*$ 2` Ԗ 4 ` 2 "8` Ȗ 44 "8  @ 2 @  > "  B: 7` "^   `#d #\#`@:x  @> " '  > > > > !a@e%(#@]ʒ '  @d̒ Z  "        *` "l  2 (g   bZ#\* Қ X  2 .쀦 P?# 8  " 3  < (-  ` @82` "` *  ' . . . *  ' .` .` .` " "`  "@   (& `   4 b > @J#㿘 `" > @^ʐ# `> @^Đ#0\> `'H  d  ' ` 2 Z> > > !a@dȔ%Z  "   `"   ` 8*`  *`"    ` 8*`  * 2    "`  2 Z`   Z2#\H*   2 ,`쀤` w?# `  [  d> "!x`> > c@e"> @e >  A *`  ' , , ,"  `" `  `  Ж   *`  ' * * * ``" `   `"  '      ($@ `   ` 4   &@ H2*@͖@ `"-`` (@"@@  > > #ab" > #`> > c@ew"> @et (> @eo  ?c  2``$` @"@@ > #`> > c@eR"> @eO 8> @eJ `?c  2ɀ `ŀ``` ` `!􀢠@> #4" '`" 'Вb@ ??# . **"@at* `ڰ ` ` >  ` " > `"T "@ > @<T> "!x`&> > c@d"`>  P    0 ` "   1 "@   2 @  3@dÒ "ax > > c@d"!>  p#@a@dax  > > c@d" >  @d ax  > > c@d"`>    @d ax  > > @d  6`0`B >`0 2GT `2CT  2T `  TT `"4T  "0T``",T "(T` #!@> "!x`> > c@dG"> @dD _ > @d=  6 0`B < 0k T - ) ` $`@ 2`2> c `   > > c@d"> @d !(' > @d :  `7> ` ! 2> @D  ` <"` ` 2"` "   `<"`` "` `  `  "` `   2`> " > @Gא!x㿘 `2 @* ? ` 2@`b8@ ( @  6b8 6`@&@   ` ߀ "`" ` ` ?  ` @@ ?wdwdw\w\wlwlwtwtw|w|㿐!> ֠#(> > #\"a"x  @XӘ > > #\ Ta   @Xɘ > > #\!a!   @X > > #\#laȒ   @X > > #\ aؘ  D @X @w)> @0"@+;?> cPcP @\W > "#h> "b> @Ґ#> """"> """>  8" 8"`> > " P"a>  D" D"`>X?"$ x%" $ LT"4 <# - Z!  $ $ $ $ 4$ $ $$ <*\$ $ $ ,$ $ $ 0$ 8$ (<$ H!> "@`!" @G$!x$!|>!d@ } 㿘>> ! @ ? > @a?!?  0  ?  0  㿘_@ "K @K 4E `   + " *  @@ 27  " *  "    + " *  0@@ 2"   " *  $@"  $* @` `0``b$2a0`a8  >(        㿘 !(@_s   && & & & & $`8 8 8㿘  @% @_Z%$@d h> Ґ"@4 㿘NN /" N 1> #ې  $h㿘N /  N /"    @K$@_$@dĔ$`@d /  ,@Ɛ `!``@d$L@`i,(> h@aΐ"@ڒ  > h@aÐ"X2,L@ @c ? ` %@c`h#%@ F  @   @^Ȕ%$ $ (@dk @`  h`h$@dd> b@c$$@c->  ``$$ = (+$h$%,@@d_ / 2,L@ @s $h㿘 B> #>!`:`$ 6e 2! .!$ *   4  `"`  8 8!> V"!` "! $!@1  $hĀ㿘&!."o."pN  r  @`$@^$N / @cՔ$8."oa`" ,J`h `h,@cŔ$N . B@c / ",.@"o ."oN`.2 LN .2LN /L > b@b$@b$@cɒ /  > @_(bЀ  ."p.@@Ȓ `> a`2&!> @`" > @`"@  e  "e㿘.a "y bo  > b$@caa`h@b$Xbp @א$@^5$!``h,@@cK$bo 6a1> @cp / "*"@b$bo  &a@b h@b  a> h@`S#@_ . a@b h@baL@ hi@b @bT$@B bp  N > "> # @bA$ 㿘!`e ?> @`#( &! "e!$h&!, ,",( "(`(",` "`2(㿘 #> @0 @@-J  (` ,"`,&  , ("@`@X 㿘 a 2 a0`0a "a0@%ja0`a4"a4& a4a0"&a4?&b$a 8b 4a4 0@b:@b<bb@@( @&b@`0@@0S@0Q 2 aa "a@%.a@, ba8> "@W㿘   @]Ӓ  ":   , ,``* `2 @"@,02`#P@  @    @\  @b  4 `` $ `$$ `" $`   $ $ $  "@&  㿘`.`2 `2@`@a 0`2`㿘.`6``@? "`"`& "@ @ 0`2㿘> ϒs#* 2 㿘. > ϐ#2`> `* `0 `@``2@``"`㿘. > ϐ#2`㿘 $ 2  @Ő* 2 & ? 㿘 $ @ 㿘 $  @  > cP@a` 0@a] 㿘> ϒ#* 2 㿘. > ϐ#2`T㿘. > ϐ#`2`㿘> !@ !  `"a "` "`  "L $@M |> @V#la 2   > c>  "c$ " 㿘> !` > # > % a `"a "` "`  "L $@Mq |> @VP#la 2 $Ḱ㿘> !` > c t H /`  > H 00e* ! > a> > @  P"# # PG"a'> L $ 2 @L <  @F   2L $0`" "` "`  "L $> #<`@X@L  "@L  "> ! |> @UҐ#l 2 H 0%!㿐@ME  ( !  @J ! `` ''H /f * '  @KH 0㿐@M 2 " !@  @J 'H /f * '  @KWH 0㿘` .`# &* $@0`4,&, ?@?$@@`&%@*  `$&% 㿘`,  &.`"4* @  .`0 @ $@ `,&, @?&@`&$* $ 㿘`$@֔ `$ "  %`( `(@” `%@ @ @ `@ @ `(@ `*@ `,@ `-@ 㿐`0`@^Đ@`@^@a@^@|b<7@v a'@o b('@i b@'@c bD'@] bH@Y bL'@S bP'@M bT@I bX'@C b\@? b]@; bd@7 b_@3 b`@/ ba@+ bb@' bc@# be@ bf@ bg@ bh@ bi@ bk@  bl@ bn@ 㿘`a  .`"4* @  .`0@  M > #@H CH /` * ! %@*`$ (@ ,   #@   # # "  " @ ѐ`%@*  "$@ $$%2H 0 (> "'@  ' ( "$@ $ , *  @  *$ $@ " ڐ"$* "@!0   ֤8@> #;#;`  > @?V#X (> !d> b' 0" P@"~;0'@"x`U@"r`@l`&&@@"g0 0 `W@"\ 0 @"V0 T  2`Y@ I`Z@H0 @E  1`>@`<@40J @"70#`0@.`/%@0h @"* %1`;@!`:@16@ 5@`I@`J@"D  2`@ `@ 0D   m1`;@5`:@d0  W@"a0`'@"[`@U`@`T@O0 20#`0@ `/@E0 @A0" P0J @:0h @7 m 1`G@`F@,`@@#`?@&`<@* \ D16@ 5@`I@`J@"D J 2`@ `@ 0D  ; !> @M#|!> @;#|H /`0#* !0#0@U 0T@ " KW U@ " > ) &@ ">  @ "F>  @&>    @!>    +@ "> 8 N *@>   @  ܰ @ ".0 V@ "  @"p ˰ @" Ű '@ "D@"8  (@"B  0 `Z@ )0 @"VN0 R@ " E8 S Q@"   @"   `W@" ]0 2@ 0 `Y@ [ 0 0" O@  n-0 @ ">   )0 @"GI q @>  l @ "V>  P@ U 0 b/@>  ] 1E@",A=@"},'0h @> 0J @ "V>  %1 A@@"V = 1 ;@ ". :@". 1 <@L 0 +A@", ?@d,nU$(C@, 14@ > I@ ", G@, M@ ",J@` 0 3@~>   2 @ "K. 6@ " 7@"   @ "W.8  @"0. װ @" Ұ "h`>  ˰ # ` hd  t##  8`x  > @XҐ#x0 "h`>   #x"h  "t> @X#0  "  Vl4  D2  (."* 0@  .>  @@ 2  !> "@OH "x  $b, 4$a$b0$a$a8a8$a<$a$b$a4$  @ "$b$"$ $b$L` " L`@%` $a"@% L`Ѐ "L``В  $bL` "$bې` $b L` " Lal`* `4b: La " blaa* `4b<  bl  b] "  `0 " bd  bd@& 2  bd@& 2 C 2 = 2  2 >  8  + 2  ( La  a@[ $a d  "d  8 b\   2 bla "a8 bl  a8 "  {a8  $a@  @@ 2 ,  8 (  " # l4   ."* `" &"* @  _.D2  (Z!> "@M’ +"x  $b, 4$b0$a8a8$a<$aL`` $a4@$` $a7"@$C L`$aL`Ѐ "L`k`В  $bL` "$bb` $b L` " La`* `4b: La " bla* `4b<  bl  b] "  `0  " bd  bd@%n 2  bd@%h 2 ʒ 2 Đ 2  2 >  8`  2 `(`La  a@ $a d  "d  8v b\   "N bl  N  a8 "   0Ha8  $a@ h 8  $* @ + $* @  !@* @  $@  0$ 202 `dU     $, @J @?1"@ $$a0*@ a0`$a4@ `"@ "` 2 04a0$a4$a04""4`$a0a0"a4$* @a0"0"0$a4$* `"$* @@ "$0 $*`@  %@ *@ r0 Lm?h '>  ANh   @T  2, O .a|@6~0 LH? _   J  4  4 `" H 2I`"4 I@2A4 Hw 78d HHo "05 " e`02 "%e " Nh``b "Nh " O @Sh 2 O  @3L  O`, O ,.  2' %> @K "  @"IX @Mr ! F P@Rݒ <> c> !@  $ $! @ > #!   @WÐX b$& ̀ ?"$& Ȁ ?"$&А$@&K&"&&   > c.* &!  @  >  D G N 2> #a(?.͔!   @W`P b$$` ̀ ?"$$` Ȁ ?"$a$`Ȑ&@$a $a"$a$ak! Q!  . N * @> *`@(ǐ.* &X"!@%0T > #@R 0M@D+ > #@W1 0C"@R x> "@R  > "@R "> #!L!1$!t@% 0-'H J /}/ " 2H 2 H 2H " H `" `2B 2 B 2B " B " @ H.BH7(@7  BH7@7 a  Ȱ  H   6DH0B6F0  0 6FH@6D8 > !@!* 2 &!@*!" `2&6&>@1!&> !@*!> ϐ#P*  v&`> Ϡ#P*` Ĕ @L 2g  * "_&> \"# @`W  :ap:a:ax:a:aa0`2:ap0K P@'>  L $ 2 ؐ " >  "c<!x`3> @SK#0/ P@'>  L $ 2  " > "#<!x`> @S0#0#@  > #l@Iϒ  7 N`$ `$ &`|l@KQ 0> !@ @U  2 L $ 2  &`@B* l@K70> !`&`&`"!"`. P&@` >  &``2> #&> #@ 2 >  P@`  ```*``  Ԕ 0> #@  >  P @ '   *  |@BD ~ .z&  8> `@ "`@r& @@ 2m 8   2e !>  @I% k DN`0 " @`0 &`@ @ @!  > @#`@@  &`(`8``(&`,`"6"`&  #\  "* @`& &`(`20  #\ {    @`" ``(` *`(` D0@#Ks0? I 8   2  ܐ  #\A "ٰ  .!>  @H ܐ DL`0 " $`@@`0 $`@@# @   " @"`@@.  @J  @2@` @     (   * ( "   (` ,"`,&` , ("@"V @@ >  @IΒ$@ $`(``($`,`"@&`2  ( ,`($`,$`( ," $ ,`$`(`("`,`(&` ($ ($`,@`&`0JB "F &!  $> "4? :  & 2 0,a? ( `6& 20 q .!  $> "? "#N   (@S @N/?    (@SՔ @N  , D@ @J$<ذ$(հ D@ (8@0̰ʰ D@ (<@W0$( D $(@ɔ$0$ D $(@$0$( D@ (8@0,$(D@(<#\0@4@8 D@ @$<  D $($8@T$0v s D $($<@2$0i f D@@#\#`#d$($4$0$8@$<VT D $(@ǔ$0K `H D $(@$0? < D $($8@ Y$02 / D $($8@"$0% " D@#\$($8$0$4@?$H@x@S $2    @r$$( @m  @G  $   !L  ͐$ @ ؐ@M$( $@R$ @  @ Ɛ$  @$ `@@ݒ $2   @$$( @  @> $   !$L  sk$ @ ~@MM$( $@Rh$ @  @ l  M`@Ȥ@ \$2]   @Ő$$( @  @ 6$ 5 ``0L   > !`'> #$!@ (  $ $    4*`" *  `0 $ " @6 @3  `@ @; $    $$ @ @L$( $@Qː$  @!  @ ΐ  Ð`@ˤ@   > #h? , ,&  @ > #h? ?> #`9 ̔ `0 "`p"$&`0`p`t$@&`p"@&`t&`t`l$`d@  &`h4`h@Ov`h"@&`hj oK `㜀̐,^&? L  '>  "`"`蒒 2 > ?O#h    "`t%"`X   C"!p`> @> ;"c9"#@zԀ 4  @  .@  )@  %@J @F @A @>  @9 @6   @2 @- 0 H 0`@ ;|> @ )|> " > @2#,4Dhd"2 䨀<䬀"䴀"<  2"d"d  "d䨀2  ""d"  ""䬀" 䰀 2"""> 䬀" 䴀2 ""3 2"d"d  "d䨀2  ""d"  ""䨀" 䰀 2""" "d"" ݘ  2ld䴀2 "dd䨀"d d d@2""" "dd䨀䴀 䬀n"k 䴀2d2" 䬀  䰀 "2"""" dd "d䬀2 d䨀"d d d@2"""m 䨀 "dd䬀"d d d@2""" "dd䨀䴀䬀"  䴔 A"䴀2d䬀2"   䰀 "䨀2"""" dd "d䨀2 d䬀"d d d@2""" "d "2d2"㿘d2d@d =䨀 "䬖$ 2䰀" "&$ 2#$#$䰀" d"d"d"d"d`"&d2"d"dd"$d 2"$  $ 2$`dd" "&$2#$#$` 㿘@   @ $$&d&d&d &d`6$$$$$@  㿘  @ $$ $" $$$$2$0 䨀 $"$䬀"$ `㿐!> ֠#> > !dc#\$ؔ  @A' > > #̚c#\   @A > >    c  @A#\>  㸚 *>  + (\\> ("L @H 㿐|  @ ; @% "6 $  0 , @L 2%  H /` * ! @t`" $H 0$`" > @KD#&$ h> "> ''P'̺'L x  ! @A ˰ @Ӑ "ư     > "x @M L 'Ԁt  ה   0  ذ  @    @ @   /뀦 2   /ꀢ@ //뀦   @g 2V @ @/& 'Զ    ? L LL`` @ @̒Ԁ   H /`4'А* !'̐@rԀ PH 0Ё P@JP 2"@  @@<Ԁ L@̔@ђ > " > @.m p> "'P' xؠ  @ Z 2ذ @ "Ӱ   Ͱ ˰  >   @F @7+ 6( '    0 +  @  @0 2* `  c'Ԫ/ Ô   0  ذ p @  i  @  2 /ꀢ@"     /뀢 @   *"'Զ    25     ` ` P  H /` * ! @Ԁ  PH 0P 2"    @ה> " > @-{ 0X> > 'c'T\'X`''H''L'P 'Ѐx  !d@ ]   @  " d    > "x @ i  @=L '''Ȁj H ؐ  0- @ ְ /@3     .  ꀢ@&& 'Ȑ /  @   /@ 2 @ @/& '̐ /`L 﨔   Lߔ L` @ `Ԕ@ 6P`2L@P"@q &Lؑ* H* @'@  /m  2X     N `  @̀& H /`4'Đ* !'@X@@  TH 0ā T@)T 2"X`"@2" P LP@"@   @j@̀H@L@  > " > @,9 @x> " ' _8 @ ( 2h @  "c $ ] W / ؐϔ  B0  @  耢 逢``7 @ @C " /   /뀦  "     `Ӕ `  `@ 2& b > @+ P㿈 @  7 @ @ "2 $ 2$, @&% @E4  ''$3><''$b@ʖ b$@ʐ  `> $ &@Gb ` 㿀> #~ @ i Z @  "U $ 2$O @ I&@D  ''$' 'H /` * ! $3><b@C b$@= `  @ @O ` H 0  `> $ &@F  p> "'L' x   @   @  "  L{ 'ԀM 3 ퟔ   0 ܔ ذ Y @h  R @ݔ     //뀏 }  2;    & 'ԴL`     H /`4'А* !'АԒ @  H 0Ё 2& L@ʔ> " > @*n   ?0/  *? %` `0J 8? `88 J(J  ?  ?㿈&@@C˒   '$  '><b@+ > @F $  ><b@ > @E!&㿈@C $#><'b@ > @E!0$b@ > @Eڐ!XP> "'@C `  @ //'$2`@ `/`/` ''''$``   ``0&`$ @IH /* ! @:H 0 #  @v  2    `0`␰  > @)z!㿘`>  > #@<  # @C ``` , 0, 1@$ 42 ` , 0, 1@$ 8`$ <`$ @` $ D `, `, `, , 㿘 @ 㿘 ` > > @=Z 0@=W#́㿘@ #> ` ` @ "&`@Ea$&$㿘#       @ǒ &`$  $$㿘@   @ `$"@&$㿘@`@``㿘 $H /`* !  `?.  P@B\  p@BY H 0&  x> " ',b) Z  /얔 /뀎 P  b쇔  `ݠ b > @(u!ȁ㿘@B  `` ..  "@?* $& "& "@?* &  ..    ?   *``"`  *`*`  & p> "'@AҒ 0`  $"$H /` * ! `` `   4 В @Ɛ`0H 0` ? > @'!p> ` b'$"$H /` * ! `` `   4 В Y`0@œ H 0` > @C!? > @'" 㿘@AF ``. `. `. `4 & `8&`<& `@& `D& > @ ` b'>2 ē* €.  2 `& `"``&``?`&`ؒ`%  "`  &``?`&`xH /`* !  PC  p? H 0  '` ` ` ``' `` `U&` 2R `??L&`&`J  # ` X `>" X > "0  4> `b4" 8"  <" @"b4`" " "  $"$2# ` \ `" \ > "0p  8> `b8"( <", @"0 D"4b8`"8 "< "@ "D  > @&Đ"8㿐< @ K @ > D "'ϒ? '> @ @@H  $ ` $$$$'` ` H /` * ! @  `H 0`2&@ 㺰> "> '|  ''@ / $(   N$(  @@ 8 > `'8"$ 2Dd @P  "   @ "N$ $d'O B`@?$" "7$dȀ   @ ".$d$  '8@  L "d'$dȀ 2 " d @q "$ d 8 ? $d$d'`({$( H /` * ! @:@\  H 0@ 2& @ > " > @%"P㺰> " '|l 'H ', * * B$( * * z$(K  @l > V"  d   ?@ "$ d ?$d$d'  H /` * ! @Ր  H 02&  > @%""`㿘?2F @D ? @l 8 @> &1 "'? "`%@i   d(糔$( 2 0d($( `> & "p@@Ò 㿐> #>2 @  @  x @&q  'H /` * ! > "̒?A@ 8 5H /` * !  dL$  0d胔$ H 0, 2 H 0$$'i @G `H 0`> & "@@7 㺰> "> ' lR ', + $(   ,$(9  @ > " "d'd(ڰ$( H /` * ! @  H 02&  > @#"Ё㺰> " \'|m 2 2 2~ '@T ), * * 怔$( * * 縔$(]  @  <> " & d `"@* $d  @ "$ $d'd  2` H /` 0  * ! @  H 0 2'`2'@ > " > @#M"㿐} ; " > 4 "']? $ @  $ ?$$$$'$ 2$ @` a $a&@ $a$ݛ2& 㺘> " \' m"ʰ  @   ܸ " a$ " a@"$  #>  &$ 'bȒ 2+$  @   $$'N  @ @"+"㿐} 9  "4 !$ "0 !@2, > "'4? d @t  d ?&d&d'` 2d @{$!$2& 㿘> # | [ ۨ "V a$ "R a@> L "? ` d @0  &dd   2d $ H /`  * ! @ 2d  H 0$a$2&2& `> "$'d? $ 2_$ @k Y$ EԔ  :c''''ĐԀ    k "$ @"'Ȓ *$ '$ '̠2 Ж   ?АȒ[ $ $d&$$d$d&$$d$d&$$d@ $ d `<   @o  ?@&$" > @!#㿘N$ '> bH@;I " ?N$ 2?$@?#` J ``$J @ 2 ?$ ? ?㿘N /2N#N   / `J@ /  $"ǒ$"@9Ғ N# ?@>d:  N `d*N  㿘`@> #N  > f ?!  㿘@@:@  㿘 @$ 㿘> ="> c$Ȑ  "c  "$$ @` 㿘 $@$Ԁ 㿐`"`"`<`> ﷐"$Ȁ` d? "d$$  ߐ@ > cȐ?"c`$    1`2 &$ $Ā "&$ @y &$&$ 㿘  @$ 㿐  Җ * H /` * ! $(@9 0$X@9 0  >$>$H 0&$㿘> !d@2p # @9r$ؐє$( $٫ &$a  "a $@ $@ @ 2&$@  㿘 $@ 2$㿐`  m W$ "$@ $ "$@ $Ā "$$̀`"> a ?"a  $> !d@3㿘$d@= @9㿘> T"㿘$  $Ȁ 2$ 3   `@> #"  $> bdG $> "\@  ` 2  ` ``?"$$`B >$`B >$ 㿘$ \  $Ȁ 2$ U   @> #"  $> bd > $"\@  2  "  ` `@`> @:ΐ# /`*,`@ $( `B ;$X @B :`/`@  P `B ; p @B:h> "'!@8Q$(@=l ``(@=f$> 2&$> #  `$ @84$+ 2&$Ȑ      &$ $  &$$ $` > @q#@㿘$`> @:Q#X0 &$$  p> "`'?  > # 2$ > "d$ 2$ $Ȁ 2$ `{?2@6 ` @v > g  `"0``8`4&> "4> "8 '  I ` `  `` ` &@0 -> +> ``$$b\@ l `ؔ> L 7  ڀ`  > @#㿈@7R  '耦'"$ $><b@㿈@7;  ''H /`* ! ``&`X &`\ 2``><$b@````><$b@H 0H>  X?# @ 'b2  2 *  Z`#\   @ " > @E#H`  2  ?@2    ? ?耋@ 7/?? 7` `2 `(쀠x7` t?# ` / 2*@ Y*$ 4 `"``   `&  //2*@ * 2`/2*@ * &`2*@ * ` @* @'(`(`(`Ѐ  72*@ * `?   > #`C @'@2`  @#\;`#h> #> ##l$2 > ("> >  # #p` #ta"> >  #>  #x> #|#@8L> "@| (  㿘` G 6`> #`>  @8189`?6` # cc(> 1> 3`3` c # c2@2  2!x`( L  0@8, 2!x`>  P@7 㿐!> ֠#(> > "`p#\ l  @-_ > > #t#\`   @-U > ""㿘'> ⤀ )>  $"#> $b@0 2@/#t⤀ @> #  p  ~? x? z? |7 7 7 ///?i7  ,  L 2>  > >   > #  >  2 #\ #` "> >  #>  #d#h#l#p #t> #> ##x$2 > ("> >  # #|` #a"> >  #>  # > ## @76'> @"آ -%> @ !>   @2  @5$ 2 , ,@5 2  L L@5 "D  2 > "@- /7 t@- "  <`<`<@<` p> <` x"4` z 4` |4` ~4` ,` ,` $@@-,` ⤐t@/ @ l, +, K, k@$$@ 㿘 "  `@2  ` @2  `@2  ` " @4   ` @ 2  (  ` @`" @8`*  2 (!$ ` @`"s @8`*  2m !   ` @`"a @7` 2[  \ ( ` "R `@7*   `@7=*  2  F@7ђ%*  2: %@7,*  2  21 03 ``)`(`@7  `@7  !@7%ܑ*  2 ܒ%  `" @7`*  2 0 `@  2P   "" `  2  ` 2  `2  `2   `  2   2""` "`"㿘  @2 > b`% @"` `4 |` 4 x` l4 ~` 4 z `, `$ , 0 ``2@ p> " F? ? ? ? 7   '7 `(7耊 * 7 "ؔ >  L#\L ,  ,@5i 0> L !@5a,0  2 `"2 <""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@   @   &`&`&` &``6$ $ $@  㿘  @     "     2 0   " "  `㿐!> # #> !"!"`> ֔(#\> > a0 D   d@(} >  @"a  @P%> "`@> @ !@ $#> @1e!H㿀> "'@0  @5%>  ␐ ؒ @*   @0 ؒ@5 > c& & ̐ & А C > @Ґ!h㿘``>  Ȑ &  Đ  & > & a` & `""`@1!x㿘 E`" '`#>  Ȁ ?> @2!06& Ȁ ?> @2!0- &  `"  "`> "!  "@@0!  > #  Ȁ   Ā > ! @e   2   " ``"  @" ``2@ 㿘H /` * ! > c ( "c6 2$ > @0" >Q& H @O $ > " @0@H 0㿘 H !H /` * ! >  `"@F @_$ & HN H 0㿘H /` * ! > `" 2" > @09"& H 0㿘 H /` * ! >  `""&   H 0㿘H o *@ a > `" > @/"@H 0㿘" \$  X  2 H        2  H  8 (  J  p> " $ ' >   D@' @. dH /` * ! > bX@/ 2> !@3$`L`L "j`Hc @ ` $`T` А $`TВ@3ܔ  %`> b`@3   % > bp@3  % > b@3  % > b@3 `T "> @3,@3) "@> `T@1> ̐" "!`H, $`Hd  "d  %`L,`a,``$@$`"@`L" & @/`LH 0 `H  Y "`LL`L " D   D@(H 0 b > @"㿘 ̀ "  @  ` `  `  2㿘  >  L H #> > @.ؐ"$c@  T@  ac$$А͒㿀`> '`"! @(!> ``!> ``  ?`@@`2` ?#d#\#` @a ̚ > a"@0&$㿘 o  `k@`"d` `  2^` "X` T P T "K`   `?? ">`  `26`   20`   "    `  ` @e  4 2`"@`@ `@``2@㿘> !)> !@#* !@$* >  #*  @  > #H@/0N!> *  @*ס @@痒 $ @%!` 4 > * `@* $@-' ,``,` $` ?$ ?$` $` $`  "4` ` 2  @ :@* ,@ ` :` ,@  (,@㿘 $ = `9`L 5`H 1H /` * !  `"  "` L"  @`" `Lz  " L `H > "`H @'J D& H 0 $ ` `L`\`X" 㿘H o *@ a > `N"H 0㿘@1f 㿀!> "'!@1 H /* ! > [!   H 0?␐@,[ `!@ @,W ` *` * *` `*`** * * @@ ;@`@ @ B :*`ؑ*`H 0 > @}#㿘H /` * ! > ! 0? %> @m   @+ @ `@+ @$  H 0 㿘 H /` >  H 0A * ! > ! ? ,ΐ@0 2 @ > #$ H `ؐՔ ؀ ːW  H 0& 㿘  N @,>  @0 @ ?А @0[ "  ?А   㿘H /` * ! > ! ? ’  $ T H 0 㿘H /` * ! > ! [? 8  $ * H 0     `` *`"`` *`   *@ 㿘!> !$@*!Ġ!$  <!Ȥ 1> />S->S+>S)> ܠ ( #@-m"0L`x  @$`$`$`,`X$a,`Z$@@c$`\@c u@ @Ġ!Āaā㿘H /f * ' !  ` &!` & & "`!?&!H 0 `@y 0ہ㿘@y  ` "`P @" T8 @"  T @ @2   T"@2 T2 T P\> ` d ' `` > ]?!$ <`W@*U @  =b\`// / /''''b$?''b$b$' '``(@/R b^   9$   ''ܐ#?''b0 b,''/ 2  <` 4 `@*`4  <@ʔ @  > @]#Z [\cdjookmnvw<w<w<vww<w<ww$w,㿘>  #> "b(b@)ڒ"8b  $"$"$">  c$"$"$"$"$"$"$"$"$"$"@. (> b0>\>\$b D`0>T  T$ $ , X$!, Z%$ @ 6>aa" @ >aa\"8@ ݔ>abp"P@ ؔ>ac@ Ӑ"h@&@& < @I 㿘H /f * ' !  ` &!` & & "`!?&!H 0 `@wܐ 0ہ㿘   `  > #@"S &` @)U  㿘  * *`@ *     > #`> #@+ q   2  > #`e> #@+za  * *`@ *   >   *  **` @  ? > ` >  * > !@a`> a > !@!   * @(!  `      `> @#k#> !@#g $ a $a  6  ( )* @4  0 -  @ A* @4 0 H 4$  X Y* @4 D h i*  j* k*`@  $  l m* n* o *`@  $  p q* r* s *`@  $  t u*` 4  v w*` 4  x,  y,  c`2  `"  a 2`  b*` d e* f*`@  g*   "  *  * *`@  $   * *  *`@  $   * *  *`@  $   *` 4   *` 4  ,  ,  `  `"  2`  *`  * *`@  *   "  ҉  >  *  * *c @ " $!  *` •*  ×*c @ @ $! , H  , I , J , L , N ^, M   * *  *  @$ , Oy  a?$a `" > @"f# `> @"`#> !@"\  8> "> "> !Ħ '` B  : ϲ > "!h`ɀ  " `B < " `B < `,` ` *   @( @xڐ 2  `B <  (`B :(   0`B :0 > 'c@)  "` >S#,  €` @|̖ @`@  * *`@ *   H /`4J* !J  >  Lr*? 1r`@ `O`z,`O 0!   H 0="m? mc`@ `O`z,`O H 0 ,"`*@|j ߔᨑH /` * ! ` 2@> !)> 퀢  x    ꀢ  耢   !x`(`X@) `X`B  <`Xq`  ՠ H 0ʀ ,"`*@| ᨑH /` * ! `@> ! 퀢    x   !x`> @(̐ PX   *` * * @ u' 2 `I` "^ X`B X=X w ` x  ` ( hw  h i* j*  *`@ k` " $ `f  @D`$` l m*` n* o*  @$` p q* r* s *  @$` t u* @4` v w* @4` x,` y,` c  ``5 a 2`` b*` d e* f*  g*`@` "    *  **  `@ " 4  ` x@( `  @8 -!x`> >   > ` @@(`X`B =X 2 " 2 `O@  `O @   E` h i*` j* k*  @$` l m* n* o *  @$` p q* r* s *  @$` t u* @4` v w* @4` x,` y,` c 2 ``" a 2`` b*` d e* f*  g*`@` " *` * *  @$` * *  *  @$` * *  *  @$` * @4` * @4` ,` ,` 2 ``" 2`` *` * *  *`@` " > *` ‘*  Õ*#@ @ $a ,`N 2v 퀦" @ WH 0 ,"`*@z[ ДᨑH /` * ! `&@> ! 8  *` * * @ tN' 2 `O X`B = X`xF,`O H 0Ȁ ,*"`*@z  H /` * ! ` J@> ! P    @  !x`> @&ɐ X ܐ H I*` J* K* @ s' 2 `I@+ Z X`B =X 7 `  ` ( `7  ` @( 0  *  **  `@ "     0 1*  2** 3 `@ " 4  ` @( `  @@8 %!x`> @!`@&YX`B =X" `O" " `O@X `O  @;  (`  *` * *  @$`  * *  *  @$`  * *  *  @$`  * @4`  * @4` ,` !,` 2 0``" 0 2`` *` * *  *`@` " 0 1*` 2* 3*  @$` 4 5* 6* 7 *  @$` 8 9* :* ; *  @$` < =* @4` > ?* @4` @,` A,` + 2 L``" L ) 2`` **` , -* .*  /*`@` " L> M*` N*  O*#@ @ $a P,`N X2"" @H 0O `,@x ᨑH /` * ! `&@> ! {  *` * * @ r' 2 `O X`B = X`v,`O H 0 `,@xZ ϔᨑH /`4"* !"  @4`K@> !2   * *`@ *  '@> #"%">  D%"!x"`%"> @$!H@. > !@ސ"P r' 2 `OX`B  =X 2  @֔  " @H 0 " ` @w W`@    0> ""h@%T@!x`u> @$!pr > *  *`@*  # "" "h%"@%"> ( > b|?"b|!x N"(> @$!J !x`D> @$v!A ,`*@w 8`B 5:8H /` `H 0" H 0 * ! `@@ 0H 0 "@pU" > @?"㿘@pH h> c> " a'@"* @" T @" T6  !@" T@N +0!@/ $␀ " ? @6 T6 T!3((&H /f * '  \ :@@ H 0 В @!xaĀ``(@& b'b ʐ'䀢   @!!b ڰz  Ұ 2$b8 $b䀢 ǰ $bOЀ 'b $ađH /f * ' @ob$b$bH 0 ?* 2`4@ $@1  H /f * '  \`\@ aĀ g \@ g8`\@Y`\@$a  ?* 2`4@Ԝ $aĀ`,8b 2(aR`T @2 '$ađH 0T 1a@Ր̀  $$ađH 0E 7  4a,$,aĀ > b8 @*> > (#$b> b| "b|> #`"(> @""> !ē*@ @ېbh @d  H 0  @H 0   > @"0㿘!Ā " \*@# &" &""*`" *  & \㿘H /f * ' > "@I  > 6 `` $ 2` & 6 && & & H 0 `t  x$t >S#, € ,*` * " *     $*` *`" *  `(2 H /f * ' > #@ & $H 0 $ (  & 6 & 0& (& ,& <& 8  2  @n t `&$t( ܐ"@&   & & &  ,, ,  , > # 0   &> !@80> !@ 㿘> "" < `   Ā  8 @   g @n$b$ \ H /f4* '  #  $H 0?   `@͐   $H 0)  1> ,/> ` (,`1> %/>  !   @  2  *  *`@*  ` "ޢ    #`&a `$ # #  @!,Ƀ ``2`2`2`,`,`,`,``@$0 ` `s `* 2 2 ,`(,`)` `0i `0* 2 2 ,`@,`A`4`H_ `D* 2 2 ,`X,`Y`В`U a$ 222,`,`,`,``2`2`2`,`,`,`,``222,`,`,`,``2`2`2`,`,`,`,``222,`,`,`,`a2`2`2`,`,`,`,`a222,`,`,`,`a2`2`2`,`,`,`,`a 222,`,`,`,``Ā 2 "$    ,`,`,` ,`2 2 2 ,`,`,`,``Ȁ 2 "$    ,`,`,` ,`2 2 2 ,`,`,`,``H,``I,``J,``L,``M,``N,` ` ,``2 2 2 ,`i,`j,`k,`h`2`2`2`,`l,`n,`o,`m`222,`q,`p,`r,`s`* 2 2 ,`u,`t`*`2`2`,`v,`w`,`x`,`y`    ,`a,``` ,`b` 2`2`2`,`d,`e,`f,`g,`c`2 2 2 ,`,`,`,``2`2`2`,`,`,`,``222,`,`,`,``* 2 2 ,`,``*`2`2`,`,``,``,``    ,`,`` ,`` 2`2`2`,`,`,`,`,`a",`,`,` ,`Ó2 2 2 ,`,`,`,`Ā   ``    { 2c  $H 0   "I `  ` *` * " *   Q`, Q  X *  X""  X$@ `2 2 2 , H, I, J, K`N``, P ` `+  `—* `Ñ*  3 3 3 , M, L, N, OԐ  (`Д    ""  $ @_* `2 2 2 , , , , @ `  ` @H 0㿘> ""    Δ" $"   ` `@~ " $"7  `""@$""  "" ` ,`" $"@ e  H I* J* K *  @2`2`2`.` .`.` .` `"@@B㿘> "H /f4"* '"  @+ k"  $"H 0 ` 6  "`"` "6 6 ***`* @!Δ @H p@㿘H o*@ g@ H 0㿘H o*@ g@ H 0㿘" > @ΐ> "(`$  " &"` >  "`"` > "2`2`2`*****c""@ 2`2`2`***@*㿘 H /f4"* '"  @" ""P O 2 N 8  !"@ k ` 2">  D"@ "2 O  " &"&"@w&"> #` > @L"@"@7 &"" @OH 0㿘" ` )&"> !ē*"h@@ H /f * '    > #`> @"`0@ H 00> (&" &"> b|?"b|> # "(> @"@"h㿘@" " 2 < &"`&" @2" @j"&"&"@㿘@"8" 2 <  &" &"@@㿀> "!' 2 `"8 @```'`8# ```$"   `ܐ"   "  `  &`&`  @i ` ` `` &`2 `> p`B A:p<* @ *@@ $ , `@4 4   4 ,  , @4 $ "8 @2"`"6`"> $ "a&" `!Ȓ`B < `   @  b x`B < x@iSb > @=" 㿐 * *`@  *  22 `2 (+`@ +    .. . .    2>   * *`@  *  222. . . . H /`4'* !'  * * *    ,@;ؐ !  !*  (*` )@ *+  "* $  %+ &  +*  #(+` @ '*   02 2 02  02`2`2` `  `. $-`, . #. (. ). *. +. %. &. '+. . !. "ad     -* ` *  .*  *`@ `` 2 `(  H 0 *>  !*  "* #*`@  ad ( )*` ** $  %+` &+  +* '@  *   @8`H 0 0> #`> @2"> X`B :X㿘> "" <` Ā 8 @   @h7$$H /f4* '   P  $H 0Ѱ    " :  $H 0 W  T! !@9`M @I`  2  * *`@ *  222, , , ,   * * *   ,@9Ɛ2  `- ,`-  2 0  * *`@ *  222, , , ,  0`  & `24!d 0`0$ 0# # @(, `2`2`2`,@,`!,`,`  ``2! ` ` * ` *`@ ` *  222,`,` ,` ,` !,`,!d222,`",`#,` ,`! 2`2 2 2 2`2`,`(,`),`*,`$,`%,`&,`',`+  `  `- ZH 0㿘> "",> @#Ȓ 2> > "#"㿘$( @b f @$(@ym &#>  @9 (!?>h>l>l>l !"b%Ԇ   2& \6 T. X. Z&!&!& & &#&#&!&! &!> ܐbH  bH >j.# b.# .# .#.#.#@$@ @ @ < 3@, H /f * ' > ,,`&#Ԑ#"c&#",H 0  㿘H /f * ' #Ԁ`#"c##"@$H 0@@1# "#@ҍ #쀢 "#@҇ # "@ҁ @~  > , " #2 ##ꀠ2##܀  2# 㿐!> ", 1`/ \ ", #  #Ԁ # 2#Ԁ 2#> @/#   >  (@&#P  #܀>  (@# 㿘> #d`> c@|l > ",`N%> '> ϑH /f * ' ` ` $""`?"H 0 `!> @ 0ݑH /f * ' #` #` $""`?"H 0 `"c@ 0݀`㿐   @h  } `"@    > @#0p @l– 2 > @#d  @@>  @ 0Y ` *   *`   > "@~ P0G# @h# `   @l 2 > ` `(> #@b + @  * @ @   * @   a"`b`g 0?5> ba 07/b0 021 `@lS 2 >  $  ֐ `@l= 2 >    @!> !(> !8  > !H`,4  `@l ` @``(> !`> !P4 @0` ` q   e  `0N a`0`2 c> ",`> @Ő!h0 > !@`(0"c "@Ò  @  x$c$cd4c4c @4c $c$d@V " d`T > !@`(d> ǒ`*`% @v0P`Nd@4c`T > !@y`( $c@3Yd c@0;:@d`T > "@e`($c> "H"H,c ,c ,c ,c ,c c ,c@` $cc$c4c$d @$d$0 `( > >   @?0> #> "8 @7@dY㿘> ",`   > > > "hbx@"c 0@d@㿘    > > > "hbx@o"@f `> @"0;  @f  2 > @#00  `> @#@0&  #  *  z   * `<@ @'@f~   & `h`$`h@0@cx> #ܢ b'2T@cߐ<  A A"#@cא4 2  ??耢/" d" c#2 #2#2 T 2@#`#> ##x#\@ (`? @6` p#ܔ& p  b > @#㿘> !an#쀦@   a@a@0 !p@m1!o@K@!b N " #@ $# #  @P  $#@!  @͆ @$##쀢 " @6  $#@k!, @l Z @$##܀``(@۔ #.#` @Ҕ"#. #쀢` @ɔ": . 7 # &#&$&$&$ & $$)&$ !#  @$$#$$$$> "H"H,# ,# ,# ,# ,# ,#% @"㿘H /f * ' > "@ S  > 4 `` $ 2` $ 4 $$ $ $ H 0 | (s H /f * ' > #@ % $ $H 0 $ #>  ( $ 4 $ 0$ ($ ,$ <$ 8  2K H /f * ' T > ؗ* ?2  `@k   "$ 8@  <"`< < 8"`8" ( $@vc   $ 0 , @9 4 ?# @4 $ 0@aH 0 $  $ $ $ 㿘# ` > @z##쀢  @J # @B`@=` 2 g 7 ,  , , , ` `:*@*$@*@  , ,#쀢`  : ** $ * #ٔ, , #  ,  ,  : ** $ * # ,  , ,  ,# ,#, #, #, 㿘 T > #@ (# L  "$00!> ǒ`*`!  H /f* ' $  &$ T@ @H 00}*`" * <  $$ T?`&$> #@> ($@*H 00aH /f * ' $  0&$> H .#H .# .# .# .# &#.#&$ " $ T >  @ ($> ǒ`*` @$H 00#@ " $$ T?`&$> !@ ($> ǒ`*`{ @̐$H 00@5㿘# * H /f * '  &#&$  >  T >   (@> !ē*$@@ H 0㿘H /f4#* '#    T >  @@ (#ܔ#@#&#> "H"H.# .# .# .# .# # .#@ &##&#@6#H 0㿘>  (@] X #&#€> "H"H.# .# .# .# .# &#.#㿘#  j #쀢  @ # `@w` 2U 7 ,  , , , 4`, ,  , ,#쀢`  4, , #!, , #  ,  ,# 2 ,# , ###  ,  , ,  ,# ,#, #, #, 㿀> "'  2`0 7 *  * 6`* * * *  ??"/ c2 /*****`? @3`   " > @ 㿘# 㿘#  > aĔ $ 2@&#@j㿘@( e# \@0]`  `' 8# `  $"    ܐ"   "    $ $  @_        $ 2  t & t * *# 2`*# * 4`* * < @gQ@ 2 㿘@А   `a"a " " " " (" ," 0\" 4`" 8    "  "  " " " " (" ," 0" 4" 8 㿘   > 2< H /f     ! * '   2 0@^Ԑ ` ` && "` ?& `  4`& & H 0 㿘  6H /f     ! * '   2 0@^ ` ` && "` ?& `  ?& H 0 㿘>  @M> @ 㿘``< ( "?`  4;`  8+ @    d 4 2   (  @h   B<    4  2 <   @(<  < <   4 `,   8`0& `,€`@ `  $@$`& `?$`  `2 $ (   @ c < $ (㿘#> ` 2 @@>` 2@> @ΐ X  2  0 < 2& <O 5 @ E @j 0@2 `   @ <`   <  ?  ? @< ?<   @ < < $ ( < & <@ɛ  #> c䀢  > Ϡ# `>nb@e @g $c 㿘 H /f4> * '>   !4 "  ! ` 䀢`" @  2!4H 0`> Ϡ# `>nb@) @+ 0> "#㿘 < > &`&@  2`* @ *`@l&@ &` 㿘 ` ``  `  0 @u0@0@ 㿘@Ɛ  (   "$ !  H /f4!* '!  W  H 0㿘N $ !> @D0" 2  @/ 2 > @1   0  0 @F0@0@ ِ㿘N $ " @20   0  0 @G0@0@ 㿘 `` `   @G@@ 㿘 `` `   @ɞ@@ 㿘     @מ@@ `! `29 `    * : "`  `02   ` @ `*  `(( `0 0 ``` Y `    * :  @"`" `@08 ` 0?` 8 (  ::8 2` *`` *  (( 2  *(000****㿈> !> А> "0@o"> "`㿐> "0`> @ ! @: 0(@(b2*@ *@ b 2`* @ *`B*2*;@ C0((㿘 x @ū ^ @  x $ 0 $ ("$ $ `2$ >  $ 2$ >  $ 2$ >  $ `$ # $$ 2 @ "@ 1!+ @4  $    <>    * $ > !0@ $     *  * *`" $ $ *  @[$ $$ 8@)ܐ㿘@ 8@   (:"@ H:` P:` X:` `:`  h"`( l"`, p"`0㿐 0 # (@)& 0 <"@<* "@ *`"  @*  " * @ $ ?`$ `@t 8Q< `  * <  ,"  & ( )& ,` $&& 4 & 4   $  & 4& , $@U: `  @\ "   p& , & p & 4````@6 ``@`"`&"``&@ &```2 h l & l & h X`B > X ` ; @ B > `& ,@Zt? H`B > H P @ ; B > P 㿘ג&@`$ @@ 㿘f "h   2` \   T   * @: H  $ 0B@ @2  : `6 ?# ` * @ *  ; @;  8 3` +`"  * *`@ *   2`  @222+ ++ +  㿘@`  ` "&@"`` ?&`" 2 "00   "0@(< 㿘>     "  2   @  > @ !` $$ @ 7 ` $$ $ ?$`@ ߑ* $    ?: &  2`,$ `` 㿘 ? & > `2 "`@ 2@"@@X  㿘`@ `1`  @,`А: .@``, 㿘@ɐ$  @""@`$̀@"&$$Ȁ@"&$ȁ `  `(   (  ( 㿘    @ " @  $@$̀"&$$Ȁ"&$Ȥ`  㿘` @ 㿘`&`> `> `> `> `& (`& ,`& 0`& 4` & `& 8`(& <`,& @`0& D@`& H`& L`& P@`& T`$& X@ & \@ ``\ `㿐@[ "&     H /f * '  >t>u>s㌘ ap#\#`y H p@㿘@/ 2a  %  @¯ "  @ %%@  & `$$$ 㿘  2&  N$Ȁ`"$$̀`@E  㿀 "  | 7 ,`    a``,``2`a"{  L  T D `   @@@> ! `> !@ [  < @"4`" |L @"G 2E ̀ <?  <  2 L >u#h #\ #`#d N @ >{ Nl#\ #p #` #d #h #l@ޒ2 | ,` ""$  <  "$Ȱ 㿘  "#  || "  @ $ @% * @ 2"@ $̀"$$$Ȁ"$$Ȱ 㾐`   Q |  !2! !& 㿘`   $> `(@ E!@Wg. 7cϐ " $ % 2 `$Ȁ 2& `@WT 7`@ 2   `$  $ `C <`B> >  7㿘 $@ϐ  ` $ @& 㿘    $ 䀢`   T$@㿘  , @  @ , $  2& 㿘 p 2  ؒ @ @t ؐ`@q   @  $@@Ò  @c \ $`L沒$`P$`$`"$`@@ $`<@$`$` $`8$`"@d"` @"1$`d & :  $`,$`,`&2  $`($`(`(h$`$2  $`0$`0 )$`T    2l @ L#而 @ @@`*"  d@Ñ*   $`\@" H /f * ' . ` @ $`H H H H 2 H& H"@$`H`P `@'`<$`D'`@@`  ``` "`@ @S"H 0㿘  H /f * ' 沒@ ߐ"& & 8& "`2  & ,& ,2  & ( & ( (& $2  & 0 & 0     *  "@ @ # H 0 㿘   ,  `  %@W @%@     $ @  $  H 2 ړ, `*`    P"       @2 "  4D2 `"  P 2 @㿘`4 @`H /f * ' @T`P @ `D  "@`P "`<2  @ `D`P"`@"D&`D `D`@`* `" `H@ `H`H`H2`H"`H`*  @2 `H# #   `*` ` "@ # `*@ 9#@ `PH 0`\ @ ` @@ @ 㿀h@! $4  \4  `&` &`&`&`&`&` &`m@ #* f&`&%b  & : &` &``ؠ`܆`Ԅ`````@`   "" " " "  &`&`  " " "  \>{#``d#d#hH#\#l#p  &`> @"0" 㿐`   @#``? 쀣 + l  p   4  L 4$  L  "  쀣6l& $ p 6L 4L$ @ `, @@  "@   @  @/?㿘  ,`"@ 2 H  , & 㿘 "- @l &( `p@6    2@4   8     ے "  D  㿘 ``ԑ* "@ PK 4  l@ &D ` p@ $= @ & l7& 4. @!  `쀢@ "# |$,@" # |` #  T€  l  & L` p@ $ L ``* "@ 㿐@"s       l  "c&   ԑ* &  "@ @   6  `8  `4 @$  `"$  l m  ` 8`6  * %2$  L 2$  HՀ`2Ϣ Ǧ`"     쀢 6  &  `& 쀥`R   *  L% L & 쀦B@ 2> @"( `2 , @@ ?"@  `$ `"@$  @2    H* " * "@  ؑ* "  `*`"  * " "   @r & `&@͐& 㿐@!    K&   ԑ* &  "@ @     `" H l 2 -`2 H L 2 H2ߨ?`"     쀢 6  &  `& 쀥`>   *  L&@ L & 쀦.@P 2> @ݐ"@` , @@?"@ H "@  ؑ* "  *`"  * " "   @ & `&@?& 㿘 @&   g㿘  ؑ* @`  `` <B`C <`<` ,  ,   < <  <     = 4;    "@2 А"@@А"@@ @ 6И"?@ . ?/!  @ @$& И"?@ &   ?/!  `& & Ж"?@& @   ?/!  @ @& & `sд"@? `x `t " 2  $``($`$`.<< `$@<@ ; $$ $`$`,6+ $`$+ # : @@ $`l?/!?@@ $`l`$`p $``( @4`4$`$ $`l@瀐`$`4`@" `̐ $` $`t `P$`x  $`h`` <B`C <`<``P`2  *   쀢  @ `l  p  6 & 쀢 4&   * ' *`%   @ & &㿘 @ΐ ` @ * "㿘   `@@Q `2`  "$"`  ?$ "` *`@ ?$@ 㿘 И &  p  l |@ " ``2 А"@@А"@@ 4 7 " 0 0 h> ǖ"  pВ@ "?@  @ ?/! l @ @& l& p Ȕ  ԑ* `@& 4& @0 l   >{b@u@w㿘 H /f4 4* ' 4  & l& 4@Ѐ`@H 0㿘> @ϐ"X㿘` 2 d `z \  `Q `"`&`"` & &  㿘`2`  "&"`  ?& "`@PI 㿘` 2@[ \2  ""@"` ?"`" 㿐@ "&     H /f * '  >>>}"`#\#` H p@㿘@ 2a  !$  @ @r!$@ $! & `$  @  㿘  "  & @~ @$ @! @ ` `">  D  T` 2 D  D@  ".  |`( @  2#  | $#\#` ' ' ' ' ' ' ' ' N'@o؀   㿘  "  @  |  @;   @  |  !`@ K ! !& 㿘 @$ "  ` @    ` 㿘` @ 㿘  "   `@.@ 2    2& 㿘\ ?i`! @: b@!  @1 -& @ @ &&!`" 2  "   "`  " m& ` ` 88 8   4" $\ 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @`    @ `*"  d@ϑ*   &   "` `!@  `  0@ & @j     @      @ۚ     0@ |& @I !(   @ "   " 0@f b& @/ !h   @ &&  $& & H /f * '  $? $*@  "   2 $?* 2" @ H 0 !2$ 2  $`2`' ` 2`"`H 0 0.! " @ "    `2   " @  " @  " @   "@ @  㿘 "z   t H /f * '   `" @ " @2`  " "` 2`  `  # ?* @ "@  !"!H 0@a! "    `2 5  `""` ` ""`  " @(  " @"  " @  @ @   2    " 㿘`   $> `(@"p0Yw " `  @t "`   " `` 2$ $@L$ 7`@  !!`C <`B @ɐ" "`?$`К` C :`B<<А@Ж"0@B<0`  @   `@0@0@㿘  2  $  < & @L1?  $   `"`&`"` & &  㿘 ` 2@. 2  ""@"` ?"`"  㿘  `4 `B >!`! ; @ B >!@K  ?" `?" `2`  """` ?""`2!ؐ  @+ @㿘 @ @n! &!㿘 @㿘   @ 0 >   >  > >!  >!  >! >! >! @8 4 $ 8 4  >!>! 4 @ 0 0>`@ C > @  @ > 8@㿘 4 @ 0 0>`@ C > @  @ > 8@Ґ㿘 0@ >`C  @ѐ > 8㿘      ` !```?&!`"{ X ! `"   p t@ H p@B* 2` 2 !!@2 > H H8 > H!( L@ > H!(  !(@B:2 > H:` : p  H > B   (@Y!(2 !!,2 !!( @ b >!(> !    &!> xa&!a &!@> P !h   (@) (@C ,> X> ` X h@8  X2 h \ l@( h X P2  T"  @> P   b`㿘    `?  ( >` B > (!   ?`?&! " ,  H 8  H  L  H:@@j b !(@ (  x@ b @ B  > Hp H@8  t L@   Hp x@ b B> xp> H@ !!h ,@ ( `> Ж B > X Xf8  X2 X \(  X X f `@ B B > `> X X h@8  X2 h \ l@( h X P2  T"  @ > P   2t (!  : h??PT  8P2Ḁ (PḀ2P: h㿘  @ "" 㿘@ a  ""@ @ 2" DD8a "a "a  a  a   @  2! DD( !!""! "!Ā 2 @! ! ! !!ā `X@`@ @PD`DK  @ 8a2 DD8a #  " "   & `#  `@  2a`DD(a " "a""a "aĀ`2`@    @ ` D `"`8 88 2!`< <(!! 㿘  @+ "" 㿘@   "H H 2 LL8"!"!     H  2! LL( !!""! "! 2 Ha"`a a" aa `XH`HS 2`LLK! H 8a2 LL8a"a "!"! ( `%  `H  2a`LL(a"!  "a""a "a`2`H!   P 8 !  T ! 2 P 㿘>   2`* @ *`@E* 2`  㿘. 6` .`@b2`* @ *`B2*> ` * @Y  㿘  (0 (2`*  >  2  @C >@2?? 3`+ @+` 2*@ * @. >`   @  @!# , 4`@@4   >`@ ? c @ے @ * 2` @ 2 E>`   + 3` +`* 2` 2    @ >`   ?? 3`+ @+` 2*@ * @ݖ >`(:: @: `: `: `: (` : 0`(: 8㿘 2 (q(  B : 2(@ 6@(,@@ @ YB c   ?,4 ??4 @4 @[  @T * 2`  2 @ D@0B@c@b8   ?,4 ??4 @4   @/  @( * 2`  2 @ D @ B @ F 㿘 2Z  @8T    B & @@ !@c, 4`@ 4   @ ? c @ @ * 2`@ 2  @ E @ &B @c@d, 4` 0@4 @Ж ? c @ƒ @ * 2`@ 2 @  (E  @ B @F㿘@` @``$@p 2> @k> h> _@]` F  r  `@ G 8@2>@  @>> `> `B> (d4, @,`   @b     B 2 ,( , @ @b D,4@4  @J ? c @@ * 2` @ 2 D> (>> > 㿘@&`& ` "& & `& ` & & & ` "& & `& ` & & & ` "& & `& $` & (& $& (`(> 0`0> 8`8> @`@> H`H> P`P> X`> `a& a& a& `> h`> p`X> x`h> `p> ``> `x> > > & ` & ` & a> a> a> a> a& `` & `` ` ꅒ `  `?(    (   ?( 㿐@ "&     H /f * '  >>>\ Db#\#`2 H p@㿘@ 2a   T  @h "  @Ē T & `?$ $ $  㿘  "  & @^@   㿘  "!  L 8  |*   @2  @ 2   | L  N@q T 2 㿘  "  @ |  @#㾸峒  @n |   @E  & 㿘   , @ " @  ,  㿘` @ 㿘  4  , @"   `" @   ,    2& 㿘.`` # @H /f * '   `@H 0  `.`M .` @ @ @  @ w& @ .`` "@$`" 2  "` "  "`& & ` @4$` &n&   `4"` $\ 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @  /  @6 `*"  d@.*  f &   "`  `"   2 轐   "@ @  㿘H /f * '   `" @   * "  @ *` * @"# ?# H 0    `p  @p @m  㿘`  ` `$> `(@Q"@Cs+ 7Oې "   @ 2 `  2& @C` 7`@U 2 0`   $` 8`C < B> 8> 0 7㿘` ` 7 @|3 / * "&  ` `@L `?$` ` 2   $  `B <   ( @ ; B < (ד* 㿘  2     & @B?  Δ  `"`&`"` & &  㿘 ` 2@ 2  ""@"` ?"`"  㿘  `$ `B > 0` 8 @ ; B > 8@B  `2`  """` ?""`2 0㿘@&` & ` & `& ` > `(> `0> `8> (` & 0` ``b 8`2  &  ( " ( 㿐@#.`? ?*@   .   ` 2 㿐  + >@ 㿘> ` ">  "``> !$>  "`@" > "  㿘@8 > @А"0 > > @ǐ#0 ` """ """"` 㿘> Т @ @֒ "  2  $@ > @# 0Ő㿘>  " @ "  2  2 㿘@㿘> `$  >   #$t@    L $   e`   $$㿘> `$  >  "$`$@   K   $`$㿘P    & & & && & $t / 0> @-# 㿘  # G㿘!>  > > @#00!@#H > #h%>#> @C "> > #x# @  @ux@c  㿘@+6㿘" @!㿘  > t@"  t`   > t㿘@ 6 @ @ "  JK2 ` 2"  `@2@㿘  !> @#@ ِ   2> "'@   > !,'l'p'tv/x    @6 "> X#`t#> %> !> `t  t EC#`@  f`t `Ft@ @  > '#> `x@ x0@  /x@(p p> > "a$"0 > !0 'p@ @l t> #@@ 2"@ } ?'lt `t@t "& pxlt a>  (`> !(> !,>  "a0N@ e"> !0> "a," > @#㿘N> f`?@> x㿘> @ǐ#㿘N> f`?@>Fx㿘N> f`?@>ux㿘>  p`> > @ 0@ 㿘@㿘>@흔x㿘`> #>@x㿘>@VY x> Ё 㿘> !㿈> a8> a0'> > > "a,#!("4#a8> a4 )> '> %> #> !> @  "$L@Y!$L@V@cȒ!> !4`> "!8㿘 > @B!@> a8P@3Ā  > )!@Ā (@&Ȁ   > @  `@ ` @@  > #"> " @ @pC`  ȑ,``` "@#\#`#d#h؟Āܒ> @"8㿘@XD㿘@X@!㿘@X<!㿘@X8 㿘@X4 㿘@X0 㿘>  H' a@! 4   @ H`  @8`L "H@ H` @  @  㿘>@0 x㿘`> "P> b@      ` "`> t" > o"`2 ` * @ *  `0@9@   2 `",`0 @ * @*`   @  > "@˒ 2  @ > "@ 2`0  @@ `0̰ ( `> `> " @@`@*@@ ?&`> " @(  > "> #@ 㿘   2 *  *   0@ )>   2  * @*` `"@` 2 0 `@ ( 㿘    @   *   9 "2  @ -"@ '  02  0  2  "  02   0"   * 2""㿘 r 2@&@&`&  㿘 [  1/ '> #H*  ``" *`  +*H` `  / *H*H*H &*H*HH@  @ *@@@@@@@@@@@@@@@@@@@@@@@@>=?T>@@@=?@@=@@? @=>?@>@@>P@>@ApA@@ApApApApApApApApApApA$ApAp@ApApAApAp@Ap@㿘J@ !> А#@* x" #@㿘 > L@  `@  > @ 2x> @#@> "a(`1`>#ȓ*` €        > #H@`u  > #X@t`h  > #`@g`[  > #h@tZ`N  > #p@gM`A  > #x@Z@`4  > #@M3` '  ^ > @?#%`> @:# ` ` ^8> > @/#@+#   0   @E`@\ "L@@ZL@M6C> "!,㿘N > * ( (?* : `8*`>  €>x@ h -> > #> #> #@  > > #> #@ْ > > #@Ғ >   ^8> > @Ȑ#> @Đ#> @#ȁ㿘> @ 1x> @﶐#@@ܒ    (+  2 2 " 2+J " ?㿈@ # @ !> > =#> c@ >  c@ >    @c >  @@` > #@X >  @Q ?'@  @F쀢  >  @G@Ğ0@?'{@㿘!>   ?> "!(  2$!,㿘@  >  @m < > 3 0 > ! > !0 >  !( > !, > !$ $ @ @ @ >  H@X >  H @K 㿘@I   2>  H  $ 2> v H  $ @#㿐Ӑ / 0=  > X H   > L X  @'@0 '@?)'@? π ̀ @ݐ $@㿐 % @? !>     H  " @'? @ $@㿐Ґ , @?  #> !> Đ ߐ`H  ِ h * 2 @'? @~ $㿘̐L@KRMhLL RM<RQ@MRQ@ORN RPRMMRLRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRM<㿘 N@)  ` "@$`> ` `*`: @).@ `"@*@ې `  ֒"@  "$ 㿘!> %>   #> Ӑ"  `ΐ"`$$ 㿘`~> p*` €1> >   䀢@ ( @)  ?& 1> >  `耢:ܰ @)xJ  & > >  쀢 ͪ @)i  `? & ð > >  耢   @)VJ@    &  > >  쀢  J   o `쀢@ J  0> > `쀢 \  > > `耢 0>  > `耢|" I y k 0u>  1>  ` m J * @)*@)  @)J @(J^ > 4> !@@  "4#> `0 $ 4>  0'> ѐ8@%> +> )> 1> `4  ? $ 4$ 4 4J``4* 48@`0!?` @$ 4$ 4`$v% !?` @$ 4`$ 4` 4% J`e ``*@0`#`J  S > >  4 8@  J@ >  0> a?  `4  "4# 4 4 " 4J 4 48> 0> !?@  $ 4 $ 4+>  48)> `%> % J`  `*@0`#`J   $` d"@ >  ^ 1> >   耢@( U"@>   ["  > >  4 <+> )> 4'> ` 耣@  K`"KK@@2K>  0> a@    " `@" KK"KK@" K ` 耣@  8`$ 4+@% Y ` 耢 8 #<> !@> ф 8 *0  # 8$8 88* $88  $ 4* 0% > >   @'Ő % ^ >    * 8 * `$@'%  "@  ƒ"  㿘@IJ> > > >   " "`""@' @  * `"@㿘@  0Ȑ @    ?ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ<Z,Z Z4ZZZZZYYZ$YYYZZZZZZZZZZZZZDYZd㿘!> !x x !x > > "!p" > x> > p" > @ >  @> p@?J@`"> с @> с D㿘> `D "`D@ 㿘> > " @"`D㿘0? ?߀ ] ?Ѐ ` 0 >  ` O o T  t X   x>   `> "! $ /  9 7 0 ?Ѐ ? ?  ?Ѐ ` @?4ޢ??Ѐ  ? ?  _> ǐ x ?  ?  _ \C > \  S ?2,>  ,> !p %> #> B? ?  ?Ѐ  _ \ :2, \2 ,, ?2,, |`0,H `??*`>  €> <   .4 0 . , * ( & $ "       <   >  > @z ?㿘> > P `H@ >  T@ߐ@H @@$@% @% `H@> H$P㿘> J` `#>  %> L@% L @% c"$`L q `L ?`L?$`L$`L $`LL  L@% L ϐ 㿘>  X` >  L ??߀ ] !> @%b>  H> \`" H@ `H@%S > `L$ P "`L$`H`H($ P @%F > L> ѐ > "L"H"`P0 !> #>  T`H@G{ T $`H > `H "`H@%$ > сH㿘>  \> H"@ > @谐!㿘>  `   > ! > !( >  !0> !8> !@> !H 6" @ϐ㿘!> #P  > @苐!P0> $#P@膐!x> > !@ > @{!$#P㿈> > !c 1#> @> @Ta@ @ 쀢> !Ā > 􀢀  > @=!`"> > @6!> @3! Ւ> (``m`㿘@#  " @ ? "  " &@8  >  `& & > &@"   &"$ > a? "a> "`> @!1> @!    "   㿘> "     "  > b #b" ` 9  $"9@>      Jp"  > > > > > > > "" 4#b"" #!㿘N> p`? 3> 5> 7> 9> >  #&b 4&& '!㿘N p`?3>  ;> > 5> 7> 9> > &b  4'a&& '!Jc>    > > > >   4"""b "㿘> !> (a> "> "@Y0`)> @> > !`!$@%"@    2> %"@;"H㿘> і d @   ``+``2`` > d+`` #`"`""@ "p@?㿘> Ѣ d  , @ " @k 2  > "@0 > ѐ d,  "  "  # " 㿐@7 > #X@* *`` :*  **`'􀢠#X㿘@4 2N    @(`?㿘@ 'D @D  㿘N  %> Ѫ dL : , ` ,`@`"`@ 2`` :`,> 5"ȰL 〢 :@6 > ѐ d,`@%>   @W `$`@  㿘@L`@諐L  2L@ 2L` F> > "@80"@4㿐N  %> Ѫ dL@ :`,@  , @`" @䑐 2   : ,@> Ȑ"ȰL@ 〢 :'', > Ѥ d$ @)> '>`" `@"@3`? 㿐> ! `  @; > Ѱ d    @Ð  ` `  㿐> ?> Ѧ  d '"b   @@:` %"`` &㿐 !> &@"@ "&@&8> !> b ' 8ה-> !Ā@ ) @ &> #ƀ   @   > ƀ#`b@  > # ƀb @   > ƀ#b > @`#0㿘> b@L㿘> b@U㿘> "   㿘> " €㿘> "   㿘> "  㿘> "` `@㿘> "   㿘> "㿐 ' > ( '> ( ` 4> "` > @䜐#@>  > > @䕐#X > > @䎐#p `@䊐# ``> "0>  p` "> > @x#> @u#> @r# ` 㿘 *> > > "aȀ  #> @ѐ`  *> > !c #> @⿐` &   *>  x 㿐̐ @  㿐'D @D  㿘  &@ 㿘  @"@ 㿐q >  x >  xc [ >  U >  ͒㿘> b ">  "bb >  X>  "b @Đ  > "  㿘 > > @㵐 0," @В "   2  >  2  > @㕐 0 @㒐 0 @$ $$ $ > $""㿘> " " "  8   @ $@0   2> @g 㿘!> " > > @\!0@Y! " > !@%> #>  Xa`  @F#  㿘v㿐/  lgq㿘㿘> b  > " > #L #> '  8  b` @  2 $> с 㿘> " $ > #L "   @: 8 8    @* 2` > "" 㿐N h  l  b>  !h> !h   m?'> %> 쌒>x > @⡐!x웒   2&> J!&$($,vvvvwww㿐`h ?`b>"X*` €> ѐS `> ѐM \> ѐG T> ѐA X!> #\'@ ; 8 #\> !d`- $#\* !> #`'@    #`> !d` $#`  > ѐ"@m -㿘> !`@@@㙒@#@#`㿘> J!`!> ! А  *`: ?Ѐ4 L@: @K L 2 ` * : ? 8*`N *`:  -@5 L  > @ʐ! a?N`_2 @&  z$?> @Ố!`> N"s'2 NЀ /> Ѷ /> Ѱd  `V  ???'Ġ  #> єd , `2  "8 w* `d)>'Ȓ dÔȐ' f'Ȑ d̀ J@ :`$J@   ?  $J 2  `a> `X "`XВN@ ?`#J  L@   @ * :  "`J@ 2 @ +* Đ" 'Đ _* Ā z`'> !> %> L@   + `  *`: ?+J 2  \X@$ \P b > @"  @*@`  `*``  @*@`  @ `*`*@`  @ `*`*@`  ` @*@*``㿘㿘ܔ@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*`*@*`@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*@*`@ * @*@*`*`*`㿘㿘Д<<$$$$<<DDDDDD`?X> > b '@v"x?>  ;>  7>  3>  /> $ 2(` '> ( 2,d > , > 0 > 8 > @ > D  > H > \ `> @4"&`4&`8&`4&`0 @@ > &`4@$""`h @@  @> &`4@""> ``&` &`  &` ?&` ?&a &a`&a &a  &a &a &a .`@&a@ @z@x@ǐ&a0&a8.a<&a@&at&a|.a&a&a'؀  > b@9Ā "؀  > b@.Ā " 'H€ > > Ѷ" b@'-> +> )> #!> a0#\@b#\at#@#܀ > b@Ā &a 'H€ " > @š#``""!  - 㿘 &!@ d@ `H /l * - !? &!> !> *`" (*! @ > #0@N H 0@D @A h>   @ 6 > !D>`  !D `@ 0 2` @k   @k   @k   @k  `> "'' @n  ' 4 H€ 0 İ?b > @ #P㿘\@K &`@C ~ ?  &@@ 6 ( @**@``$, @@' 2(`@ * %`*`$ ``4*" &``  &`(`@ *@`2( =.` ; &@@ 5( @**@``$, @@ 2(`@ * %`*`$ d``4*" &``  &`(`@ *@`2(㿈  >'''@Ӗ > @M#` 㿘` ">   ">  > "> >  "p#x#@۠#> @+# 㿘 0 4" T &@ L` @ &`   @] &` `   㿘 4 P  0` 0` @ 㿘> ѐb ?  2` b* @ "0 ! " 4*  2!%  ` `$!`  ``2  @@̒!? $!@ː!㿘     0    0 @@ 㿘> ѐ" ?   2`"* @ 2!(  "!#  ` `$!`  ``   !@ !? $!@s!㿘> ѐ" ?   2`"* @ 2!(  "!#  ` `$!`  ``   !@y !? $!@9!㿘> ѐ ?  2` * @ 2!*  "!%  ` `$!`  ``2  @I@,!? $!@!㿘> ѐ" ?   2`"* @ 2!$  "!  ` `$!`  ``@` !? $!@Ő!㿘> ѐ ?  2`  ⌑* @ "%?! "!? ` `$!` ?`` @m ?!? $!@!㿘 `$ @А @ɒ  ? & & &  . ;@& & & & (& 0. 8. 9. :㿘 4ِ h  =   t x 0" Ő &  "  = "     0"  `` ("`Ȅ8"``""``x"``t`l  "` t `< p `4€`0 h&`X&``&`d.`&`.`.`&a &a(&a, `<  .`< `<` .`<2a> ``&a&a &a &a&a&a`&`&`&` &`&a&aa > ` p> @ڼ#!   @ߐa'a 'a'a'`'`'p`'|`'t'x&`l&`@  2`4  `4 @`0&a,.`<.`=㿘H /l4 4* - 4 4  !, " 0 =  0€ H 0㿘H /l * -   4&!$`4 0€ H 0㿘M ߀   4 m 2.L`9`` `@Ր$`" @`:` H /l * - `$`$`@sH 0 ?L`9 > @#,`9`0 H /l4`0* -`0" > Ǥ d+> !Ĕ`*`" * > "p % d! @ !`% d `0 > ǑH 0㿘> Ѱ ". @ 4H /l * - ` 쀢 " !,  40,@". 0@ 0.  `&  퀢 "`N ܀ 2 4T 2  4``" 4@ 0 4 ,@ 0. `@ 02 <`  < = `. <. = 2 <`2 &!, < = `. <. =&!,& XH 0 㿘> " . @hL;  , v = s` H /l * - $"@  #> 6``> "p $` !  @ј `$`  )$"@ 倎H 0`*@9$@$$`  0H 0 #H 00H 00H 0 #H 00|` y wH /l * -  '!> 쀢 @ ̀Ҕ `> "p $` !  @W `$`   ު ,9H 0 ""@@& `*0@@@ %@ H /l * - $$,9H 0`  㿘H /l4 * - 쀢   `  `@r & ` 4 0@ 0.  퀢  d  d@b & d 4 ,@ 0. H 0㿘  4`!   h> "@@ #` ``2 ` ?€ 0$   >4(  U        ` *@`0`*@`4*@> "p'! Ĕ `  b @8 8@8&@`   b > @͐ 㿘> " . @L;  `    $ ,  =` `&`@ B >``23`(`. 8 ` <`B#&`>`("$(``2`Ͱ H 0Ű #H 00> @d 8,9 `  H /l * - $  !> Ӕ 0d> "p $d !  @Ԙ `$d  $  ,9H 0$"@  " @Ӂ@}@&`* @x` $@0 : H /l * - $$L:`$ @C% @>%  @k% "@ ,:,9 퀢  L8 @`H 0 `  R㿘> " . @  4@ )!@ " @ "V !@ 0@"  !@ " 8!"!@"!, @"`\  b}@"+ !@"`8!@ "!@ 00!@"b~@ٰ 0!@0"!@ 0΀ "$ X X "$ Xư  H /l * -  " =H 00  퀢  ` @k  =   쀢 `@:H 00&&H /l * -  &   l@ː" & t  |$ " &H 00dH /l * -    "@@   :  &   @֡" & $ &H 00=<&@7@42Z -``)@ 0% <&` € 0&`\@ 0  `<  0€ " $!,02 0@ 0&㿘` L @` ` d@ @&@@ X " @Y  @u0 㿘> Ѱ ". @ H /l * - `A = "  !$@`0 @` `  = 2  Ā@   @覒 L`@衒 @H 0㿘> " . @ 4\@ 0 "4?X "0? @  *?L ; 2 0 , ;   H /l4 * - 퀢  @4H 0 0X @㿐 4`d !#\`d> 0" t x l `(> 0 t@ l 2 .  㿐N ߀ 2  4  @6 4  ``  #\``> 0"    `$> 0 @ 2 .  㿘 <  4  @3   $  $ !@Ԑ (L ;@$ ( ` > $  0@0 "$ L 9 "  x, : @$@$!@ЮL 8 " 0 4 $ 4 $ 0!(@ &!( 耢 " @    " @   @ ( "@ * &    & &   @@ :  $  $@ +$  耢 ! @ @  #@@@  @  ( `@" * &  ˔  `& &  Ô ` 2 = $> 0 ⼟@ " =\ = "!,L 8 2 !,   4!,C !,  ` 9 㿘 < h R 4 @2    $  $  (L ; `$ (`d <> `( @ 003 L 8 ` $  4"   @ $ 4 $ &`dL 9 2 `d 0"   @ $ 0$ $ `d  `(>  0@  ``   "`2 ``+  "`` 2` "`` 2` "``>x(``"`  `   㿘  &`&`.` .`  4 @€ 0 2  :  &`.`  4@ 0 x> "'    } &  :  @"}{ & : @2` `2'g [ ,'`4 '`D`0€ R` H`$`4  @2  ?'ؒ ΀ 03 / `4 '`D`0€ (`  `$`4 "`? 'ؐe "` "` "@" > @{ h㿘 &` 4 D€ 0  ` &` &&` 4D 0 ` && h> @ "''Ѐ'`z ''͖ؐؔr` /' 4 '`D 0€ b`  \'ܖ`$`4  @2` ?'ؒЀ HР A 4 '`D 0€ 5`  '܀@ ''" , `$  `4 'ؐvȀ `Ȗ  ''` , ` @''@#'Ѐ  &.*`&@*. @& @"@. > @ xx> "'2@` 2@I F ` 'ؐ> 'ܰ  `$`0 2`@ 4'@ 0"` '܀`' `$ @@`'" 4 2 4  @€ 0 b@pb > @V x> @ b' ` 'ؒ  4' D؟€ 0 "` "  ```"@`"` ``@`" > @ @> `4 b`8' k ` ` '` '`'a'a'a'a 'a'a'a'a@'' `쀢? `' `8?"` ' ` ?" 'Ĩ  ?"`'`?"'Ȩ ?"`'`?"'̨ ?' I " A "  `   ''   `   ''Ԡ `?`2``   ,`= ,`= `=` a,  `,`=]\@`0 2 `=  ?''' '2 `=?'''' `= `0@ "  ''' ' ''''$a$a $a$a$a$a$`$`$`$`$a$a``l " `  `? `2``Mat c ? `2p>a0 T `?at`А D"?a0{ 3"`3 atj`3 "" 3 a0Y 3 "`p?"`0a `4`s '''/@؟€`0 "`0 ` "' 0,``0 2" 0 `퀢 2 0 `= " 0H /l * - H 0 " 0 ` "'`t,` 0 2"`t `쀢 2`t `= "`tH /l * - eH 0 "`t?`2`t`t    ޒ  ,`€`0$`$`l,``?" `=   `= "m``@`0 r"`"C`xH /l * -  )``l" `= `=   `퀢    `=    `쀢 H 0 /"`x? ` 8 ( `y> $``|  `?8`y1 $``x?2``|?  ```Đ" 4$`İ " > @ x> " 4`8' 2 u !0&@!&`8 &`!$ &`!$ &` !  $ !t$&`!@`k$!&``H ``3!"&`p 4  '''D؟€ 0 2&`p&`p &` $  ̐" &`(  "@$(! &`,$, .`0 ,0 Ԁ@ .`1 @ ,1,2.`2 <2  .`6 < `,6 .`7 ,7 &`  h$  &`t @i &`x @e &`| = &` > @   㿘 \  \2  &@ 0 2㿘 \   @ʒ  2 㿘> " . @֒ 㿘> " . @0!@ + 4 ! !@ "}@  0:@"0!@ 02    @  \" "$ \# `8&@`H`D€ 02`@ € 0  `` @ 0 > * R`   > ф"`8P> ф"`8D"` @N "*   @(. @!> *`$ h @  h#> `$a8 2> > @! h "a8@˒ a8 $@Œ 0 "" @da8@a> cT@: *  > !> "`>   a0#\ l@  l@Š  l@Ŷ$ > `h*> ␐" * '$` > $`@'H$``@̵ `  > @u!H `Ԓ *  @* `Ԗ*@ *`@$``Ժ   e   `@$@"H$  rΒ   @   tZ$@@t  $`h @tC  `  2  (@* @@+ `@(  O`Ѐ` @͎$ r:$$`IJ`$```H `Ԁ@  `@א5`Ѐ`  &!: @&  &`Ѐ`"`Ԁ " `@ `@ P `$`% ""`ԑ*`` * :$`Ԥ* @`*` *$ 2 %$`vM$`@1$`̐"%`Ѐ` %@ `@ > @ `@  (%@o`@m% `Ȱ  $`> " > @!h㿘 Ԓ ,*  @Ɛ@#&  Ѐ   Ԩ      @ $$ $ $   "@`` Ԩ @ a$     Ԓ * @ $  ԑ*`  *  @ " @:  *"<$  @Ǎ$$  آ *`  *   @ " *` *  *  *   ,`: " ` ؖ*`  * *$ u$ @Ԑ㿘? 2  > "2 D *" > `h* @ 9  Ȑ  ` *  ` @ ` Ȁ "  @6 ,` ` " |" x |$ |$ x | x $ @㿘?2  > "2 *( " > `h* @ " "  x  | | **@$ | **@$ x | x @ @$ 㿘 D? 2  @ 2`> *`h" * `Ȁ2  < 0  <(& 4& @& 00% # `  `@_  <& @H /d * % @H 00H /d * % @BܐH 0㿐 ̢ @`D ``T *`@`@  Ԓ  @S*  Ԡ@ǰ*``H` > #P "`< `<0#\@I)`0`\`t "`t@sO ̀`"$ 0@2 $  \t`"t@s? $<` @զ Ԁ #.`"  0\`t "`t@s"  Բ`* @ .`@ 㿈`а\'P'`'`  @      S& @`'@ߒ`` ` "$`$@ @@* @@ż@  -`0* @ '`<2  :  ` " sВ- @*` "$ * &> - @{ >  l@’  >  `@Ő- @" $$`0> @c8&0&X`,@ &,&T&D&<&\&p&t&&xP&H#> !> '> `d@`<  &H"Ē $"`dp @q H `d&'`̀ 2` /0@*l@n  >  `@p2`-@'@pɔ   $  $ D$ \$ p$ $ |&|<'$<!> #L  H* P@Z\@  8 * P $8*# *`"  $㿘> #d`> a@*Ґ `0("`<`<&`@`<`@`0" @ @A&㿘 t  x > #d`<> a@*  0(""  * @*`  " `>  !0($0 4`" > $4!> 4! @4  | &    F  " %/>   @ 3> 5> > #L `` H ?@YӔ*  @  `d@ HĀ `d@& <@7l |`"@@1l@("> @\!Ѐ $@f㿘?2  > іb2 > *h" * @`Ȁ >>=#, l @ 㿘?2  > іb2 > *h" * @`Ȁ >>=#, l @d  h? 2  > > b5  ' > - "h0* b@ - `Ȁ  e°  e`g@`f@  m@  "@  0"@؀ @   h@"Y`e r@ = e@H >   m@ >  e g@  f@E "@ }> 0"@w `Ȁ s @R o>  >  cL ''`'a @Ų:` " '  @}a*   @}[* mו* G#  @| " @6 .` ` @l@& )`` '''ؐB ! @>  .` ` @le@& > h'@* @@o @~Ȓ @~Œ @> > - !8@*` n” &!>  d`Ā`&耊 2`> `t P'#\И @ $ d`$`,@``| @ >  `*@  `x " ``| "`@  %> -  `  @l` @~k `Ԁ*`` `  ` @~[`` ` `@~R `@~O `Ƞ8,  ?@$``@~E 8 @~A8@nF @H/ /@e@Ӓ H 0] @< 2Y>  @ذ @LN> `n!G &`*`` >&@ ;> `Ȓ$`` @Z` 2`Ȁ@2`? 2  @?`5# @ `* * >`c,@[``Ȑ @$`Ȁ  > " `Ȑ $`Ȑ ?$`Ȱ > " > @ʐ!㿘?2  > "2 6(?*> " `h* `Ȁ` !> #   ?`*  ` ? #  ?  @'''''ܐ @j? 8 D   @n`@@k ) `@@mH   @no`@@j 0H @na &   @n[`@@jؒ  㿘`@!@"`&<`&( &, &0 o&4&8 > 6Ha@n  6> b @g 6J&X&` !W &6&.&@`? 2`  ?6   . 6 * >`c,`@YT @㿘  * >  b@1 㿘 Ȁ 1>  @$ Ȑ!"  @e "    @ Ȱ  $ ȁ㿘 Ȑ `@& Ȑ ?& @͐㿘> !쀢 2 ! ? > > @"Ha< a< @N4  * > aD*@ 㿐> !쀢`!> !< `@O$!< @Q̔  6 @Q 6  `*`>  !D*  㿘> "Ȁ` > !쀣 >  * aD* `@  㿘> "Ȁ ">  l!쀢 2  3  `*`>  !D*    㿘  b@1> "Ȁ   @  2&" "Ȁ ">  l!쀢 2  0 `*`>  !D*  @㿘> "Ȁ` > > !쀢`! !@㿘> "Ȁ ">  l!쀢   2 `> *` D*  (@  ,  € 㿘> !쀢` ``@㿘!> !쀢   € !  €㿘> !쀢 !> "̐?$""̀  € "̐ $"́㿘> !     p     8 8   x  t       |                        ||㿘  @  *@E b? nJ  ` ? 2: 2  3  *   * `* > @ "?,  n  @ 렄? `*   $  `@>  `*@&㿘  D ` b? m  ` ? 29& 2  2  .   `* > @ "?,  mɐ  @ 렄? `*   $& `@> Ѱ&㿘'>! ! $@p8 8 $,` `  "? `,`   6 :&%& *  *@ * *@  *@ Ԁ`@㿘  *@ms!  * a*@ "* @mf㿘 쀢    ؀`@@  쀊  @`  쀢 @B㿘 ؀`" @   & % 2     ``*m0% &%@: Ԁ`@㿘H /d4* %  > @"0  ` >    @" `&  2   $ * *`@"  쀢 @H 0㿘   ܀` `d> @."H /d * % `  >   # @ } 쀢  > @#H !    ``8`8, $ `4`#   ?# #   #  $# # #   $ 2$$ 쀢 @    > @֐#xH 0㿘 쀢 2 > @Ɛ# 2 > @#  @ " > @#؀ ,  $,, 23  `"  $` `>    # !$,   > @#$,$ & &  $ *`*  '"  $,>    @  $, 쀊 2& > @q @ $ *`* @" @ $ & `@$& 㿘 ب ` @ 쀢 " > @M X "$> @G p&$$ *" * ! !$@ " ?- ,@ a 8`8!  2@    Ԁ`@0& @s -   z>  @  %` & p&%, $"&    &  `& &%&%&%&%``0  >  @q $, &%& & &%&%&%   $  & <&% 9b !3&%@2  >  @H &  "  "    耢@& € "   `" @   > !j@# @ @N 쀢 "B 㿐 " > @! > " @`> k#  ̀ @2k   2 > !X     *@" > ! @ܔ 00   *@")> j  "  `> !@Ē  * *@  @ "? jӐ  ` Ք? > !@ U 2  >  ! * @ /> ! @ > *, $0>  &  &  &  & @&%&%&%&% *   $*@   `" @  |0*!0@X 0#" @Q     & *@ji   c &%&%@  *@ *  @* ?& 㿘`  `*`*@`*H /f * ' ` *@` *` $`j+ `? @ @ j# ` @ 2 ` *@j ` ` "`*`*@H 0ӐT *`*@H 0` `* *`*@i ` * i` @'a?i ` `@?  `*@iؐ ` `@2`` *@` *` *@`*`` @*0` *`䀊 `` $*@ 㿘    * % @ %:`$@ ?& %&%  @> ` "? i  `  ?   2   2 ` " % 2     ``*ii%  `&%&  쀊 2A `$ % 2     ``*iP%  `&%*& > ` `%*  &%% (: ``27 ``% ` .`$  % % @$ ` * > @ "? i  @ Ơ? 2 *@g `` 9># *` €]%  %   ``*h% 5% "9 H ` ` B %  =%  &  8& %   > "P@ %> "@ % 2 %   ``*h%  &%  `4( % ` &    ``*h% &% * > @ "? h  @ ܠ? 2 *@ݤ㿘    *   *%` %%@zl$@%% &%&%%%  *  &%&%` 2&%>#4*` € 2 > (" :     2  .%       .% > "@  .% > # @  %K&% `@N> "h  `  ? 2> 2   28 2 %% 2 % *@g %&% >   *@ *"g  ` ?  2 *@ `4 % o` *@`"㿐   *` /  *`// ///    F @` $ , %`  &    ``*g% &% 㿘 ` @`> <#H *@4 r j  쀊  `> ђbБ* @ > #`@D 0[2   @> # 4` ` N    @2  ; > #@ $ 쀢 "   耢&  ğ@) `*        @ " $ $ % ` $    ``*g %  $%㿐   *@   > & @Ր# 㿘 쀢 2 > @=#؀2> @7# m  @ @> @  % ,X` @> р` "'> ?  쀊 C -pfŐ d ` ? @2   >#,  €-/+'/#>  @z %`  &    ``*f% &%>  H@d `&%`")    ȟ@ "   &  П@  `" %      ``*f[% &% ` >  @0 %`2 %   ``*fD% &%`^`` > `&  @ ```  `> ! @ &  % (`4>  `b@f  `@" ? > ! @   *  *@ `* *  @*  &%&%& & & & &%&%㿘" >>Ŕt㠐@ؒ  ! @ܖ @ !㿘"ؠ 8  >ʐ!<&""#@$6" 4 6"#@  6"""*` ;`"* ; *@ 2` @ "6"&"&"6"̟6"΀ )@^  (b >> "bp$ $ 耢$>Ɛ $ ?`"4 T! $!@V!> @`P"@@@d 㿘#` @㿘"Ԁ  ""`"`#€㿘H /f * ' @ @0H 0㿘""P`"\#+ "x 2""`@㿘> a` @Ô  `$ 㿈> " 8"P4R"'"\ 6"6"6", "`"""," H, " ," , ",", " ""h","h "Ϛ , "` "Ϟ 8, "d"\"Ѣ, "!, "x"`, ""\ A, ,@͒  ,"ΐ 6""x", ""\ , "T! ",", "܀`""@""\, T`@ {@ 4T" > @!x㿘 T $@ @bb@2!4 T$6 T  €   ! 2!$    & & $ !?&! t  2 <> @! "b@b* @b*` b @ؒ@L <@*bb* 4b`*`b2  4b4bb`*`2  4bb`8bP @bb "b> b!b@rb 2b> @l!*  b+ b\`,b2* b͐ bl* @, bp,bt, bb\ , b`*`b2  4b4b g4R㿀"P""\ B- "x "Ғ { ""\ -  """" "* @&"Ҁ """""є" "@ ? !  * + 2 > @""Β "> #\"А"0#d#`@}("΀@*> "Ѐ@ *2@p> b @&  `)& 06"""Δ "h"є-"Ҁ@2""㿘"Ԧ 8  "P""\ ,@ "x @ 2"x ,@ 4 `  "x,@ "x,@"x @ c`" ^"p @  "l @`" t $t"lp @`$pT4Rx {$x4T"*`2 <6"" 8"P @"" ""> "!"@c" 2"> @]!"* "+ "\`,"2*"͐ "l* @, "p,"t, ""\ , "`*`"2  6"6" 5 R`l`$l0""l $l"耢`@0ܐ7""\ ,@ " "x"" @ @ " @"x @2a"x 㿘 H /f * '  a2 a1 Za a"2 Ts 0!5ja"g 0 !6] 0`@ \ T 6 T ` 0^ 8@]0MҀ%8J  \ 2F& \0D@  2  T# T @6 T06  `@ `@s ,0`( 00""Ԁ   @ 8@k 8`4 T @   @v" H 0㿘. 8@W2 2 h l  & l < `& h @8@ǒ㿘 T! "6 T `.@@6.@01`*? 6*! @    T"6 T `.@@ 6.@0@ 2 2 @  *@ .@ 2  ߐ T =6 T㿐 8H /f * ' > "@;  > 4 `` $ 2` $ 4 $$ $ $ H 0  . @@ 02 $ $   '>   &.H /f * ' b@   4   `5 $ $$ 4 H 0 ͢ .2  *H /f * ' > #@Ӓ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  (  ,`   ??" $@ $ ,`42  8 $ "쀣   @s&$*`  㿘""X? "+ ?`" > " `@̒   &" 㿘"Ԁ  "`"&"ԟ@ >  @#  &"԰ 㿘"Ԁ  "`@&"ԁ㿘 8#`"" @" @͏?@Ð@9 "X  * *  (2*0"@"X" (0?  ?+@``(0""*0  *2 @"X` ` `  +@  @`2` 㿘  @ \P*@Ph   $ ## Pt @## \P( @ P \ *@P`(pP` @ `?   "Pp(`Pt  @ " ``@Pt(`P*\P(㿘"P *"P ` ` @"`@ " "P "  $ "P $ # #"P" *@>>Št@ϒ > Ѣ# . @ @ϖ   . @ > ( @( *@` > ( @( *@`@ * @> (? ( *` ( *@@ * @> (? ( *@ ( *`@ * @> (? ( *` ( *@@ * @> (? ( *`*` ( *@*`@ * @> (? ( *@ ( *`@ * @> (? ( *@*` ( *`*` `> (   *@` > ( @ *@` > ( @ *@` > ( @( *@` > ( @( *@`@ * @> (? ( *` ( *@@ * @> (? ( *@ ( *`@ * @> (? ( *` ( *@@ * @> (? ( *@ ( *` > ( @ *@` > ( @ *@`  > (   *@`  > (   *@`@ * @> (? ( *`*` ( *@*`@ * @> (? ( *@*` ( *`*`@ * @> (? ( *`*` ( *@*`@ * @> (? ( *@*` ( *`*` > > (( @(  *@` > > (( @(  *@`㿘 $ (N !>   @`"   @`"  @` `D !$h@$ 4 ` "` $`H  " H$h $ H !> "0@`0   #  @`k> H!  @ !>   @`[  㿘  (l @5  b~@b}@##kf@"'ej@"!" !#m@" #g@!#n0#o@ " 80#i@  #h`"  !>   @`"   @` "  @`  ` @    #g@T cf@G #k@dce@( }cj@tcl@"9Hs 0#i@ "H #o!#n@7!#m@A b@30#h@% Y` @> #,`J> > !Pah@C@ѐ> ;$H@L7@Ē2@-@(@ΐ$@f` "  " @< "d@<d&h& $`$h$d@b @_k 㿘 (`A !>   @__"   @_[ " @_W `D`@Ȓ`$ @_K   -㿘 (!>   @_>"   @_: " @_6 `0@V @} `02`D!> ` "` $`H "@"0@O `D2`<@`<``d "`h@ > "0ax#\(ܔ  @Z > > !@    a@P#\> > "  $ @^     㿐#d@O  L @g l l@ >   @^ $&`0`0&`4&`D`D&`H&`<`<&`@@t 2  &`T  `&`X @H&`\ @h L0 2` 2 > ѐ#""`(&, ?",`0?"`0`, @`0㿘@㿘@~@ $㿘@n  "    ,@ 㿘%>   @^V !` ` @^N  @^J ?@@h @^@  ,  @^:  ,*@& ,㿘#> b  @^. ! 2 b  @^& 0&  @^!  @^b @ `4@$ 2 > @u!`" ` "``4@ @^ 㿈> "  @] a '   ` a @ &   @] b "  > > > !aȖ@,"Ӓ  @]ѐ  @]͔ `T`"`,  !@``X@  `\ `?2   `2` @ ` a-` @  @ @]   @y@a$(tU @   @]z a 2   @]r    @]l  @]h T L`2 HT N@ܐސ  ?$ H '@F  Ґ U @k ǐ` a H  @ T@$ X H @   \@Ȑ$ ` H ?$ H  @]*   @]  a   @] 0" H  @ T  2 H X@ H ?$ H H @ \  2 H `@ H ?$ H@n`,!@" H ` `T 2 H  @\ 0a  ?$ H    @\֐  @\Ҕ a@"` `@6$ @  @\ a 1   @\  @\ ``` @  @\ a    @\  @\  U #\@0  @\ 0   @\ 0 @\ 㿘`  @r$" `,!$`,㿘`  @q$" `,!$`,㿘> #,`> > @" `@Eb8` 3 ` P@. @( )`6 L`*` 6 N 6 N`   H & H` "` H & H`& T` " H H @& H` & \ H @'& H㿘 h`@۔$ 㿘ذ  x  `  T  2 @e Lآ`@ $؁㿘؀ & 7`@=t 2`  L@d) @T` ذ * @ *`$ؒhx$  &@"``"`@e͒ L㿘@ "$>   >  j>  #,`> > `"H@b``#8 @W 2  7&`#,`> > `"p`@b` < "s ` @   "i   2 "b `@ "\  "``! 2S ``"&`@ڐ&`` "`& @ "@$ @$  @"@& @   `5$ `!1$ #,` > > `"V`b`@;V` ` 8#  < " ` @      2  V`   ` *@   H2  "  H1` 㿘> #,`> > `"@b "> #``  `2` & ` & d & h` $ @7` $ @7 p> #,> c쀢  > > @"`b@``   " ''  `` ` ?''ܒ'''''@ȕ `"@&`㿘> #@jO 2`,0 , #`4 4@"% #  ` `!@o `4 2> !d @㿘!>   @Ze" !" "`d @Z_ 㿘'>   @ZW a`2`   @ZM  @ZI  T` dt` X@  \  @Z6 0 $@@  Ԑ 㿘  @` "`@d! L$` ` @0  a` @8'  ` (  L@bC$$` T$` ` Rd 2 ` `  d&`  @c L$` 㿘 t@/6`  8 4-$6- @,& `   @  @R} ,  &С-D (  $"@D (@(D"D㿘 " D@c L&  D   $ D?* & D"  D ?㿘!>   @Yj" ! ` @Yd"  @Y` T`  ,!@2  X @2  \ ` `",`hL`h `h @$ $`d,`h @Y6 㿘!>  $ " @Y- a`+ `  @Y#"  @Y  `$`D , @o 2    `d  @a`h "  @Y  "  @X  &  ?$㿘 0   2 x  㿘> #,` > >  "@ǒcd ,*@","  H  ?& H@̐ J H "  ` "` $ H  "@` "`$ 4 " 8$ 8 `@ > @ː"0㿘`? &` P?& P``"@`@b L@``"`& @`@"> !@@㿘> "0@   @(`4$ $ $ $`4 $ `4"@`8$`4 $`8`,&a@ &`, 7㿘`P @> `T > `<   2 @ > !@@Ӓ > 1 #,`> > #c8@.` L&& & & & & & @`a  & @&  * `@& `P `L`$`P&  $`L& &`@& `@"@$`@㿘6 &dt  &dxd| @"@ `?$@@H 㿘\dt&dt7  "  "d| @"@ `?$@" @*" 㿘`dt!  .dt +` +` +` +` +` +` @+`㿘`  &dt  @&dx㿘 $h`!   P 6 P2 &$h"  "? ,?2  H   & H&  H &  H"$ H H & H @Ww 3> !> cP @ #! "  H  㿘>  @"0 @v(> c,  > > `#`c@A $$h`$h"`$t`?` 2 "@$  H $  H"@& HÐ 㿘>  @ΐ"0 @I(> c, > > `#@c $$h` 4$r$  H $  H"& H 㿈> "'P' @ PQ !@   !@!X"P!@!"Pb 'P @" ߶b > @#㿐 '. "* "*  @_  > @#0@p> > !> "#0"c>   `#\" x@' "@ "@ɒ$㿘? 2  4 ` `*`4 g@ *  @+  @ 2` > ј #03  X + " * > " cȑ* @ K!, d 2 d$!,@C ` ` * !,4` 2  `   0/h!, !,*@$!,!,$  `*@ `" "   $  $     $ @㿘`Ȓ!@`@ݒ"  d"$ ($ 0$ ,a0@ d$ 4> `( $ 8@m  4 >  `8@f a0. (4 H2`  $ <4 J$ XR$ $   aW4 $ $, @?  26 @  .  @*@ @ 3  `@ `?@  @ `4  *>ؐ `̒b|@ Ѱc06  . ) "* > "cȑ* @G  `"      * *@$  * *@$    @ @E$ ` D? 22`  *  F * *`@ 2  `@2`*`" * > " ȑ* > a, c 0 (& 4& 0H /d * % @ H 00 T <: & @ 0 (& 4& 0H /d * % @H 00a,$``@<  4  @Ő""0"< 8"4"8`<? ?` "D"D"Hȑ< @"T ,>ڐ"X","X"\ `"` d"d h"h l"l"p`"t0"4("0 @%"@& @H /d * % @ H 00%"@H /d * %  @$a@a|a<@`$a|@H 0 = Dh@㿘!d 0 $@R&!d 0@ \`t "`t@O㿘 t? D F *`   2  2 * "@*`> "@ȓ*` > #d`> `H@א  4 "  @ 0h$ 0@$ 4 @>  <""@ $ @@a|  < @`0 0" @ ad "a| @?$a| @ @ 㿘? 2`  6  * 6  *`  +  2  > јc03  + " > * Ȑ" * @a, >>="| l @` 㿘? 2`  6  * 6  *`  +  2  > јc03  + " > * Ȑ" * @a, >>="| l @`  `? 2  4 ` *`4 '* @ @> , @  2`  ' @h9 4> 06 ,"* > "# b* @ ͢  m@"{e e@) "  h@+ |"0"@"a,  e`g@m`f@ m %a,0"@߰ e"`a @ Y @  U"`Д ZJ [`@ > X@   > @_ `@ 9  @''''' @I : @L а  Д@M^  @'  @MUА$a4(+ 3`  $a0 @ 2  %  &pJ    @I@"  @Z_ H$a@@a4$aa4@%a0`0  * 2@ * >a,> ѐ#4$`$a,@B$`\@8 @Ű a,  @t "  `*@  `  ` @| @a @v`Ha@[ϒ @E`0H/ /@e@f!H 0 \?"&\0\@ `*`{ " * " #ȑ* a,` @KSa4 j"`А@Y Z &`_&d&d\&`a,$V`K!T a,$M `&`ȓ*`` G&$BC @ ?"a,$a,`Ȕ @8K`̰ 2a, e g@2a,? 2  @?`4# @ `* * >`Ȓb|@8n`̰a, ~@$a,"2  a," =$a,  " > @2 p> #@fĐ$!8  @Ya"!0  0(  (  '2"*!4"!4   ?''''''`@I!8!4@J̔ !4 @K@Z > `8  "!<㿘> #0*`" > * Ȑ" *  !, 0@0!* "@*`"@cȓ*` *!,㿘> #!,!4 ?`&!,> @ !8 @H@ @f1!8&!0&!4&!8? 0 2 @ g `(2  ( *   0 2 > * Ȅ (> ф c0(,20? 㿘!, 1>  @$!,!  @~ "!,   @!,  $!,㿘!, `@&!, ?&!,@`PXx㿘H/ /3> ba> a.a&a@ a`.a@.@ a .@@F;H 㾐> "'@> " 2`8 @H/` />  b a ? *a a` `,a@  @ a @ ,a ` @ ,@ a,@ > ( @ <bCB8 ( 8(H 0# > @Ґ ؁㿘>  > #Ѐ`2 > @ "> !ĕ*` *> "@ #@*`>  㿘WUSQ . ,  `,` 㿘˲ >.  㿘> cЀ 1 !> > >#`@@T"> >ޔ #@NbP> (  @ @" "$" #`>  "@"> "(@$> "  *?  $cЁ? 0     㿘?> > `  `  6.`"``*`c1(abgc.`#`. `.(/`@`(0`!ʐ 㿐> #Ѐ`ƀ > . "(@ . @Ő ` * 􀢠Q@` `" #@ `& & 4 4 :?  ; ?#`: `: `:`:2`> > c8 <" :    0 ` > x`B j:x$`$`$@2 > > т H/` /8> "(`@:<<@  8 > >   pB: pH 00;" " ""   ` `(`B ; ` @8`B  8<. !!   8@B 8B :  > "`  > " @#H 0㿐> @C#> h`B :hH/` /%> #> 8'> ' 'H 0 В  @B <  & &   `   @~& > @#> # @? Ho o c<8>   "(@ <$c<$c<2 &H 0 (> "' ǒ> "`S` @H/` / @2`(%-"@%H 0@͒@ /   ///  @ ///G/&@ t>b``@  X@  > " > @c!(㿘> , @B :㿘`   @U x8? @2  `@`_>ݐ#*` €X > b  O #>  X> ``C :X> "8!  @{ : b 2`8> `B :)  `& :`?#II,`,  $   ,  0   @n. ` 2`@VÒ 㿘`A`? 2`   `A> " ``A> @ c0R`   > ф@> "`8> фP>  "`8> "` 㸀  `2``"`H  <`" `@ H>   `2``"`H  㿘?  2  2`C  >  @Ti ` '+`@8*`2  @mu ?` , *  2`, , 2`Ð ?` 2`? 2   > "#@U 㿘 @"@% "@ "e8""@I @w  "@  b~@b}@ @Ho o> "  &H 0o@a 2i H > b`   "`"`H 0Q@` 2K Ho o>  "" H 0;@`ڒ 25 > " `?. #Ho o>  "#H 0@`  Ho o >  @"H 0 @@ 㿘   `  "@ # < x B@ؔ$ ` p@"@`@  ":@? "@ " h   @'@ '` '̐?'`* '%`` '" `@D`   X @`"@? Ұ Ԑ@˔ !X'` '`N@ =`?'܀ ز`'Ѐ `0`4  `p@  2 `0`t( `0  <`8  '<`8`<   @ > c` ' "``p  @  "`8@`8   @v q H   8`8  @ @ 8 C|<`8     !y7!X ? 2` ``?@\؀`N@ ."!d򀢠7 M! @M! `B`8@ܔ!   @5 T*` `<+'=(`8  "T@!*   $`@@RN `@@8`@6 j@S  `8  B<`8`88Z`8`<8T`82:` `8 $`@`<P `8@Y:<  @  @ @  H @+<`8䀢`   `0<`8 '䀢 "`@`@@Ѐ`` ?@S @$`@䀢 > c` "` Ѐ `8<`0"6`@@̒ @Dz`@%``@@X@ @   ̐@BX` L`*@H%``7 4̐@BG  "`@&X07*@'%``  @@`@%"X@ @ @R `  ̒ @D+`@%`"`@@ 㿐  `@P `?@ @ '` H @ & '㿘> a>  9 @j> > "c" 㿘> #'> %> 6`  *  " @ @2 2  `@% 6` 0 2  㿘 >  2 >  * " 2  @2 22"&& " D @H    2   " "㿘 >  aȀ    D > !@(  $ @Cr `@&  㿘 > aȀ    D > !@'ǐ@ " @%$  @R@ :&  㿐  '  6`6``@     `. :   􀦠< H 26  @`!6` @2 ` @6`  2 ` 6`  2 ` 6`  2 ` 6`  @2 ` 6`  * @&`  * @&` `&`!m6`&` @㿐'􀦠 `  `  *@ :   􀦠'`H ` 2! ``=@ ` @@` ```&`&``@` ```&`&`` `@ ``&`&`&`&` @㿘 'l '    &`&@H 8X. * "* "`  @* @, : & @ d@? * @,`,`* :`& *  @"?. * *"@ *`@*" 0*  ``d ,:`*`" *  * "&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ  //}   (  *  * `(<8HHHHHHHHHHHHHHHHHHHHHHHHHH$XT0h8hhhhhhhhhhhhhhhhhhhhhhhhhhh@   (@2   *  ( @* ` *  ` `(@*   *@ 2`"`㿘> @b"@2 㿘  `(@`$F`0`2 `,@6  /,` > " ` ! >!t*` €  $ `$  `@t> > !` a  > @" `, `,@@@-   `(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`㿘N > "`  >!*` €  > > !` a   ?> @֐"@`, `(@2*``,2`@  ` `(&``$""@&`$2`$?Ԕ`$&`$ `  ?&`㿐`(> b`,`$@w" N !   !`ad  #\ `( `@`$0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  (  2 "@@`  @    @` @  " "   -@ْ`.` 2  "@@3`  @   @'` @  " "   @``@  " " ` ?&` 㿘@N     `( (   `*  *` `( ( ? 02 ?@ ?  0?@ * @(@@ `  `㿘 `? @`@&`!X㿘 . (. &`` / ``..> >`  .  (.&`$㿘  2-    2% ` 2  > b` @͔ 2   2` > bp@  > b@  `" =&`㿐 `!`' `!ad@`2`  *` * + `  P "``!\  ?#  ` )&` `  "`L@L@2 L`L @2 €` 2  ` (`@`: `` ,`) ``! :` B8 2  + ?@   H`` @ @   2  €   2 ` '> ѐ''ܔ`\X6  !d x`!7'' '''ܐ !@J> Ѵ#Ѐ` Ĵ ?'Đ8`$  7> Ґ'6'''ĔP'& ` "#> &a`b@ɔ     1&a`b@  2?"'> 'ܐ"? 㿘.     ?.>  "  ?* € . 㿐Leؒ ;) ;Y  А R, * @ ?Ѐ .`@*`@ ;$    ? +"@ )"@  ! . ; 0`;   ??? 㿐`\    =. `.X  ;` .F600 > #> `> @z`  > > b4!> @r" > @#07> > #8c@@ǔ /"'@   "@@L 0> " "@  #a "@a"`@ H@ @   ;$ p  `@`@{ @  a @#n @&(&&$&&,@ܐ c< "@~Z >  `@& @tP ``@;  @@;’! @+0: @= `@@@2  @0  @G  `:k Y Z`@@$ `:` Y `@@$ aP; p@# H0@$㿈   '`@ ''   'm @" h@!9 > " _ `@  @$ T耢   ?@;- I0c ?@; 2'   >(?@ >  HcP @  2   " 4 :0 - ''&l 'X> cX@  " > c`@  " > ch@  "   2  @g'c @]'? * b> ?   9@Ie!h@Ò!h$`P ` `+  P* `@ @ *@ $`a,; "  +  *   *` $aP ` `+  গ* `@ @ *@ $aT$`=$ad?$`0`%0@&a&`h` `@ &`l&`@&`D$`$`$`  " l`2%l ?aP`* ` @` P.H $a\l l ?&l`0 "`0@'l  $@` $aX $aXaX #`!a,: "  *  *` * $aP ` * `@ `* @*@ $ad$aT0 &0$ @    @ @   耢   @9?`@J^ 9&a㿘@($`D   ,($`<$`T$`0@8$`@@@  J> `HcP @x  B > c$, 5? * b ,( (@b  8 @^  " "   !W<  @&&&.6&&&&.&@|6 `0 $`0@ 㿘6` @ݒ a   ?# @9u @# @Iْ 9`@*@$`@$a㿘!!,ِ!X `?@I -㿘! H @ &`&` &`&` &`&`&` `T9 Z `9 Z!Pa9 p&`8  㿐 `` & ` &@ & F㿘 @ 㿈! &, > # @o  &  :@G Ȥ@ > p D @? "`$$$  @ "!2F'6@ @P F> #@`!  @D F> #@0 , ?@  @4@E> #@ 0 H @ @@# " @0 >  #@@  F$  @$ 6@  ؐ!`2`  `+"<>"*` €> # "`8> #" 8@j > `$ "`" 8@@$'p@,tPh: @  l `@ "`@ &  2@ "`|"`㿘!@ `  `0`4&& LDTTLTTа H*  2+ 2' ,2# 42 2  2 <$"  < >\(      㿘  ࠐ / @ `   `$ `$ ` /$ T`$ `$ `$ `$ ,`$ 0`$ 4`$ 8`$ <`$ @`$ L`p< `p`t.  < 2*   @E$      $?'''''''''''@r耢 А$ < @G  $ D$ H` $ (`p< P <$ 㿈  ` +` 6  @ 0   % `@ `  ` "@ 8  p@b    `;  ;  >  (#L > #Lh`,:  pF t@?#\#` p@ ߚ; 0  @E\! $ "@`` * :  p +`? t +`?#\#`@ @F  '?@ܘ'`@%8 s`H@^;@  ` p@ `  t@`0 "`0@ `  2Y`㿘 0"z@"      @7Ș   E  㿘``*@ `  ? 6`#0@* &#@#D`#H 4"@&#@?#H`?&#D&#H @]#0 2>#8 㿘"" N" =`?  " !! 2!@ ""!  # ! 2%.!   # ". "   ?  6"#(!># 6@"  #(>#68" 㿀#P`   @Da' '쀢 ,a,`,b,a,`$c0 $cD  2 '* @DL $cD$cH $c@  `H@Q! b`2 bL! 2 b#,b  L! 2X ,bX!`  d #\`? `,bX`2c(c(b c(8ic( c,@8cc(  X  ,bΐ & ` @E:  cH""@"@ "c8@Sc8?  c@@E$#㿐   `!X " d ?`?2@*@  @  5 ` H   ( @$ H   > `#> @#@ @   >  c> #@ @ 0!@  #  @\'> #@0  " $  "" "㿘  @5 @ 㿘  @5w @ 㿘  @: D㿘  `@: D㿘` \<? > @ P T P@2* T   T@5 " T 0$ 4($ 0H /d * % @H 00,?2 T H@ <$ @ T?2 H /d * % @H 0  > ` $ D 8*` € 㿘> @ h 㿘 `@9 D`>x(`!X`     %` $` "`     ??1 J@` +???"&" @?(82`?" 2?2 ??"" @?` @((882`?" ?: P> "'@`( $($D$T$<$08@ $@@@) rH@  lH3 ?Ēc ? @ (**`+` @  3   20 3` ?@W(@ 6   $T$<$08@G$@@@ 7 H@ @`@ @*А  @ @   " "   !W<  @&&&.6&&&.@uؐ6 0 $0@[ > @o3 㿐!> ֠#(> >  a#\!  @} > > !a #\ H  @s > > #\ ̚a( 0  @i   㿐`@`2 `> $`@@!0`@@a -1  Z` @U &(&&$&&,@t K< "@B >  `@& @ 8 ``@1 !@2Z @3 @B `1 Y Z`@@?$ ` Y1 `@@4$ 0@Ԑ ? (* 0*`2`    @   `  p'L'@1     '@ϐ > "@  L`@1IL   @L@ L@3J zL @1? s  @@s h@ђ h&a`> ` !X@&`h`@@ &`l&`@`($` ?$` $`$@԰ D`Ԓ H =`ԒH'?2 @*1??# @*`+`  @ +  *22`  3`  3  ?'@((2 4k(?@˘԰ Ԓ  HI 2A  Փ*` ֕*  ב*  @ @**` @ 2  @2` $` 3$`?$`  * *  * ! ! * * +  @ 2 @ (23  @ @4 K Ԓ  H 5   *  •* Ó*`@  **   2`    2 $`  +` +  *`@  *   * (*` @2  @2 3` $`@{Ԁ'Ԁ *j(.,> &!```, ?@)԰ "> [!! H  'А!`41/ @JЀ '> !@ I `4?`8#? (+`* ( 3  2` ` `00` * `, ?@԰ > !Ԓ!dH > @ 'Ԑ`L@|o   d @X`H`$`D"`> !`@ǒ`@Ð!`@@͒ Ԁ L@L @0X?㿘a6`  @ 2`@/   ?@ ?@0:@1 `@"` ` " D@@  D "@@ @@ `@*@$`@$a 㿘!? 4 `# `*` `* * ` @ @ ? @ *`+ 2  2` @ @ `@ "`@$ 0 -! "`"` "`"` "`"`"` 㿐> #&a' @   '>  @~ΐᘢ@Ԓ H?@@, > @!@N @>X! H > 6" ? *` * *   +` +  *`@  * *? @* (3`@ 3 22 @  `  @>!   $`D> "0@Ȱ @@0QH/֔@'@  > @"X@0;$`<$`$`  $`$`8" @t>  p` @5l @`D `?`> `*` €          "`< &㿐 `` 2& &  2@< "`  p> "' !@@  `@ `> @="x ؐ@  /J > b@u   ? , -* .*  *` /@  '?* *2`  2  @=c #? % ` , -*` .* * / @ @**` @ 2 @ 2`@ ( )*   *2 @S% X ,? -*` 0* 1 .+  2+`@ *  / *` 3@  *  ((3`+  @ 2   0 @3 @  *@ *@԰ "! ,Ԁ " 0@ 0> 1*` 2* * 3 @ @ @*`* @3  2` @"nb -* .*`@ *  /  *`* Ԗ 2   H2 `. @ ` V ` `0 `1* @ *`2 @ % % \ 8 9*  :**` ;@  *  *@ 2 @ 2 @ `0 `1* @ *`2 @ ߘ a ?a *a*`@ * a  ? ** 2` 2  ( b > @j<# > @##  > "@ 㿘> #& L@y H D@* `!  #@ <2@z  @c ဢ   & 2 <@z  㿘> # ` @, L@yy H < D *  ""  & " " & @y 㿘  L@y` < H D * @`2> #X@& `" "` "@yʐ 㿐> "d @ >  &@@# D? ,c -*  .(( /@ @ ? " @ #*`*0 (2`  0 2 *0  a  (( @* 㿘  `   <      D ( )+` $( % &+ *( + '*`*@ @ @< 㿘 `?@ʒ d   @Ò!`?㿘&` ? * c *2 g4 &@&@  *"@ *` &@ *"@ *`@ *` &@ *` *" *"@ *` &@ g*@ > Ґ#|*`@ * * "@*`" @* &@  g@"@&@g@#@&@g@"@&@'Ѐ6!m* @*`" * @"*@  &@? * c 2`*  <@ *: x*`" @* "@&@x '' ' '`D  8"<"`'?"? 0 1* @ 2 *`@$ $? %* &* *  ' @ @ *` @* 2 2`   " ( )*  ***` +@  * *@ 2@ 2 @   H"`',ܒ4 T4$L8$<$@`< n $ D E*` F+  G* @ A@ B+`* *  C @ K   ?  0(? #?  4`,  *,5?   ( @ / 7`,`.6@ @ 1?7  ?@6  6@5 @@ 8`'ܐ@@ : ]  :`U: < =*  >* 8+  9 :* ?*`@ ;* @  ??  c0(  +?+` ,` 1? ( 5`-   #  .6 . 6` -`@)? ? 5 656      :`  "D"H #? '?"( < =*  >* 8 9+  : ?**` ;@ * @    4`,  +?   ,+`- 5`1?   # ,`.6 . 6`@ )? ?6 6 5 -`5     : P `< :X"    㿈     `' '?`D? < =*` >* 8+` 9@ :+  ?* ;*` @    0(  ,* +?1?  (   # 5`- .6@ . 6`@ @ -`)?6 ?@ 5 @6 5 @  @ @  4  / @+  "'  B4 $@ 2'@$@ ''@캒 @Q `@`" 㿘> > @g#-  @y  p?  > @U#А`@z `?# ?@ " `.@ .@ ``@z{.@㿘>  @xܐ  ?@k`@z^㿘      & "& *& @Qv& ?㿘>  @x ̠@ 0$$ $ $ 㿘     & ( 2 , ; & $ $ @ "  , `& (@   "    " & ,@9ג    & $@  `$? `%* c *2  `   & U  #@   > @ @ @7  & @R )   @ $ $ & $ ; &  @ %& (4 `$  & @)" `$? `%* c 2  `* &` > @h  }& ( $ )y@ & , &  , &   ?@$  ?& 㿘  " ,@{ ,  >   "> @9J >  @yw`'D>   " '`' ' '` '` 4 , @7n 'Ē'''ܐ P@D'+?`D <1? =*` 8* 9 >+  :* ?+`@ ;*` @  ?  *   # -` .6  . 6`)?@ 5 ? ̆ 5` @ ?z# `v  >`;̐ `< '// . //7'А   f   ? * *  *  @ @* @ *` 3`2`   '///7'А// 1  $ %*` Ȑ &/  `? `+  `* ` *`@  * *@ 02@@ '   * ?  /7'В Д@ C> d " D֒! > @K 8 D  #    :?` (D ` @8A  > "@D "@> " > @d7 h -㿐 \ T P@`*:   P@y "0 T H@} <?($ T  T@)& " T 0$ 4($ 0H /d * % @H 00,?2 T H@} <$ @ T?2`H /d * % @H 0  >  $ D  8*` € 㿘  @- 㿘  `@- 㿘 `@- 㿘 > ` x <@ @1y > @ 㿐  `  "@  "   * :  @ "    * "  2& h' '''`;?' )?' D <+? =*` >* 8 9( : ?(* ;*`@   1?#' ' ' '?  '̓/`   .6-`   " . 6` 5   5 @  @ @&ܰ  @찒  `   `J`. @ "؀   `@>    ? *` * *   @ @ ? @ *`* 22 c`  "` ?3# `/  `Ԁ$  ? *` * *   @ @ @ *`* 3  2` $ %*`  &АW     ! > @~~   "( R 18 @  ؀   "`@ > c` "` Ԑ  @  ܐ "@'f "@Ԑ  |  ؀    @ې㿘   @'9 㿘  O " D@ c&  D "> @6 > !@vB$  㿐 '@e?2  D? c * *`@ *   ? ** 2` 2  '@  * *  *  @ @ @*`+` 02` /&@-@  @&@@@8&@`?` + `* @ > `: @{  H '@  @}㿘 D?  # *` @*2     > > @}w K !   *` 2   "c    > !P• > !P  2,`@8,`)  (`? c 1?* *@ 2  @2@ `,@ ?  *` * *   @ @**` @ 2 @ 2`     * * *` @   * *@ 2@ 2 @  T  2,`@8K,`)  (`? c 1?* *@ 2  @2@ `,@ o?  *` * *   @ @**` @ 2 @ 2`     * * *` @   * *@ 2@ 2 @  @ ? ( +  +  +`@ *  *  ? (+  (, 3`3 3 0  *'' <? T&> !P @|y 0M> @|u!0I  =* >* ?*  @ @ @*`* @2 2`  2&&`, \ '?X#  !?%? 8 9*` :* *  ; @ @*` @* 2 @ 2` @`6 <  㿘` `- @?c *2 *"! "8! !0@ @ @@ @d`㿘`&a`&a ` &a` `@&a`&a$``2a` a`H  `@ g > @zE!@!la``@*`@ ``> * "@` &`*`" ` $ a$ a $ @a $ $ $ ``@*`@``* "@` &`*`" ` $ a$ a $ @ja` $ $ $ ``@*`@̐``> * "` &`*|"@ ` @ "`` a "`"`"`"` "`@㿘`&a`&a `c  2 * &a` `@&a`&a$``@*`@``> * "@` &`*`l" ` $ a$ a $ @a  $ $ $ ``@*`@t``* "@` &`*`" ` $ a$ a $ @a`  $ $ $ a> #P`a  , $@```@ > @G``> *`" ``&`*|"   " " " " " " @?㿘`&a&a  &a @&a&a$``@*`@``> * "@` &`*`l"   $ a$ a $ @a  $ $ $ a> #L a  , $@`L``@ > @``> *`" ``&`*|"   " " " " " " La *  , &a@Ւ> T> Ҕܐ" ?> bh8"bh? $%%%%%㿘@ 2!@ $!< @SF2  @2  2  2    2  ,   ӄF2,  @2%  > Ә`\ *@8 *  2  2    2   ,  * 㿘'T?\ > &#L  *   " $" 9> &   @&> cL  +@ #@#@@2   '@`'@  `'@#L `8  @ F"@  @ @* @ > * "@  & *` " $ $ `$ @n$ @$ $ @"A @* @ΐ > * "@  & *`l " $$ $ `$ @L$ @$ $  @* @ > * "@  & *` " $ $ `$ @-$ @$ $ #L   8  T @* @ > * "  & *|"@ @ &"`"`"` "`@"`"`T"x  #\#`#d#h#l @ː 2`  > 'T" D ''P''t'p''@p'X'T   <  @@ ! X X @` @@ ! 2  4 2x   o ۰  ,  @/'XԐX 2䀦  > #Lt-X@ `8 `` "  ``@` @@ @,@T'!D @Q"> #L  p t@8 @ @  `ܐ 'h  " @  @ 'h @#dh#`#\h@ 2@ h#`#d#\h@ "^ @h@   *@"@T,@"@'!D `@& @AX'` 6'\ 2`. TTT 'T'd  "@'d#\d `\  `@ d   @ "@P'!$" d` 'd`@Ġ @ @X` @/ dT@">  > @["x`  ` 3 ' /n    2 a`H " ,`@  > @v" ,  @-a| ׀`?&a&a ,  > Ӓ>   2, #Ð@n3  a]  >  h > Ӑ h&a4 . 0`?'> 8 @  & > Ӣ X `"@`: "@` @ `  2,. 0, 6Ta ,?'''䀢`C>#*` €a `#\#䀊  a?&a(&aa  " &a &a" &a",a ?&a&a a  " &a &a" &a  ,,a ?"&a &a@`&a$  @-2 " *" ," "" &a8&aD @.@ja@`"> #@o@.ϒ @*` Pa@aD`'E a8  @. > #@n@ `01@( & '  '' > #L ''   ''''   ''''a<'''Q @@. > #@n   㿘,,   @,a2 9 ,* - 2&  d! @   @, a   `@2 ` @ut` `0 * `@., @.) 㿐`? 4`a'a( ) ` %> b`@x  2@ `  @ 8  @ L  2` , @ J@ 2`*@@ *L "    9> J@ "` "` L %  J@    2`J@ "a*@`J@ "` "`J@ " a `J@ *@a` `'` `@`!@O @  ",`a( "> @s"h@ a0 a(  &a(2` > ؐ"h""`(2 , ?",`0?"`0`, "`@S~`0` "` ?"a(  &a(@+  ? @+@x"%   ? @+% @x $ ?@+ $a( > `,@  ΐ $@ @$    > @s"a0  @uP$$&` @ 2#`a(  &a(`@@ #@mAa(&a,a &a( "a" a" - " 4a(   &a( ?&a(a0@ * ``@@z `#4@m `  @,ے ?  @,Ԓ ?@/㿘  > @s*" , > > > #c h@s `, " &  ?@** , " *  @ @, ?& 㿘  :    " @   `  & @, ? && 㿘` @ "  +> ` ` 2 @rՐcx  $ € ```"``㿈`> , #P`@ 2' ` 2#  "`  @Ւ  2` A#@`  #`` #\#d@ǒ`  @㿀`1> #L` * &`#\ ``  @ * #`#d ?@? 2'  #`#\ `#d`  ` #h`@#l 2` 2` `  @  8  @ @ 㿈`> cL`A`#*&```   * #``#\#d ?@`?  㿘<>&a&a > cP4 * &a ``@*```> * "` &`*|"@ a@ a a" " "`a"`"`"` "`"```*`Đ`` * "` &`*"@ a @ "`a a" "`"`"`"` "` 㿀> ! > @UC"c@Y@s> > c@s^ @@^}@@@8@@D@0?@n@@w@>  X` X$` X`"` % X$` > b$aH> P  $`8`8"`<P"$`< > @ #b@" "# > "b $`@"b$`D> b#  "b" $``$`l> Ӓb  $`,$a> ,`1,a6a7  >]bА`@T>a`$@T`> "p" @6x$``1> "@`3> +> @;/2` > "$`$@  b$` $`5> 7> ;> '> /> -> ? : :`` > !"  @@< @4$!> #L  8*  :  P<<`8 @  $> ' c@ (> ! ( $` $` $aP@0/ @Xaad@@@t@x@w@@@ ad    $ @  2 @kH /f* '@[ @@]H 0> "Ғ @Vub#d>cT#\#`   @ > @p @ > ֠ #ࠖ @N˘ #` > ֐"P@B >  @ a> @p @ "@a  €Ѐ "`> @p "`@`Д@  b`"` " @`b> cx "` > #x% > "!%@$  X`"`""$`$```"@&>>  Жؒ @= ">> @p< > ! @1 ">> @p0!> ! @% ">> @p$!> !( @ ">> @p!0> !@ @  ">> @p !P> !̖` @ > @p!h@p @o@> "b> ֒ @A"`> a"a@O@;P> ! @ '''''@  `> > @qf!0@qc!0@X> a'̀ -> %> Ӧش7>  #>  !b @M !` ːL> "@ '#`#\#dԖ ?@ښ? " > @o" "` Q>  -/L∢ `  s/ِڦ  * "$@'А'@sQ $@'В ې?''АВԔ ̠?͔ ?Ȕ Ȕ'''@ > "8@pޒ 2 -> @p֐"P> @oE"h㿘> @c㿘> @c㿘@N㿘@P@4) I@  '''''ܐ@u :@ <    @@6 + > #L`1> #H "@> @N#PcL "#H @@ &#H$cL@ @$cL 2  $cL@  8> cL> " '2 ` $ @6ސ$#?:7c @5ז @7@7`Ԑ@"'԰" '" 'Вb@ ?@h7ДĒb?' '?/a ?> !> !@lm" 7``` @ld 7`0 `,@= 7',  'H ` "? l?' c /@  #`#\#d#h#l  ( @ @6r$b > @S֐"㿘@pa . c   6  `  # (.` 6 `.` @.`6 㿘> cP  cP>> "@  > "> c'H7> #> 5> 3> 1> /> -> )> +> :!>   `T @pN d\@##H $cL$#H@n'Ā`"1%#P`< / `X `Tb@p2 d\@cL $#H$cL@n "⤖#P (b@Kؘ #H`"cL`< 2`X  @Ӕ?$#H%#P@   @ʔ?$cL㿘#> cL> #쀢`!> #H  `"#H @?$#H$cL㿘 > > " \@x"``> #\`> > !X ""X@kdX> "c㿘@: 㿘@: 㿘> #쀢+!> ,@'>  @` !` " `@P"` 2``@P ` !`  > @P` > `@P > #\`> @#> # !> d> c` "d" "d > 耢`> ""@ " > #xДb?" ?/!"#x`##x> ` "`?/!"``"#x> "#> "#@P > !> # *`  0 㿐@P " А"@? &- (c (c& > Ǔ, "@*`" * * > ǰȰ?@o!  !%@j4 А> ǠȐ?@o   #㿘  &- (c`(c& > Ǔ. "@*`" * * > ǰȰ?@n  !%@ji4 > ǠȐ@nא   #㿘 , (> # `& ,`!"#> #\`H /m * . > #> cX> > "\@"``H 0㿘 , &> # ߒ& ,`"#> c\  H /m * . \ > > "`\@"`H 0㿘> `@"# , >  @q> `` ? Q"`` L!6`B < > cd` 0"`> cd +"cd> `` ? 8"`` > !@ >  `B < > cd`  "`  >  蒂`B < d "> cd` "`>  \ "` x> c  $ x> `X  "`X@St㿀> > !> > > '!'X'c\`'' @C H > xx"" H 㿐@*`" *  * & &㿐ݐ*`" *  * & &㿐@*`" *  * & &㿐@$*`" *  * & &㿐@> bb" &`" `& А"@@& &H > "" H R<S<SPSST`TVUTUP㿐!> ֠#(> >  pc#\ 8  @b > > #\#c!$  @a > "!@:  * *"*   6 *  ? * "? @*`2,  㿐@ 2`0'  $`0(@'? @/ `0`,?`$`0@J:`0 @@'Fސ@٘@'<㿐`@    ` A ` => ! @6 2`0&1  $`0(@&@ `0`,?`$`0@I`0 @g@&Ɛ"> @j:#@@@&x@ @  b 2`0q  $`0`` b>"H*` €  `` U ` (R`0> ! K(@&@ܰ   @`0`,?`$`0@I`0@&Ő 2 `0ܐ@4 `,?`$`0@I~`0@&0% @ &`  @ *@ @ ? *@`* :` ?* :  ` &`!  34`` ̒@`4` `'ؐ"~؟ 2`0` `@'`"}ذ "~` ?4`'` ؟`0T` 2``( <& `wذ &T` 2 ```("<  "@ `"D   &`@( 2!H  &``  `v` PT`  ``(  2`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W "%   h`0 d`0` " ,`% , `  ,`% ,   @@CT` = `(`R  26`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W      @ @ 2 `0`%  `0`,?`$`0@HW`0㿘` #@  `0`,?`&`0@HF`0F . `"" `0 $`0"    ?*` `&` `0`,?`&`0@H*`0`> +   +@@"   2   3 * +@@"  4$ ` ' ,@ @ 㿘.`"  @ >`&  *@ ?2   2*`   * *#  `  * *"  @> @h4#D& 㿘 .` `2`09  $`0"  *@ @>`$  *@ ?2   2*`  * *#  `  * *"  @> @g#2 , $  ,@@ |@㿘 @    (@$z@$0 (` @ 2 0!  $ 0 ` 0 ,?`$ 0@G^ 0  @, 2'` p㿘@ 2`0-  $`0T` "`(  -`  "& `@$`@\@* `0 -`0`,?`$`0@G`0㿘 />   @8@ @&: <`   <`  "@,  ?2 ?2,  `2``  ?, ?2,   , ?8??O `-    : "@,  ?2 ?2,   , ?Ð8?-  .`@@6$<`+  ` +@@"  2 3 * +@@" @4$ @$$ &   㿘  1 2* -` ' @* s-` "@@fi@f%@ `@ U '` :`: ` :`: @7 ,` '@,` ' @ >  > . >@eՒ$ >  ?. 1@eȒ$@ :  :  $ $@  '@  '$$$$$㿐   2v> > <a0  @;`&  *@?2   2*`  * *#   ` * *" @> @f:#>  I& > @f)#P= "<>  @^a p@eg 8 $ , @`" > @ $@" "@ $ a@a@ $a@" "a@$   `* "@$  $ @ "@&@& 0 $ 0 㿘>  @^%#@e+!$     @C$` $` @=@"ؐ`(>   `<` ``?4`&4`$$@$`$`$`$`$`,$` $` &0& 㿘 >  @]#[ <  " @ " @   `6 & < &&   `c*`@,`4`@: `c,` * @4`,` '@f ,` & &`:  :   '  &  &  @R, & ,  '@M & & ,`  < < ,  ,   ,?  @ "  R 2  `@ ?& ,& 0& 8& 4  @#`"  `  Ғ "`  `@ 㿘 &?* `F4&``" `0 "`0$ @9 &   @ ' :  :  $ @ '@ ' " @ "0@0 "8@z 8 "> @t > #@^㿀 ` " ,`, " ,V 2 , (   ??77 @ @ , 0 0@DQ& 0^  ? &  0?& 0T 6 0> @d#X& ,` #> !>   0#p @B  0`  /*  @2  (   ??77 @\    € `"  "` "@@)  `>  0 "a<>  0@dU#x> $a<@^ p㿀` @ 2R 6 3 -(  ?7  ? 7?А*@2     7 27   2   @     @ 0? 0 "\ 㿘> #,a   3`" \@ +   7 2S  " y #@2r .`"@ >` +`* ` #    +  "  @ ?2   3`* `+@"  @4O& N . .`" >` (*`"@   * +@   "  @ ?2   0* +@@"  @4&  >&  *@ ?2   2*`  +@*"   +@ * "  > @cn#2 }&  㿘  `` `,` $`㿘 @`(@`@@  ``@ @ 㿐!> ֠#(> > !Dc    @Z/#\> > #\"c @  @Z% 㿘`4 €`4R` (> Մ"`8 "`"  4(  `2``"` 4 `("   㿘@"-  > ' #  `  ,!  @'Ӓ "    & 4 6 ?Ȓ*  0 & & 6 ! & $!   ( 4   `2``"`㿀< ,@@    &    (  `  6 & (# 2  ,   ? .@  $ '77'''@   &  @ "  㿐  . 2` 2 > Ւb"> !D@Z @a && " (& , &$ ,& , ?",`0?"`0`,  @Aؐ`0 㿈`g@ r T` "`00l $`0`   |  2Z`0&`` D`( ' ' * ` g* D $   o4 @B ` 14 $ `  Q `  ``?&` &` *` `* " @ &` &`   &``` @&`0`,?`$`0@A]`0㿘V`    `  ` 8 > Ր"*` 2  "1`4@א 20  $0 `$ @`,:*`0@ "7` 2V`T @"-` "*` 2V`T @2`"`@2  `8* @ "` 2 2V`T @2`   X 23`> "@Y|  2$  $ 4 $ 80,?`$0@@ؐ0`$ ,` $ 0@&`&` $ ` $ `$ ` $ `@$ $@  .$ ,` $ 0`$ $Ho o 8   €   (  $ (@ H 0` " ` 8@@7 "` ( 2`Ho o (  $ (H 0`  ( Ho o (  ?$ (@ʐH 0ߒ@ ('X P A#@^'` ' ?h` @C@ 6 T!@ > !ē*@ *`" *" * P? ' '?` ?/a  '8''' 3`   -.@@"" ''Вb@ ??T!@ > !ē*@ *`" *" * H/` /``"`6`  #>  $`!@>7 H 0 ? # " '`'`"@$`` @ ` "` $`   "@H 0@0 (` $ (`?n$`  2  8` € 2   ( ?$ (`[$`& & & &  $&   ( ?$ (`$`H 0 8@ @vHo o " $  ($ ?$ ($ `?$`` $ `"@$`H 0,, ݔ Ho o  `2t@`"` $`"H 0` ,*X%"@   㿘 ( H /f * ' `A    @t:   $ H 0㿘 (@^Y p   :&`>`8&`H 㿘`  ,' ( 0*@ @->  @ 4`0 "`0 8@ 4!@X$`2  ,& 0 4 #?!  8*@ @3>  @  8@@Xb$`2  4 * 8> !D@X& ( 㿘   ?& @>S   ?& @sѐ @ 㿘  8` € "   (  & (@  2 8㿘 @@ @S@ 2 8㿘 .`0@㿘 8@ `4 2   @  @0`4$`8 `42  %`8`,  ! (!  @), `,`0*`,$* @@]~*``0 "$`,@Ԓ $`,$`0 `0* @@&&@& (㿘 8` 042  8* @@"@5> 5> 2" ( " 8@> 8`  4`0 "`0 4'@W㿘 H/` / (` > > > #c@]͔#&  & "" ( & (`"H 0  㿘 H/` / (` > > > #c(@]# ` "` "  "@ ( & (?"H 0     (  " (2   2 (x`(D% (% $@㹐  &a<    @@a 2 4X @  "a` 3"`@@ @ 2 4a `I2{ @@m  2t 4 @#\#`@ `#d` #h#l@w 2S>  ` T"   '&` > Ґ#ܢ @€ a4 8`"  2a( a(  ;`T ` 2@ >a$@8 a @@  a   $   ې` @>  4@V#0 4> @V#@遐x,! @@ 'L $,>  @T#ܬ@$찒 2, 'l'''h@''h''l''@'!> "h ?@t "hh'''''' '''Ȕ> Ӑ ' '' t> cغ @; 2> @\o h  "5>   J@,`J@   @@ ?  @ ?ؐ ?'``  2` K谒  ?` ?%@'  䀢 2`` ?-谒  ?" 0``?%@'n  䀢 #> c   ? "c * " b ` *   " А ? ' 'А @>>  L$ 2 $$ 2 $$ 2 $$$Ȁ`2> @[ Ӓ Β ''>`$"  =c    j8@& @87 '5?,bc 4b@f @, $, $ ?H@;$,@`2,`2 ,` 2,`",, *@$,,",@  ,!  $, $@ @ l"@( "$" g' 'R ( `   ' 2B``  ܀  ܀> @[ @g@r؀ @؀  `H "`H 2 > 2` "h""`(, ?",`0?"`0`, "`@:z`0``$, >$,`" ", ' H /i * * @>d$$$$ഖ  *@" " @ "`"`H 0c@@@Ta @  ," € 2 (L@ ,(@' @ ?`" `H䀢@؟€ؐ `,3 ,3 @€  @`$ @o,* @ u$,r!@okj#؀  ?'`@S耢 "@  @=@Sېcؒ@@ ?,*@D$,> #@Sʒ0>&@   @>`@S耢 "@x @S @cؒ@y@i ? @Δ ,*@$,@S 㿈`` ''  2U !4,  * * @  @'&@'  -쀢 6  @ ?' '  ? &`   쀢  ?  'ɔ   㿀`4'> `0`< /"  @~.@~&`<%> tL` Pc`< * '#`#\#d @n " `0> @Z `<@~ 0+`  * t@6@  @B&!L@~`<L  *  a`< #`!L#\#d@D >  @Z `<@~ 㿘@*`@  㿘 4 'H>`> !`@X  , "> 츐>  @Q! , w&!d`& , w H@8& ,?&!, @<&!  @<  @< @א!H `@2"!H` "&`` `|2``x  @%̔ @` ` " &`@ ` "&`@&`&`!H@ה ǐ `& @  ,@ Ґ . 1 8`" < <"`< < 8"@ ` "`   "> \\ & \ "` "\&  T`> @8b`! #> `L@}b`,( 7&`,@% 2`L ,@2 J6!`  H!d!d`@l  !d@ (`H& |  ,@ H ,@"  ,> "@J T 2 ,@7Ӑ ,@@  ((@  @% H@7 H ,@@@7@" > @ G"c!&  H`@@M㿘#> @M-c>  & 8 # 8"`<"& <@Mc@7H/` /㿘> բ#%> '> @M  @M0  @5 0 8`" < <"`< < 8"@@Mw@ ,    H@%C, 1@7` H0@T㿐@ 2`!H` &@`?" T    , @" ` 4  !H @ 2 L`  ( " L L 1B2L 1 ( 2~ LL 1 E  4&``  !`'ܐ 2` `"  X!dҔ H 2{ X " t@ $ X@q ( B ,@  @$֐@6`  t $ t@ 8 & t4!` !d@ H @r0N ``2 4`` 4$ ,&``  !`*  '2-  * 4$ ,&`` ?#'s   L 2` , 2` 2&> 8!  @5 "J T H > @2L "(LP PPL `T "L`TL P"`T`T"P"H㿘> !d@P!! @^ *@ `"  "`   "@ L`" P P"`P P L"@ @Ғ? `?  "` @@>  @Pj!! "> @z> #@P`> c ?"c 㿘 ,(@$  @j㿈!  $>(#``d#\#d  @9 㿈#`#\#d    @, 㿈@` @ @ "  $@ ` `@   `@2@` 2#`#\#d   @ 㿈> !>    c \ ` 2>   > > Ր h@9,c$ > @V!` #$c @@  :   p  >  t `t?@/c  #> `t @f  > ?@!c  $c  @N(# ,`1$`(`X $`@U($@!(a( (>]bА`@9V>a`$`@9Q $`,!$a , " ,o ,!`, @ '$`, , ($`,>  @M!$` _ ` " @ "! $a@  ﵐ $`ܐ$`ސ$` ` "$`@ $`` "`!H `  , `, $`,`, $`, @ $`@ @`@"`D& @ @$`D@$`H`, $`, T $`L T`L"`P& T T$`P$`T$``$`l @"  t$` $`@ t$`t@:a@)$`$a D€!  &! , @86 `$aP> "(#\#\@ϒ` > bb "b   @(" >  "   @"  "   @ ">   "    @"3> b%> 7> 9> ;> ! !܀ "b@W# $@b b`,h$`4 4$`X H`H `ܐ` * @  $a! "@a"`4!"`a 4"XX $`X`"` &X$` `4 T `P* @ $`8@ `8"`< T`4`P @ *`" `4 * $`< ,@"``>` @7`>` @7H/ /` Ԑ  4ab,`1@mH 0! ?&!`4 > cL` "`` "`d` "`d 2"`, `!>  !h @2c `,` `  ,(@!  `4%%㿘@m 2 @~ 2 >  \" 4"  H @2 24 㿀#d> 'T'X#\! #` "   , " ,T@Uɐ!7& 㿘  !> #> `4!pa7@Ug#. ۔ 㿘> #` 0 @   2> @S!@S $ $ $> Ւc,`""`㿘> ,>   "c c,c,@ $c,$ @ @ < c, c,㿘  ` @ & @n㿘 ,@RŐ @o6 `4a7&  " `> b> Ӫ ! @' `2  ` 8 ,@ @& Д  @ 2 6 $ $   *& ! @2'`2'" ', @Ro''@@ Ò  *@& b > @8!P#>  b@'&   ''7''@ *@& b > @8!`#>  b@'&  `@V''@ʐ *@& b > @8w"`#>  b@'&  >@V''@ *@& b > @8U"`> "'`O  & > cL  8   @ s `'@'`'`'@r %"@&`&'  "@98 8 @4Ɣ א@   *@&  > @7"#>  b@'&  .`>`'0'4'8'<@ޔ 0 ''@ *@& b > @7ː"(X#>  b@'&   ''''@ *@& b > @7"0P` ` @  *&   $ @ @'''''ܐ!@B 2|  @<`  @@  *@& l `>  X`X`2`@ &`# ` ``2`B2` =  !@  "5  `/` @i@1`@``@ `  @M@"  @@  *@& 㿘@ ( 2``&` `2`  &`?* &`&` ` @` f! 㿘 ǘ T`  L " Hh , @ ,Ȑ  '?''''''̀` '`(`, ''''`@ @s @ `>   b8@Q1>  X " 2 & >   2  ` 2 2  2 2 `&`,   |,PÐ㿘@Oߒ $ p & &?& ?& & & &     HR "  2  H  㿘> #     Ho o   @`p@  @ > @PL"h@ ? 2 4> @PC" @(` @> @P6">  @  > 0 > "@P#` *@& `  &   @ @@> @P#`J>-#*` € @  `0a ^` @2B @"/    &    `H 0  Ho o   ?&  @ # > > > #(c8@O!32 M  `&    @- & 뀌`   & 0c  "c  &  @> !h $!h @   >   > @O#  *`:` & 6 6  * &  @c?-"c @ ?&  @> !h?$!h @   >   > @OH#c? "c ?&  @> !h?$!h`  @2   4~   f  & @ "2    &    `H 0  Ho o   ?&  `# > > > #(c8@N!& 0)2 M   `&    @- & 뀌`  *@& &  &  @&    > @NĐ (    @ @.Z @  `0  ``@   @ > @N P  @ 6    6 0  @֤   @"/    &    `H 0  Ho o   ?&  @ # > > > #(c8p@NA"732 M  `&    @,d & 뀌`   & @ M   &   `   `H 0  Ho o   ?&  `>    > > > #(c8@M"?  & 0. `&    @, &  ` 2  M   @ *@& #  &  @&    > @M (  ; @  0  @> >   @M  !(@Mc?"c  @"6  ?6  @> !h?$!h   *@& 0  >  ?&  @> !h? $!h@Mr!`c?"c?&  @ @-0 @  `0 `> @MO! @     @<    `  `  `H 0  Ho o     >   >   > > > #(c8@L"' & 2  @    &     @+ ` 2 M @   -  &  @&  @6 26  @> !h $!h @ > H 0> "(@L c "c    @      *@& @,<  @H 0㿘   >  @N"P0 @>  > * "x@N: @>  @M"0>  @M"0@M" @  >  @M"ȁٰ> p p > #8"#8㿘?2   0%$ > c8  #8 #> `#8#8`!c @*J 2 #8 `#8  $#8㿘  @ H>  `p?& D & `& `$ ` @``$`  & $p & & "@" `&& `""`㿘`"  "`> " t "@t > " x 2> pp> b!>  p  '`   $@ &( ` pТ   &  p/  ,@K 2  $@2  & > @1-#㿘> c< - >  x` `D? x`,e` x" x0"  x> `t4@  x" 0 x"$c<" $c<> `t @  x" $c<㿘?2   > c8   !>  x  #8  #8S x#8#8 @* 㿐> !d`'0# @c  0# @[ c @1>  #@> #@ H'c@V B'0# @"0# @ 5'10 #@#@2+ > " x`" #@  "`x1> $ & t@" x0 c""@ & `"x"4 t"<@ x"`8"`0 & x0 #@"`8"`4"`0& > Ր "c<1> #<? 8   >  x`` " (`ؐ @ 'x``    &#<x "#<? 8   >  x`8`4" (`0 ϒ@ 'x`8`4   &#<x8 "8>  x l#<   2 7> >  x @  "@ @Iz xs x  "(   ' &#<Axbx0x84@  <, dl x> "D<@Kx` "`F&#<:1>  >& x`(   6  > q"c< x0$1>  (& x`(   !' x> $&,` &,@& &L@LB  x &`, &`,`&`, '㿘@r㿘@Y 㿘>  p "  , ,`@I 2  "  2 , 㿘 ,`8 >`< "` 5 a/> Ӑ! >4c     `a/.`@ 2`a0>  >  !.``  `  $` ` > ӑ.`a ` 㿘 ,` 4`2   @J @p 㿘 ,` `~ "`   "8`  ` `> !@  > "L>4c  "L `@  2`a@@ .`h 9> !@@ 6b .`$> "L, ` `5 `>    > !D>4c  !D `@ 0 2``䀦@ .`5 >  䀦@ .`- > !D, `g 0` 0b$` ` ` .` .`"> * bL `N 0 > * aD `E 0㿘 ,`D N`L "` E `>  T  > Ґ# `   `@ ` @ 2` T@ .`' >  T@ .` > Ґ#ܡ, ` ` a$` ` > ғ.`@#ܓ*`@` S㿘,` >2!@*` €  ߒ    x> #.`@`> @H > #L*"@ @ h> @H  ` ` `5 3 `@0 . ba) ' d$ "  @@0@  @  @@@   @  - "@> *`!@H /f4'* ''@?> զ#cT.`'  4   @%Ϙ @ *@  $ @ 2n@> cL* @$`cL @.@ > L@< , > c@@|L 2> > @Gu @H 0  #> & `: ` *@ B <`2 > cL* @ 2$`&2` ` B > #Lr<`@"@7o$@   @b" *"@2`"@" "`` "$`@ $@ *`2` > Ր#T:` > > "> #`#d ؒ`:`@Hj> >  h@   F'> #@` '`` `'>  &`` h @%`  @`" 2`` &`@@R @` ` m @> #`> >  p``#\ @HR$@?" 6 7o""*" 7o" 2#\*> > #L&`&: > * R@@> @F!> @F!(H 0 " 2` *B? <`$``B <`$@ $$H 0 㿘> #.`> # @> !x > > Ր#T.` > !@@FOcL`& > c: * R+ > " *   *@ H /f * ' cL A> h#`b` `@`3 1 / - da( $& $ ," ( @@40@ 4 0@ < 8@4@@ D @@ L HT#*`  cL> Ր#T.` > !h@E* )cL> @@{r+ `( "$`44``  6 @%h @?B$@< H 00r7o"@ `> '> 2`!@G2@EḀ`    7o""@`@ *"@6   4 * @ "3   $  3 2   $( > @Eu! (@8  02    ,@(  0`B < 0 ``"B<  $` 6@@$@?`$@$ " & $ H 0> D#> H> > T8"HcL> #> T8"cL> #&cL88H*"D㿈%> t> #L!> `P#D7'> `#\  @y> "c@> > #D"#t"x*`@z > '> a#L$㔠`(  *@  @Bِ:  cD#* @*`@G: !$? 6$`` ``` `"3 ``  -0`"  -> P )> #"P @Cު  '>   @$,@ @FY@Hf  @`#* ʖ#(( "  @ 4> > G"`E"4> > @"># $!4> > 6#@4#x4> > /#-#耦4 04> >   X4> >   Ȁ @4> >  ! !84> > !p!є 8''  8 j > * 㘖  @ ^> a R > "  P> ՠ#T .   @G@ ``  Ӑ@C0$> > ը"(cT  !> . q$@ "0@E @G @`@*? b> ֔ _J@ "*@ ᐐb W @o> L(L`7*(   . ,  @) ' @"!"" !$($    @(0㿘 @n 0 &㿘> `#@_ 0 ? &㿘  "@&@ 㿘"`@ 2 " 㿘`   > "> #  > @C"" > @C"> #  "> > @C"ؐ"@C㿘`> @C#"㿘`* @> *`8@  ? @ > c ? $3 `> c ?` a @'>  @ ( @  ݀` 2 # @2 @  㿘@"Z㿘> `?#  @H /d * % `0 # !> `0@&`0 #0 @  `0``0 &`0H 0&`D&`4&`,&`p `@@-` `"`)@ &`0`*2 @ &`T@&`H`(&`<&`<`<> @BT#8$> @BO#X  $, @tJ  `H@sǔ `0&`4(&`00@ּŀH /d * % `0"  !> #x @ @ `0b `0 &`0H 0@ڒ`H@s?$`0h"`<`4 " `<`@@@> @A#$`> @A# @"  $`$@`;`` B# ?` '`@ ` n``@&a@H /d * % `0?# @&`0@"0 `0 @`0*@&`0@!XH 0㿘>  @9ސ!İ@@ t!P#!& 㿘 \ @ 0 @"> > @A#!@;Z <@4" <㿐> " X> "`\!> !؀ %>  >  ): T@ !$P`#> `:`>  )@  !؀`$bĒ`:`>  ) @〔P> `""bĀ !> > @AL##(> > #\#`!p  @8G > > #\!` H  @8= > > !,`#\ P  @83 > >  `` #\   @8) > > "`( 0   @8#\> > #\!`8   @8 㿘> #> " *`   2    )֔ @   2  )0 @@& $ @ $@" $@$ 㿘ː @ " > @@ΐ @> 쀢"   42 H 2 4 > T> @P( "   4  8 2 4 > > @ć( "     2  㿘 "!H> @@ X!H  @`> @@z O@  4> @@r  > e  `@8 >  @8" $$ $ $ !H     ,> c ?& ,  $` > @@H !H $` @ "@$`$`> > "Đ@* `$@" "Đ@* @"@$`$`"% @Y !H@U  @` D"`D D @"!H` 2&!H@# &!H` & @` @"`D`$`& D 㿘 @` D"`D D @"!H` 2&!H@ &!H 㿘  `"`x""`x`"  "` "@ ? ">  @9">  `@9㿘 H!H@` ` 2 T` &`? &`@% T !H@" L` 2 L 1?  ` "`? "`@  L 2!H㿘  L 1 2 @  @  @   @ 0 2L 1㿈 1  *`> X:@A2   4*`:`> !  4>  ,> !7aƀ!`!4> !5"PƀN!6>  "p ƀ !P>  ƀ" |@A d |@BL d t>  x ƀ >  "#\   ƀ 㿐N   n.> J#` #N@" L@`L@ 2`L@m> > @@# > @@#H> @@#p> @@#0n Xwa0/"0,> > > > > #Ȓc@@g  > > > > > > > #\ `PX` h@@U`p> > > > >  xc@@H ]%> ª)> N1 JH> #> `   *@@54L@ n">  w a"P6"&2  7@@!+ 耤 ? 4H N1 "#\#\#\7#` @@, 7 > ! @?2N1>  \ 2N1`` 4"``H4" H4 "!H "㿘@` 4@"!H 2!H  !H`   !H `&㿘@` 4@"!Hz " !H!H`    !H `   4& ` "`"  " , "" ` "`"  "㿘@`  R` &R @:`   F.  2& 㿘!H 4 @ " , " 4 :  4 &㿘` @A  4"aH "5  2aH. !H`  2( `,@"aH! aH ` 2`4`4 " ` !H   㿘@ ` ` `  Ԕ ` ̔   Ŕ `"㿘@`?` ? @  ?"n  @?h       @& 2S @ @   @ @ 2=? @? @ ? @ @ ?&?   ? &  `@@  &" ", @2& , !$,㿘@ ` ` `  * ` "    `"㿘@`?` ? @  ?"[  @?U       @| 2@ @ @   @ @f 2*? @? @ ? @ @Q ??2& @o&" 2& , !$,㿈`@ ''` @2' `@  2 '? ?'?'o㿈`@ ''`@2' `@  2 '? ?'?'㿘`@`   @ 2 / @" @  @ @Ԓ  @ @ʒ 2 @"$ ? $ $ @ $" `,!$`,㿘`@`2  @"  @@  @ð $" `,!$`,㿘`@`   @ 2 & @" @  @ @r  @ @h 2$ $ @ $" `,!$`,㿘`@`2  @"  @@E  @j $" `,!$`,㿘`@2 2@  @R&``ゕ,  22` `, !$`,R` `(@ :    *   ` b2b @ 㿘>  @3!!,@:' P &㿘@? "@> @4!,㿘  n P &㿘ՠa P &㿘`  &`!H` ` @㿘   !H  @⭒` ?"  ,2  &  㿘@  )  "`M "'`I    2:N!69 )` !H . )  * )N!6& @ 2N!6 ) >  `&`>  X  )` `2 N!6&  2  ) )?&  㿘@    "`R "-`N  f A`@D; ` !Hj 1`  -``@. @ `"` >  `&`>  X ` ``2  `@`  2 `` 㿘 @ ` ``# 4 &?Na66 .a6  .a6H/ /@!SH 0 㿈`  @@㿘`(  .`@  2 @   2   @ m " v ` ``  `"`@q & `> ` `` >  ! !> !> !ؖ :`? 8 >2  (>@8  ` @`>`2)@  " @82   ( >" "  >" "  > #P8     @ @}d  << 㿘@  *  `O  㿘H o4+@n   H 0 @D@B 2 > %%&&&&#\4`> !đ, @,`b2*@ *@ b 2`* @ *`B2*@ 8*@9 Д @9@&Д @@9x6`.  .`@c3`+ +` b 2**@C3`+ +`&  @9v Д @9p@%А @9O@)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@9M Д @9G@&А @9&@&㿘@ `   M `  H` H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿐#> a@ !> > ֐#(#\> "Ța8   @.  $a@"@0  w  $ $ 㿘`? "`> @1"ȁH> ֖ᨀ" > " > `` $ " ""!#!H H> ֔ᨄ > ᬀ @2@@"@H > "  22 㿘  9  >  ! !$$ $ $ >G!v @r@ >  " 2㿘>G> " H $ > @7$!P㿘> a )> -> D+> a#` !> a9"! `@/ !#` aĠ`( $ > ֦! ` "`$  " 2  @@   a 2a > > ֆ" !   $   ""   "  2 " "  "  ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! = = = = = = = = = = = = = = = = = = = = = =И C A2 ,!HH  ; ,4>Gԇ* "* @"% @ 0   " @  @"  @   㿐> ֒c(> > #\#a!<  @-' 㿘>  @.R# $ߺ!< $!8 $"`$ $8 8㿘 $!8`@& $㿘 $a8? "a8> & $@/#㿈@   $` ` `2`Z ` G,`@ `'@ $ $  a*@ 2$ a 2a  $ a "a   $ a `  @$ 2  , " ,  $  ,@"   $   2   $  `* $  2`   "@  `$(H*`"  ("?`" `,#`,`4"`, 2`,2`,`,(#`,8"8"@  "  " "a> \2 4 "4 > ք*` 2a,a ` #a a,#a,a0  a, #a,a0 #a0H> ֖  *``*!,"!,``*`㿘͐!0 ! $> ֤!!0} * 8 &!0*` "! !, &!,! &! *$@!0`2!0 $a $a$a$a ,*@& ,`P`"$`P( " H   "` "` ?( "(`(("(?"(H  !  "㿘 $?!!(`$!$!@ 3> &!(!(a @  㿈 $! 2`!  $! ``"@!'!'!  ܨ' *@ $ ܗ   !  ! ?$!#@  ! $!$!$!$!  㿈 $! 2`!  $! ``!l *@ $ [   !  ! ?$!#@  ! $!$!$!$!  㿘`` / @  2`$ I 2` ` @= `    @㿘 $ >  XL4 $,"2 `@24/ " !H 2 (  !4 $@,"2@  ` 1? @ג@24  㿘 I)  B  >   "  "   2 @@ @ 倦0`    "  "   @㿘  R @ 㿘   ! , "  @2 @@_ @ 󀦠 ,  $* G!0"D$a0!(2@$a0  @` t.`x@m't@!(\ < "<!'t` @!(`@!( &!(a@`!0* &!0> ֐!`"$@!,&!, $@$a0$a($a,@$a$㿘 ( ,> @2t!@! Β@ > ֐!.`   ,(* !,!( !0  N!6  .!6 !H ` !  *@&!  !  , * *&! & ,! ` &! rN 1 nH/` /N 1  %> L# , UhP `"6! `D`2C!4`F! 6!`* H&! ,`  @07 ,4` +    H@& ,``! *&! "!4  . 1`" ! *&! @0  >   "c!4 2 2.!4@)H 0㿘> ֢!!(!  ,*@ +  X ! ? * !,*@ $!  ,("!( , ((25 $4!`H  ,@@  , 1@*@k H @o@dH 0 ,("!(!` "!(? !(*@ 2!(! * $!  $. @`@`< E!  4`> !@2ޔ!(* ,(2!(!H `2 H2!( H4!``,   Ho o @@H 0r!(2p!( ! 2l!( ,(2h!(> @2!c!( $! 㿘 ,*   H. 1@& ,> #쀦 $> @0!  ?* *@$ . a$@@  a(a,a0 @`  x't@ta a(ހ  @`0K> (> @0!H/` /a  ?a$a(`@( $(a@ 0* $0> ֐!`"$@,$,$@H 0 < "<a$@2't$a0$a$$a($a,'t ` t㿘 4>  @0Ēa 4> "@1 㿘 ,!b@  6!b> & ,.`` $@ "a$ "`X x> " ',aB b,!> "L` >  cL  ` *   @: @ ϰ  D b\`$`7` > $` 0@1֐ '\'X'|''X#@a! h b@K <    6@p  ? @r@=bP4bc0y!pP@ߒd '@4($L'$'(''` Ȕ*' ̖+@' `+ + @'԰ H -Ȁ 'Ƞ #\;`#h#l  ܘ А @ג .`> Б* #`Ȕ"` *  Ԙ #\#d#h#l @  #`#\#d#h#l   @֪ @  @֊z "b > @"8㿘ϒ  N㿘@. &&  & ` >H T*` €& &  >  2 " 4a " "a   4   `2``"`@*@   "  @ 㿘  > @."H  `> #쀤 `> @."XU Q` `?&?&8  "'@਀ "@  2@@.# "@0# 2@@ @&@`@"$`$@@"B &>` 2㿐` 2`> @."h``4@> @."  2` &`&@  "  /ܔ   0*  `?$ $```B >`&`㿘 > @.W" , *, -,     @?*``@ &&㿘    2&  `&  && " $  &" $ & $㿘 2 2@> @."``"`& `@"@碒 㿘`  @  2 0` "`&  " € `瀒  2㿘  巔  2&  & > ֒"h`"h && "" "h㿘> "h"h@  @ ` @@@2@`2> @-" "hh@ "` h@"@9 㿘H/` / > ֐"h  €  2 0> "h"h    € 2 H 0 Hd H H H H H H H H H Jl J J J J K K( Kh K L L L L M MD R Mt M M M L LH M M R R J M N N( ND N N N N O N` O O O O O K| P PP PD P\ OT P P Q Q8 Qp Q M$ KD KP K\ MX QT Q Q Q R R0 M RT R R R JD J< JD J< J< J< J< J< J< J< J< J< J< J< J< J< J< J< J< J< J< J< J< J< J< JD J< J< J< J< JD J< J< J< J< JD J< JD J< J< J< JD J< J< J< J< J< JD JD JD JD JD JD J< JD J< J< JD ST Sl S S S S S T Td T T T U4 ]p \ \ \ \ ]4 ]T ]㿘> > "0!$ ! > > !h8!$  > > "H!$  X`   'Đ x` s @*Ȱ lȒ?` #>Q *` €>R` ! >T#>#>!>  > !x>"|>"tE -` ʔ  <`  #> b 1 `@]ޖ  b  0#`#\``ğ``` @]ה> " Δ  ` `Ԕ x> \" '`?`9>Q"0*` €( ?`E">Q!*` €> >  Ðq> (> @> ǐ!> ǐ!> ǐ!> G!<> D p> A"А?> 9 !> !d'@첒 H E!d 쀢6 $!d@6$!d`4  $!d > !@! )`'> $"!`>  `@! `> ""!> "ܐ'@G$"ܐϒ> ʘ @tw@p @h@^c> "a     > א1#> א*#> ؐ#"d> n"!!&a f   > ֐"Lf a \ W >  H a@  H>  H a@" ذ    #\ɰ> d >  (>  @ @gg> !> "> # @y @(Ӗ!> # '@C䲒 ``}  y #@$$# s @Bk> _ @> X D> Q H> ֐J#d @QF @U= @6 @k- @$> ǐ@ט!䲒 @v @Ț > ؐ!T@ - > @#X㿐 \`? ?` >Q#*` €> <0> !6>  d_> #>  cTV* > L> #  " L* > #LG @ِ h> "t> ’h@EX @Ð  R> #H> ֙*` + x# @n+ C> #H @96> "`1 -@ ,@L$3> a  -1> ֐ @"p 2"p d d&"p"p &&"p a@"p  -㿘  @     `&@ф  u 㿘'P` @     `&@Pa 㿘 @ *  \ -㿘  @     `&@0  ! 㿐''` @     `&@  㿐@#\㿐 #\@㿘\@,[ `  @@  `,  `% ` "&@@   ?*?@ɐ@@*&@  б/㿘@,   @     &@М㿘  @ ` `&@Ё r㿘` @   ` &@`㿘@  > !< ` *`" *  (&@`!> "&@!@E  !@&&@   `72 8   8&&@ 㿐   @  ` `2    2    "Ȓ |   `2  `&   6     "Xd >  Xl' h9>Q#L- €`4aH$ aH ` "W`  4`, "Q`aH ` "K` l2G```2?`` @28` `,"22`E $7@Jϝ!p 6!pϗ"Ȣ 0$8;d8 @̒X"Xτ %?@``2N`1  >  \ '$@'@ !@'@  㿘&@!H` `  P&` &` &`  &` &` &` &` ~N 1  1 8 !&a0&a8&a<&aDaX@& ! &bd   &! , @X@:&a0 ȐaX&a8 Д! &a< &aDT  &bd!?&! H "&bh 4&bh!H &bl!H 6bp , ?` `?`l&bt`x " #&bx`|&b|&bt`  @ &b!H `2 &b `b> ’#h @%S `.b`6b&b6b6bb@%I .b! @%Db.b    P>b㿈@%"X >   >   >(  >0  >8$  >@H  >H>Pd >X&`(&d,&h4&lH "&p 4&pH ` "&t 4&tH? &|&x @`&`&@&` &`&0`&4Ϡ`@ 6H 6, ?H ` `?`l&`x ? &|`| >P&t8&Ԕ &&x&|&>>>  >& & (&$,&(0&,1.06.3`64b66@*7 @*8H`  @$`N1 1 8 &&&/&@& & & & >  >P >1.0&&&&4.15.2`P@)Ҕ  >XH `"`` &`H `2` &` "1 P>@1?   > >&, 2@WE`&ؔ U&&&&&8>< ><>= > =>$> >(: > , :`> 0 :`> 4 :`> 8 :`> < :`> @ :`> D :`>HP?@'TL '?/a  ???>H& &$?&X`'T `(     - 2 1   & ? ۰  ,b@Ұ @ϰ  >   "Ln =?c?T  ''''''''ܒ  @W   _  V ,``*` '`y&@:w  /> ̯  w ?T'''''''' @Wd c "VL '  ?L'T" '''''' @WG F L  @`@@L 2`@ +d ,@@&'',R  ` &'`@   '8 @n g 㿘> !h Z > c< o > #@ `)>  +> `,@'@`"t @ bx "> : > #H * * "  * %bxq%"t%bx l @ *`6%"t> ¬#p "t$`,> –#h @%?"t@'Kbx@`, @'ΐ`4& `8> `@> `H> (`P> 0`X> 8``& @`d& D`h& H`l& L`p& P`t& T@`ѦX "t*?-%< *> #@`"'ah%> ֠ x `,@'`4& `8> `@> `H> (`P> 0`X> 8``& @`d& D`h& H`l& L`p& P`t& T@` Xah ҵ  㿘`"԰    > ʰ  > ư "8   `> " $ D"  <& @@&  Ĕ @@" >    :@) 6@> "4"4`&@`&``&`` &``&` $&`bb &@ &`  &` &` &`  &` &` &`&`> !!`&@`&``&`` &`&`  @K D@ ">   > 8  > 4 , aؐ*    ",  , @*``$ , *  $@! #,   , "@*``   , "*  @! $@@: "&ʱ  "㿘 @ 㿘`   X 㿐 `< >  T4`> /  T 4+ '> ґ*cܐ * `@`"      0`8 `' `&`8 㿘> !> c쀢a>  p`" Ho o>  #H 0 H 0Ȱ  @ @`@ ύ H/` / > @!#xL 1 " > @!# "> > @!#> #b$ ,!4$ $   " ""$ @"  ,!  ` $ ,(!(@ ︐    @ , 1 2    , 1@`"@> #d`> ’c@9 @6H 0 !5> *# , d$ , { $ ,  @ @`@D #  > #@ܐ * 2 ! `"   ,(!(@ `   @ @`@2 $   $?a *  ?  @ @`@  є  㿘H/` / `N 1 @H ,@  ,$& ,H 08>   2 ` ""`"㿘H/` /> > c"@ A >   " 1> @ #Ȑ ( *`@ :`2($ "`@$`L 1 2 ( ,@ , , 1` $ @r> > "#"a> @! `Ĕ0 2 H 0㿘?㿘@ 㿈# @>'` '> Ð @!ВX > !d`> #x#x`` > 0 #x > # @> Ð H@!" 0 bb? #b  ?/a  #b H 0@;H 㿐@   0i`< 㿐Β `'  2@``l 0  㿐@  2 > !'@"'`` p@  Y#@'а'@= "`L  7  > > Ð!Dx!  ?"  #" ` -"@'ܐ" '沒b ?"@'"'沒b ?耢 6`''`ǥ 㿐@   @;@ǖ   ``> ǐ!nj 㿀 2/@ v  &` m  @ *`" * *''䀢  ` > a"a" 㿐 o@ A  gc*" * "@*`@ *` @` #`> ր@"|# > "|@4> ǐ @> !̓*@ *`!̐@Ғ @Β`& H /i * * > "> """bH 0 ` !В"@@w'"@@'`   㿀@ T H /i4@* *@ 0 ֐  ' ' ''쀢,䀢 " ''" '"@ 'Вb@ ' ' * ''''H 0`ƅ x@ 8y ` p  2o`` @?  a ]@ 2X @ "@Q  . @耢 쀢 "D@Uؔ?ܐ '耣 '?/a  ?& & & !& @H /i * * @ * """"H 0  㿈    ?/& =& ?/b@!b?     & @&  @& & R @ @    "" '耢`'@??Ɛ?$  ,@ @ϒ }x@8  Є?`  2  " > Ȁ&"  >  &"  6  "@ @" "    "  "  " " "  `" Є@@" "  㿈 "@' "'Вb@ ?@@`       && 㿈"@' "'Вb@ ?耦2   耢   &&  &@ @  @ @4&@ >  > #  " " " 㿘  > @} `!> > Ð @v@"> # @  ?&  & "@"  "` "& > b`&& `""`@"㿘!> @y"  "   "` "  &  " @& 㿘!> @a"> 〒`#〒 `> "*` @@ > " "  "@ " #   2F:  ' @@  " "  "@ " # 】:` .:` ' @@  " "  "@ " # 】:` 2`*  @@  " "  "@ " #  @ @{"㿘> ֬@"> 쀢@ > "+> )@'@ "` " c"@ a !:` `  !42`:` "#* c `" # :  !42: "#* # c"@ !:` `  !42`:` "#*  " c"@ !:` `  !42`:` "#* "   ` # @ @p쀢@@㿐$> "&%>  6 7 `2'> Ú ' > <`" Ѐ  @:2 㿘> ##> @ > @ > ֤@/"> Ȑ"> "Đ?`@㿘> >c" ec8> >c"X 쫖 㿘!> " > $"""㿘> "> b!> ֟€"> "2 @> "@:`㿘!> "  > k"> " 㿐> "`? -   075> 'h . !> > D"> bb€ &!> ֒T" 5> 05> 1" !> "`> b> ƙ"2 @:`㿘f @7@㿘> Ð! @Y t t t t t㿘#> aH>da”!> !`>dbD@aH@.!`㿘> #쀢> ǑH /m4* . "  "H 0 > aĔ > > "cؒ @ "㿘> >  c\*> #X > > > > Ð!8aH@! X l 1 ?` $   $ > " | 2 `T$ |H /m * . d |  x x* *  @<* @$ | t$ x@4($ tH 0Ho o @d !41> #쀤  !5L 1 2,!4 ,  22@" ,!4@} !5@},!40,!4H 0  2 1@f> 1#> !㿘>   t> #d`,> Òa@}b , @& t &  & hŏ@ђ "& t ? & & t@㿘> #Ho o !5 ,!4@}E, 1 `@ @+"`@H 0㿘> #> @3!H/ / a5 ,a4@}$,`1``D @ "`DH 0㿐> #> cd > Òa@| ѐ> ! !  # " " ' 'Вb@ ?`Ԕ? $``@ $`?/a $`$```: @ (2   8#`    M `I  @8 2 `  @(``B <`>  ?$`L`i"k>    >  㿘> #d`> Òa@|z N 1`*`>d!0 €> @! ,( !`!  * @&!  , `. 1@|l ( , , & > ! 0 > !4 #  > > "c"㿘> #d`> Òa@|5 N!6 *  t @ 8  .!5> # `@  > > "c"㿘 t $ @8& tH/ /ҐH 0!4 1!5.!4> , , > $ $ > 4 4 > #> ֆ⠄"`"#  㿘   @> b  `> @|"V` `> > @u" V`@p"(2  @ 2 `> @Ԑ"0  > `"`@U   " &   "& W & &  O 㿀''''耦` `  ` @ > #' ,'"$  * 2  (*`: * @*``  2  V  2V   2> "`耢`>    > @"@"㿘` `  ` @ > #4*`$ %` * 2  ( `*`: * @*``  2  @ݒ T ` 2T` 2㿀> R`'' ''''`> Ƞ"V* * @ 2V 㿘@ @'"  !> ֠"ƀ * @i 㿘  > Ò@Z"  @ 㿘  `  ` ` @d `* "@V   V `  6 6 > c$&```&``""`@Z`> > Ð#@` > #`@` > #"&  "  2 $V `@2 $V "6 V 2 $  6  $  뀢2@~㿘@ /`> @H#  %  2> @?#8@~V`  && ("& V` V` > À@ &  *`    @ &   *` 2  V` & > Ð cp @Ғ  (& $> @#x ,  , @, .`@$.`$.` є   &@ "> > #Ȓ#> @#*`@"@ u $ * ` > Ð#@̒ & ,㿘  ?* 2   > @#  @  € - `> o  @  ` `> `$2`@P`2`$> Ȗ"`"! 2$R  R @"2 R 2 $ R @2$ 怢 `"  "`> "#(  "@@( `@* "@> Đ @ @` 6`@@ 2 `   *`"` @Ւ $`$@ 㿘`  ``(  -   $`(€ 2$`(㿘`  ``(  -  ?$`(€  2$`(㿘 $ 2> > @ #, > 2@`Ȁ2  ɔ  2"> @ " "#, " "@%" 㿘> #, #,  $@` $`$ " €  [@ `2 >  㿘> c c> @!c?"cc`D 㿘> #$` `$2  Ȓ "  "c$ `2`$ 㿘> #$ #> Ē``$```0 5  I @aH - 㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,? & ,͒ 㿘@ (&> @%!x@ &> #4 & ""  $"`$G" $`@@&$"="`$$@ @ $ @ 02`T T&*$$2$$"`$$2$"`$$""`$ $@ @  2`T T&$$2$$"`$"$ (   @*`2 㿘 D? @2  ` `4  a> Đ@a>!>  0,` :`> !> Ě!> Ę! Đ!` > Ĵ! Đ!ȟ@ `% ` <`(@`,  `8@֐> ĐД`8@j`,@ɴ`,@c> Đ!> @ @ > > <"#H㿘 > #H`>  #@ "   ,@)  2 , 㿘 ! … @ 0 $ 0 㿘 0   ,  !&  "  `& 2 > @!@D! @A" `&> @& "@"> H>   "H"<㿘 ̆  ̃ `"  "`> "#D "> > H ?"< "H> @ΐ"0㿘 4  & 4 h㿈 4??& 4>  ,@F"Pz h"@' l"'Вb@ ?? p t & p & t?/a  & p& t`& h& l >` P 8@ CB> 8> P X @@ CB> @> X H`B > H s@ 㿘   㿘   㿘H /d * %   > H> 8> P> @> X `& p& tH 0> )> "4" '@" "4!? @4  `? 4`  . * > Ĕ@"p4` `*` > * aD'>   "> "4"@ Xe  `e@ "> "4"@ - ` > @"@ ">  " > @ 2 @ >z " ""8 > @_#>b > h#@㿘!h ɝ   > @#P!h@k>l>m>mc T&& & 㿘B 㿘`, "  J!6     } `$  0 tt  "  $"`$㿘> !x"!x"`> > Đ#Pcp @ 㿘!> " " $""  > > & > & & >$"& & > ax` & `""`> က2    "   >  |   㿘 "i   `" a  ^ ?> !x > #P@2   #P@2 "3 -6$ -0. Ho oH 0  ' 菔   2 绔 㿘> a > "ጐ "aጀ` > Ā@2`@#x`@ጔጀ & ጐ "`"& 㿐!> !  > > Đ#pc#\   @  $!㿘> ! @  㿘@ \`> @y# > Đ#В@> @m `+ > @f (  `> ŀ @\ ` @& ( 0& $`&    " " ' `" &    2&  & && & &  &  &   & ]㿘 2 > @ " `"`"@@   ` "`  " ɔ 㿘     @ 9"' '   ' "  & :'   + `2@&  @ "" & `""`"@@ @0 ' '  '" &' 㿘 > @  > Ő @ > @!:  > Ő!(@> @}!h@ * (>  @!> Ő!@> @i!@ 2 > @" 3 `* `&> `     &  !X l " @B # ``(` < 㿘\'H `> @#"`d 2 > @"H *   >  "@ > H#@> @#8H& @ > Ő#`@> @#`> @# @: > Ő#@r> @ 0@ H> @f X  "?         > Ɛ @M> @   *   " S?L 75`%? @  "  `  ?@    ` @8 ?`@ _` `{" x`:  "  H?? :8`' @  "  `  ?@    `? @`?@ `$ `-" *`` ` `    &  !> ŔX % ")H@  #d "㿘 > @ ! @  @3> Ɛ!8@`> @ ΐ!p:  @%> Ɛ!8@R> @ ! 2  @q 2 j K @ ; C@2  2 `""`"@@ >` 2!@  2@  ,@   $` $` "  $@" "$`   @  @Đ> Ɛ!@> @ a!"  "`@[  " ?&  㿘  * 2 !> ŀ`"`'   & ` ! "X W 20  뀎` `"  "` !"@H /f  .` * ' .`> #p@D `H 0  & 㿘 `>` &`  &` &@ " &  '&`H /f * ' > #p@H 0  &` &@ " &  &`    d& 0H /f * ' > #p@}H 0㿘 2> @ ">  >  "( @bP   !>  "x@   2 㿘`/`a> "H        @  a&&   J `  @   > > "`D"<> H@a``(`` "`"`&`"``` ` "`"`> @   @ > > @ L 㿘>  H H/` /  @$%> '> ƀ LH 0E #`$L!Ⱆ " "  H 002 @‎H 0> `L ?"`Lݔ  `$  @&`$ ``     " 8㿘 H/` /`A>  H`` > @ `PH 0 R > H> ֆ>  T"8" T  T`2``"`H  <`` " ``@ 㿘>  @`> @ { P#> `L `L    `L > `H`L ?$`L   }@"0 ~@w@<?0>@; v@(?06H> H   H`6""> H @"> L LL L> `L"` "` "`> \"    Ш H x    ϸ ψ  h" "" 㿘 ` n*`>s" €H/` /d& H /m4_& * .X& H /i4S& * *L& H /f4G& * '@& H /e4;& * &4& H /f4/& * '(& H /d4#& * %& H /`4& * !0 H /`4 & * !& > @ a" > > Ɛ"ؒ@ X &㿘@ > > Ɛ#@ J`  "@`H 0 㿘 &`"&`@J` @ ?@   &`&` "`4  &`&`"`& 㿘  @!` @ ?@ 2  `2  &&@ "  p`#t#p7 ?@ 6 " ""9#  $"/?@ $ " ""#``"`?@ " 2#`# t" p #pp`#t#p& 6 " ""##  " """#``"`뀢`ր`#`# t" p #p㿘` 2 D 2 D> @ @#H <@:> @ 9#h&  D <" & D@`"``"``@ "@ &@" &&``@ h 2 8 pH/ /> !@ڒH 0 8 `& 8@& 㿐\ 2 > ֠#(     > #L$  $ $ $   $  ?`$ $ " ` ( @@ @ @ (& > Ɛ#@Ȓ& & &  & & > h ?& 4& `& L& 8& ,& 0& h& d& & $& T& D& H& & & & & & & "h& P> @#  & : @ & h & |& | & p@ &@ & ( &@@   & <> > > ǐ#ؒc0@k!@ &@> a& t& x& & & & & & & & & & l` >  > ǚ`P (   _#\> > ǐ"``X#\ L  U > " l&> ֔& "@"& X  X& \ "$ 㿘 X`" T \"`\ \"` \ X"@  !> @    H`" > @ `Ҕ  ` "  > > > ǐ#ؒc@"? " > > > ǐ#ؒc@"@`"  "`> "" ""\"$"\㿘 Ā "& >  `@ & ā㿘 h  |@H/ /> @ !H 0㿘` > #d`> ǒ`@k > #쀢`2 `H`"`H> ``@!`H`L@> ``@! 2!``Ā `"`ȟ€`H`L@ `" ">`d` 5`ꛒ` 0> `aH@ِ +` 2= `D" ``> @ !P> @z!x@;    @`` 2`H`2`d`  $``$`d``  x`l`H@V` $` 2`D> ``@C! 2 ``> ǐ!@ɔ > @8!x7"" > ``! @-` "`$   "@`D`H $`D$`H `2 ` 2?> @"0$`` "` "`$`" $``$    `$ `<"> ``@"P` "` "` $` " $` ` $ @n``D `, $`@Ap T  H  @  `> @Y"x> @Ȑ" h " p |@ p ' ϒ p @ ?@   7>  `@"b&@  &` `"``# #  &` #   D H` ?& & D& H&  d  ?& d `  & 0@ `2' <  4  &  T `"  0` "` " # " &  #  @ڐ0?@` "` " # " &  # & 㿘\㿘 <@@O@ @'  0 `& & 0`@֒ +  ` @ 0 4@ `& 4 㿘 T` $?@ (>  `@"  & " &  &&& &&& &$ h 2 x p x  t  & @ & x& x`$@ < D ??& D7"?> > > ǐ@ "&`ؒ@$d `&` "& &@ ??@  "&  8   & 8& 㿘   &  D ,@@L   ` @q  "  " 㿘` & , <@ѐ <@ <& 0& 0 D ,@㿘`  <@s <@ <& 4& 4㿘 H@  & & & L& `&   <@U <@ <& 4& 4㿀 Ā"' ȟ€ '  @a Ԑ `; 8 0@5@Ф"@'> )> +> ` "` ؒ#c(@%" '`$" `'@?> "耢@ &  D < ," ` 8 0@@䀢` ) @``"``@"@` h 2 pH/ /> !H 0䀤`2@ 㿘 H /f> * '> \  > ""\\ "\e H 0㿘H &* @+ H 0㿘 '>  h  @ $  7"#> c@  2 2 㿘@ *   :  l"  p"  c" `@*  ` `>  # $ (ƀ h T> ǟƀ# ,>  0# 4ƀ 8 <>  D ( Hƀ L >   `ƀ  >    ƀ *`  > ȟƀ   > ȟƀ ؐ   > ȟƀ    2 > ȟƀ!`> ȟƀ! ` > ȟƀ!0 h`> ȟƀ!8.  *+> )>   ƀaH ,!p 0 4ƀ 8  "'> %>  ᨟ƀ  .`@`ƀ`$.` 2  2 㿐 T  @" h `> Ȑ!@> ``!1 4 7"> '>  `" `@ `@#\> @m"p T  @ `@#\> ``"x@ 0  Ԥ 㿘     $ 2 "   2     2"  " " " " $" (" " " " ," 0" 4" 8"`" ` "`㿘 @J` "`$  "㿘 2' , "  0 2$ 2 0 $ 0 @ < ( 6 1  , 8 $ ,$ 8  > > > Ȑ#ؒc@&l ?> > > Ȑ#ؒc@&m* "  2 " > > > Ȑ#ؒc@&p "$ 㿘  2< 8     23&  2 H /f * ' > "` H 0  @703@& L 4`& 4$ $  "@  & &  8 & 8 ` `> > > Ȑ#ؒc @C&|*`$  @ " "@ > > > Ȑ#ؒc@@4&  "& 㿘 $"  (€ 㿘  m  <%> '>  8?& 8   > Ȑؒ@ &l?> Ȑؒ@&m* $   `2" > Ȑؒ@&p  2 $ "&  $"  (€ ƀ  2 8`") 4?& 4` "`&  " "& H /f * ' > "`H 0 2 㿘>x 㿘>w< 㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' > "P  ' H 0   2!     0 0@$ `   & `㿘 T@€ 2-` Ā"&  ȟ€@€ 0H /f * ' @C H p@ 2@ 㿘 T €H /f4 * '    H 00  "  d  ?& d X 2 d  ?$ H 0㿘  X`\"`\& \X"@"X X"\ "&   &X   &  㿘6`@8" 㿘@8Q㿘> c@> 6`@7g 㿘> c@@7{㿘6`> #d``> Ȓc`@dn > `t> (@7M㿘> #d`$> > Ȓc@d\ > `t@7X ( < D h ` p           h ` L d P l , l 4  d H  P 㿘> Ȑ#@ 㿘> Ȓc@S 㿘>  #> `p@?H'H 'L'P'T'X ! `!> #0"@Ȕ#0$`p> @s @> @m > c\ @@f㿘> ɒ @[> cd    >   @>  @@b㿘'L'P'T'XH/` /@   @LH 0>  @`L  @ 6x> "'  <@J > ɒ `@BO؀`  >L @;  L   > @2 b >  h㿘'H'L'P'T'XH/ /   @@HH 0>  @`H  @0  㿘>  p`> ""Ȁ`  `> "Ȁ ````@;1  ` `> bȀ""bȀ`    >  D` . :  `> "Ȁ` ` `> #h@`Y㿘> #'H'L'P'T'X`,  aH  `   @ȘH ,"  !H `" @"@!H 㿘  @? "@> "㿘'L'P'T'X%       @6ɒ    @L?㿘'L'P'T'X  @{L㿘> "'H`'L'P'T'X    @hH㿘!> 'H'L'P'T'X#L3> cX &cX  @TH>  p`2&cX&cX#L㿘%> ~L!> #X $#X @: >  p`2$#X$#XL㿐?'P'T'X`'' (@P`*㿐?`'' (@ `*@> " '''`'' `: `   2.` w>  . M`%`2* ^ ''? M`ZZ>~ *` € ? ?L@  > p  > ɔx { O2A> ɔ oO `L `   2.` >  L.VL 2L EL@? * :   6 < ,`   2.` >  L@.,L@   2.` ޢ` L@.`L@ 逧` L@ 4`L@ `W >`  K 2I.` > J E `> `` !   ?    @?* : ?: `` - -@ `> ɐ '  x ?     @?* : ?:   2  `` -`" M  ? ' '  +M`*  ?&?MЀ   , * ?РMЀ &آ?גҨ  , * ?РMЀ 'è @M l2   ?/     ?    @?* : ?:  ` -` >  `   x u o  ?> t:  @ ?m" ?h2    ? 2   @  ? ? ^  ?> ɦ` '  S x ?`> ɬ   @ "''@'    ? 2   @  ? ? # >  > ɐ ' ?  2   @  ? ?   2  `' ?`"R逢 ".  5,A> ɘ 4, 40 - 806 03- @ `0- @  8' 8'0-,4   4 -  '@V '$ '` /' @ & +` ` 2`  '# ? `  2.` ֐ .  ?< `   +` .3/ + 0`   2.` >   . ` 2.`  `.˔`2!# ? 0`  2.` t . 0 ?"@ ? 0`  2.` U . 0 ?'M `  2.` 6 ?.o??' "@ ? `   2.`  . M ? `2&> " >  㿘` @@`% 2 1  H /m * . `"` " @"`"H 0 㿘   @ &@   @  * 2`      $  , & ,>  "c؁㿐 , +) ` @ #&@   @ * 2`@   ` g   7d  Đ      % &t &t &t &t &t &t &t % &t &t &t &t &t &t &t &t &t &t &t &t &t &t &t &t &t &t &t &t % % % % % & &t & &t &t &t &$ &t &t &t &t &4 &t &D &T &t &d 7 ; ; ; ; ; ; ; 6, ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; 6t 6 78 7 84 8 ; 9X ; ; ; 9d ; ; ; ; 9 ; 9 9 ; :Н㿘> Ȕ + > > Ȑ|.((S7> x |P4P&x.`(@2> "ct p.`( #t $> t#t!#t㿘!> #|  > # 2 #|> !7> ɐ!$#|#|,`:` `q$#|`Q > > > ր@"> Ȇ`( "㿘#> > ɖ (ϐ`@ܐ`1> #> c !>  Ƞ@А``@ʐ`#@&#> > ㌀ > Ȇ ( > "#"㈁㿘` > #l " > 4 > ɀ  > > ["0> W"0T" 㿘. > . @> ȓ*`"@ > D"(V `*`>" €> V 7"0 > 3"00> /"80> +"@㿘> ֔cp.  >  > ct*> ɐ"P0y*ct:  > a`#p& *`> ΐ!*`>  !d >  "p0]#p: $. > "0T@> ȓ*`"@> ɒ"> "V? > ې"V?"T #> ɒӐbV | V?T   4> > "> "> Ȗ`|* R  > Ȩ <  '> V*  ;V? > "㿘N -    N 02% N x  X2   `     ɠ     *:   2Ѐ  ? &@ 㿘     `O* Є 8O /`8 (. (> а`` ?O O "  "  " O?#66 㿘N?   +> J@    `,`cx:  4- *> ȧ: `<,`: @12 `@ "`* cx:`@ - : ? &@?㿐%> Ƞ )> '> ɒŐ#X@ (@ڐLJ@ "` "` "`J@   >  &@#   ג㿘> #p 4> ֡. j< %> #> 04c@, :``y`Y`n`N, :  y YȐ cՐ. > Ȑb*  `   %> Ȁ   "`$`" `$@ *|R@? @ `R@?,   > <#H0 P|R@? > Ȯ < T* \ @T?`> ɐ#XR  , @_ %  > ɒ ">> #`ܐ0T#t > ɐ#p0K> !` 4D> ɡ. ɑ< %> #> 04-c@, :``y`Y`n`N, :  y Y'' c4t!> Β& !`*`> ɒ@#t & *`$ t> ΐ&?a* @> ɒ#>6"㿘> #p 7 . > Ȑ* b R` "   "  > 4 >  2` 2` > #> ɒ". 3:  > ~# > ϐ dܐ> s#0> #t > > ɐ#i0!`  > ɐ& ?> Βa* @> ʐ Y0V"㿘> #p 7 . > Ȑ* b R` "   "  >  " > 2` 2` 1#> ɒ-". ڑ:  > %# > v e>  (0> #t > > ʐ 80!`  > ɐ& ?> Βa* @> ʐ X0"㿘>  #> cJ@ j c,@@@0)> ɢ`  %> `` c, @ ?* : `2?*`>" €> ː 08> ǐ 04> Ð!00> !@0,> !h0(> !0$> !0 > !0> "0> "(0> "P0> "p0 > "0> "0> ##@c,J@c㿘> ֠ "#|%> #> Α, : S ta` ? ?$|㿘> ֠ "#| #> ֐ <,   > ^#0cx? > Ȑ?$|㿘> #p> ֦   Q"c|> > ȶ |b* V @ > ȓ.  |:` ,T/ `2@_!@@$ W. :``e `s`d > #8 > #8 c < :   T?ˢ` #p$?'c|㿐L@?  -> L@    2`L@,L@` "`` "`` "`x:  4-`*> ȩ: `<,: @ 2 @͐ "* x:`@ -`: ?2L@> #P0     > ɐM s0#㿘/ ?  c > "#|> ""`Y%> Α.:   @`2L $ @ 2D $.:    T `` 25 $T 21 $T  2+ $ *?  d e c > #8 f> #8 $ $  $,`:  $7?  $ `` @6A? .> !> ַ: a#t,`@1 -`+`?  d"#t e c #t>  f"> q`#t`U `* ӑ: `#h? ``@ˑ,`?  c> ֐?"c|㿐NN    2 NN "  "  " N > ǐ#0*  > ɑ.`.: :l0#㿐.`?'> > ȳ>`"' )> ʒ#@ (LL "  "  " L : 2"L> #p􀢀 > "-`* * @@  `a> u#` ' ? q  ј f ` Q> ^#` `h@ $> #t> cp   > F#0;.:  > > =#02" `  @z`2 $@9 " $ 2 > >  0 8 aà?$* *⠒`> `  `' '`'` '`'`'`'`''77ڒ i=̀?@ aM.J: ,G: Ed#p !̑+` * > Ȓb $  ?ܚ?## ?䀠 ?# ?# # ??# ?# ?# # ?> !(Ԓ@И⠓*`# ؔ@ "܀"" """"" > Ș! R   2 > !`> ̖   R  @  2 #p %#p` ? @`2$@w 2 $V  2$V4$ 2@   ? @`2$@S 2 $V  2$V4$ 2 !@q`2$@0 2$V  2$V 66 $ 2R`㿐N  /> N "  " N - N    2  J@ ? @(2  @ "  J`NN "  "  "  M@ T >  O *` ?* : `2A*`># €N >  7  > > -"#N >  % ; > W-W N ߒ >  ` `> > "#l> g  N iŒ   > Wm c@g 0N %: X dӰ  ʰ  > WG dN > !  0 e w   > W eN >   Y W  d> W fJWu  0qN U> P 0j& qT?0eN ^ 0^Ԑ[ N # 9> N#> ǀ -%> $a  *`:   2 NN "  " N   a"  taa aaА( # > " `?""> !h> ˒!p> p!H > k!x 㿘O#> > b!> `x^a@w ( O > Q!    N - 2  *  > ("L2  * > (!D> 2`6?> 6?> *? @ `2 ?@ (@* ?> @2` > !? @ `2 ?@  (@* @ 6?> *"? *?㿐@  " `  `0 "`0`#\`@  hВ ?'''''쀧 '4    @`2''  耢 ?  #2   `  &  \ ȘM \"0,?`&0Ε0㿐@ % " `  `0 "`0`#\`@  8/    $    _  ''''' N'   '  `=     @`2   tؔ6  耢 ?  # 耤$     \" 0,?`&00㿐@  " `  `0 "`0`#\`@  h '''''''쀧 ':    @`2''  耢 ?  #  2   `  &  \ ȘJ \"0,?`&0͒0㿐@ " " `  `0 "`0`#\`@  8/    $    f   ''''' T'   '  `C     @`2   pؔ2  耢 ?  #   耤$     \" 0,?`&00>  "@'    2`b b> ` @ ?* ` @  * #L,2` Ű  0 $ 0    p `i 2 0 @<   `$@ b|"9@"{"[T m b}b~2f @ 'l    ?4    b~le@ 'l  @  ?4    b}lQ'lT    ( "<  "@ `A"D   'l 2!H5  'l   `vl) 2  ( `<!$@ `w@ $@  2  0`є 0 ,?`$ 0 0`  > !H`@ 85 ,,@,`  @{,-   ''''''@g ''?'Ȯ'` w 2`,` n 2`,` e 2`,` "[  2`,Φ  ʐ? '  '?/a  '''' '> `,@Ж%`,@ 2^`, 2Z`,` ,@@6K`,"" ''Вb@ ??T!@ > !ē*@ *`" *" * H/` /`,`@ H 0`,%`,> > ː В!ɞ H 0 "`,`,? ?%`,  #" 2``" `Ĕ 2`` 2` ` 2Ѐޒ 㿘'D  'T  <T> ˸!ب -4* %@,e 2 02  $ 0 ` D  4`*  `-  & 0 ,?`$ 0ʯ 0 " ?@&Ց- Α4T@'@  `E㿘@ 4 "&@. " &@ >  @2&@` 6`㿘 4  > `  "`> 6 l   #&H/` />  @2 ,J1  0ݐ 0 @ ?",H 0㿘  @* @` 6`͐ 2 0 6` $ 0 ` V`6` 0 ,?`$ 0 0V` "` ڲ`&` >  a` ` ǰ ,  6 @   2`@  ,#@3* "**%@ *"@ *`@ *`?Ѐ ~ Ȕ?̐ 'Ѐ  '?/a  ''''Ԧ 5>  ,`@% ,n 2Y ,,~ݐЀ@Ԁ@6K ,Ȑ"" ''Вb@ ??T!@ > !ē*@ *`" *" * }DH/` / ,`@ H 0 ,% ,> > ː ! H 0 " , , # ? % ,? 0  @5 㿈 #> (* Đ`@{ Z `ἒ @s O  I 2 > 2` " ("`& 202 2` " ("`&$ <$`<, ?",`0?"`0`, `0, ?",`0?"`0`, `0 ߐd @ @(㿘> `t@ " @> a0& && & & "a0 㿘 & @M & @& <& D 2} 0 0 4c& 8& (& ,& & $ 㿘( @! #> ː"$ @!a     @!" @ !$ @ " D0 O$ D  $ $ " $$ $ @ V  ?$ @aO @ ~b$ @ |$ @V & # @> ː $ @! Ș 2D D @!#> ː"$ @!a Ƹ 2  @!a$ @ 2* D" @" @  " @ 8 @ 8   m "  @ ~b$ @ |$ @  2 D|  D?  $ D @  ?$ @ !T@8   @  ?$ @ " ! @ @ ?$ @a  @   8#@ 4   㿘 ( <   @" DK  $ D@ 8> ` 4  1  -  #> ː$ @!a  2  @!$ @ @ 2 @ $ @ ~b$ @ |$ @ǀ " D? $ D @  ?$ @q0 " @ $ `s %> ː"$ @! ٘   @!$ @ 2 D "@@(  @ ~b$ @ |$ @= @@ "@ @4   2, @@    " > y"$s 2 @   $ $@"$ > e"0  $> \"H @ ~b$ @ |$ @ 2@ D5 $ @  3 # @ @ ?$ @g  @   8#@ :  " @  @> ː $ @`! H 2 D @ 2   " D @ K  D?  $ D @  ?$ @Ƭ   @  ?$ @Ɵ    " 2{v (  @ @ ?$ @   @   8#@ ܒ  1  }@  ( ~@ @ 0@ @ 0@ @    88 "㿘 (`A <   2  @   @ 2 `" `@ `   ` @" !8 `A  @ @$ @`~``@ @$`@㿘`(@墒 p&`  &`H   @  C B?@>`8>`@ &`  $&`$ (&`( ,&`, 0&`0 4&`4` &`` &`㿘 (& @& ( 㿘 ` > `?"`> a0> " "a0t @ & 㿘 X @ @ ?& @<  @   8#@   " Dd  D !> š @`& @ "h   D` < $ @ @ ?$ @  @   8#@   6  @`t$ @`, $ <>  ߑ`4(R` < > ׆4"`8"` " >  D"`8 "`"   4(R `< `2 "``2`  `2``"` 4(<" @2  `" `@  2     4(<`" `@" @  2 "    ` "   㿐> ֒c(> > #\ bp H  >  hX h h o h h o j k k j i, lL l l o o o o o o o o o o o o o o o o o mp l o n8 o h, g g l g g l g g gX g g g g g l l l l l l l l l l l l l l l l l g g g g gP@  -` 2`,< `, 4 #@`$V>"P*` €`44@L"$ (! ``! `4 2&> !d$& ( `H L`1 2&0&@`$ >!*` €`,`H($`,`4a $`X  *b $aa@㿒 ذ `  '` :Є@   ''??''''؀   @ &`   ĖВ :̄ ''?''''쀣`'``  0`  0  ' '' ' @̰" `' 0x` u a  $a`, 2`@``"a@Mm La?)$a` Z a  $a`, 2a@a`H?$a`4`X " `,0 2> "`,*@$`,$`Xa@ L`1 2` `4a`H/ /2H 0 ` C ?$a &` `,`H($`,`4@$`Xa    * $a &` `  @ؒ a`'`  `   $a` "aڰ  `," > > > ː"xb_!@˒ ƒ  G P`Ĕ P   $, @Y@L$ 0," > > > ː"xb-!@   P ``$, @.@LR $` P 0r," > > > ː"xb!@g b  !``!   $, @@L^$ 0@," > > > ː"xbɔ!@5 0 ! ``$, @ʐ@K $` !Q 0@L:'` > ⦐"㿘` ``,!@ `4 2`,> !d `,@ # 㿘  Ւ `,@ ` `   "` ` `?@@,` 㿘 (   @= 㿘 (   @; 㿘c  (J "7cE2I  "~ ""}2=  ##26  ! >3 E    x" ` x = 3 3 3 x1  L # < # @`$# D <  "  2  " i r   @P   ` @   @kܔ㿘 ( H /` * ! `A L \@:   2  T 2 2  8 ` ` | "@  " 4    2  `" 2 8 ``  H 2   @  ` l x 4 x`   4 H 0㿘 (@઒ p0&` `  @ 㿘 (  @9$ (㿘2`   `@ 0`@r`  ``@r@   㿘> DŽ"4    > *4`2*4 "> #(#@$> >  #X!̀  > #x 4 ?422@ `4`> 2a> "a> #`  >    "`"" ` `  > > a؀`"> ː#4  "`,2```㿘  (> > > > V > ǚ"4` > !̕* 2  ` 0 6 `&6 `"6   2V V ?"a> #& aԁ㿘`>'@>'` @`,8 ?c@ > Ǥ"4  6 *>  aؑ*  ,`u>`  @2q "3 0gY 0d ^ `" $` $ (" $ $$ (@`2` $ " (> 2# > , $ ,0< 7 ` 1 ,@4` 4'  Ā@8'Ā > $ $   a > $ $ H$ ,! @ ` 㿘`  @`3> ǒ"4` > aؚ  ,    . aؑ*  ,`4 44  ` &&W  !i "J O"K > ǒ"4` > aؚ  ,    . aؑ*  ,`4 "442$ & ?$ !$ >  $  * $ $ 4 $ $ $ $$ (c$ ,$ H$ 0$ 4$ 8$ @ ?#*`@& 㿘?@c` ``> Ǡb4  *>  aؑ* `,` V@` @    @ᤐ`, 8 ``$ "  @  @  > aЀ@  > aԀ     b$` > ̔0! / ` =$` ° `, ʖ b">  8@$>  X >  x2b>  $`? 4 4`)1> !> Ѐ> Ґ PȀ̐ > ǐ 4  &> > ޿!!̗*  `0#3 4   Q   ` }:$`' /> -> +> ̔4  +`: 4ގ @މa0@ $> !̓.` +`: ?"`> q!H`, =` $` & ` 2`  $` #` }$`0"$` ` > "`$ `( `$`($`$4#$`0$`8'㿘 ?@c` ``{`> Ǹ"4  ǰ *>  aؑ* `,`V@` @ Ȕ! ` A @" ` ")$` 1$`> !h` * >    @4 @  "`   "$`ݐ $` 2 $` > ֐! 2  0> ̔0!  ` `,  ?V@c` S  > `$`(" $`($`$ 4$`4$`@ @8      09 #=03 *7> 5> /> ̦"4%@  *: 4݂Ȁ@}ޔ > !̓.`   '@  p p p p p \ , \  T  ` \ t ( 㿐!> ֠#(> > #\"a D  @ > > #\ a ! d6 !> "   * "> "@e*`"  * "> "@[*`> "!㿘> > t b ( א t?"% t!> "t!7  #>  /!a䀦    2  & 6 a&$a㿘@2R> !䀢2&@2 R "g  2&@` R @I 1> ט 2>`R2:` 222R 2D *`:  2> a䀢 "a>  >  2"!Z  t?& t@ *  #  #  @  *`:   * `2 22"  㿘> ! J '> T   @(  *`" S  *`: @ 4 *  "  ?"  *`: `@ݘ *` 2䀤$@$@> ! t?$t 2T 㿈`?`  >!*` €` g  >'`>' ,#\#`@@P ?c@ \`> " 6 > ",   >`  @2  >!,. €{ > `$ p  `" $ Y# p> Ն""@a ’@ D > $ $   a㜐 > $ ,$ G!  D;! &  6 . * @`'@&! &  6 . * @`y'@! r&p  6l . * e'@! ^  ` @W.` @   ` 0L! F&D  6@ . * @` 8'@Д 1&/  6+ .  * 2   ` @ .`  @@  ` ?0 㿘  @` `"$ > ǔ" $ >  p"@ >   ",,   @$` 1> b @  > b `@ .`@   N ! _` &  &U &F> P  ""U > " @ > " "  `@ .`@ 2`@2$`/ > $@ !$`.`$`?$` $` >  * 3 > "4`$`,4` $`$.`"> `p"`p> ".` ?#@*`@&  ` `Ւ > "X?`c@'L  '> bb> "- 'W@ @   `2 L  "@  ` ' ,`  ӑ* Ȩ',``*L 2 9>  7  @ @ߑ*` * U` `` # * `2  2 `2    2   2 `@2   Ϛ`G @:``* @*` @  " 2 `(2 #U` 2  4  4"> ̔!$  "'@ W@?c "U`t  2 ?4 ?4  f `I X+`"= V` 8 @m 0Ā ?+` * !> `"V`  @V "2" @/`* @*` @  " 2 !  `  *` * 4$ > b L"  㿘> !! I+>  2 BT  6)> ע @63%> ,`  (V `V > А"(` &`> ɐ"H + @ *  @@ 2 @ *` 2 (Y@T `@԰ a$x t?% t㿐` ` 4Ű `6 ?`>!T*` €3> b'T b@?#@ *` U %> b*#> b "@* @צ*`  @* ba*b"@* @ה*` a $$ap&b> Ǡ" '  d @`H?#@Z $ W > Ǡ" ' K  G/ C$ > Ǡ" ' 7 @3?#@- $ * > Ǡ" 'ǘ  @`4$   >  "$> "(> ",> "0ϔ - 8 8  `>  6?> ("2 (?? >  > *: `     㿘#> cL 8`  @ , > #T`> `> #4 㐒"@?##"㐁㿘`?#@ > "@ 6( '> 㘥,` >  #P  @@Gi* ?&` (> #*`$ 0  4 ( "  > "#"@ 㿘  `! @`?" `  ?"@@2 "    㿘@ 㿀 ``!> Ǡ!  *     $@ `?$ @  " @? 2`g @!! \ @` ?     ?2 G > #L  ` .  ``#L  @?@2, '@Β'8@ @, #`#\#d @ @К > $@ $ (4 & 6(&,&@ @㿘`>'@>'` @`,X   P 8N >#4. €! 2A@ < : 8 21 < 2*> & &   a㜐 > & 4&  2 & V ("` & ?#@> > "c* " 㿘> c. @ƒ ``"` @ ` && ? #*`@'  㿘> Ǹ! `  +>  c >  cL'> -2   (@ @?%c#> $㈒ `c >  c?cψ # c2 ㈒" %cd$> ㌀   @ >  <+> 7> #` `@ ,``2` @ #> Ջ"h  ` " > #*  <+> 7> ?"㌤ <+> 7> #,`"@ @N$ < ,`$$  ?c $ $ $  ? * 2 4 $ `$  4 @ 㜓*`$ 8@ $ $$ 44 ($ $ 0$ ,'@㿘`@` !v@ `"  6 #㿘 `2@'&` ,   &` ~@ `> ?#c? * @"@( 2(@ 㿘  @  ?u`@   & 㿐> ֒c(#\> > ̖ b ##> ǒ @ؔ a   *  > "@*`   *  > "@*`> #La> > > $a"c""㈁㿐` `4 `6 ?`>#H*` €!> ǐ_!  > L!! *   : 4#  > Ǡ! 'B { @w`u $ r > Dz!`'- f`@b]?#@\ *` . !> `#}*%> ` "@* @@*`#ؒ  $# * `}֕*`*"@ @i*`’ $+&`> Ǡ! '  @` $ > Ǡ! 'Ҙ    6$   - | X | | | | | | | | | | | | | | | | | | | | | | | | | | p ` x h d x x x x x  4 X | 㿘H /e * & `p &`l &`p`@ &`t`p =&`pH 0 㿘> bȀ""bȐ@֒  & x | ` 6 @? "@>  |X"& p& | 㿘`l *`4!@`(" `H /e4* &@ @ ϐH 0a >  `DB: ` &`D>  h`$B: h`&`$>  ?`B : 7` @ . 22U @u  `x` @2(`p" `!@ ! "!@!  ( 퀌@`@"`p@`p  2?h2`*&`p!d=` 2  `` @ ^ @`p@ c`p &`p ` ! @`*@&`@ @ J``( "`@ `&``5 2  ` 2 `@ܒ @ &   2 `x  `@Œ @ `x  `p( 2 " `p2 `n> *aD * `&`p@ € 0{"e`pw  2h`  2W`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` " `p@`@ `p2/  +`V``@` `"`p@ϐ`@ ` `p@ m` @ h``"6`@/`6``p>*@&`p 2B  >d< b`@ ]@  ?"`p@ Q@?  > ̐"  @@ ?@?   ` @@(`p 2  d" @ ʐ`p 2` d` `x @2v`p@ mr`p``( # V``H 6d`p @w_`p@ [`p`@ S  @ @ ђK`p   2`ހd  6`@L`(@  `p`ޒ`*`:  6``6``p@*@&`p /@5V`ܐ@  2`p `"`pV`ܐ" 8  $ `p @?  `p! 2`   ` `p* &`&`p@Ґ㿘` 2 >  x `d``B ; x &`d`H@i ۰? <  9 `5 `ܔ   "$ H /e * & > ̒`H@#> `x&`d > B;`x&`dH 0`܀6`?  2?  ` >  x `d``B ; x  &`d @ `H " 6` 6`܀ ` 2 ` ?  4? 1@`@.@?`>"ؓ*` €  ' ! ^ ( ) \? @> `x \`dB:`x &`d@ɒ`H =`@ > V`܀ "2?>  x `d``B ; x &`d@`H  > ̐"  `?`V`>"*` €4 6`` " 6`  6`ܰ?0 `@#`}@? ] r@<#> ``^@F!> \`{@Y`z+@@+#> ``@%`e@ `u@#>  ` @ B` @`@< h  g@ #> 3 `@/`@ -#> !> ׀ J   c! @ ۘ A!H|  ,` hx ` !, !( " h@"7`n@R`@> `@"` @`^@`a@@" h `o@t"@fs@-w@ @>  "}@ 4 "~  @ ] r@-̒@ѐ@iĒv@ b@ge@  g@  `@`@ 0H /e4* &  p p ?$pH 0 H /e * & @&H 0~ H /e * & p$$pH 0h ` ` @_  4> Ѡ"Ȁ  " >  p ( (> M > ̐# @ '''''@TӐ ?@w/` @@wђ!@y3 @[k +($"> bȀ"#"b" @` " 0x , &666 6!H|  , 2 xY  x " #H /e * &  $H 0ݰ H /e * & p ;$pH 0ǰ HH /e4* &#@  @   H 00 @2@7  : Ѐ€ " pH 00p2   2 $ ߐ"$p@$$$($(` |   H @  @"<  ! @4`$@f-@Œ( '''' ''('$,$(0$ 4$$8$,@$<$ $$0$4$8$<$@* $$($ ( 7&  @  $w H 0  ! l  h H /e * & h> נ ؓ*`  €. €  h*` €H 00,hH 0ΰ H /e * & pa   * ~$$p@H 0  `  ` > !H|   , > h ؓ*`  € H /e4p* &p n> *aD * `$p@€ H 0g !H @a  |`"!H@ W `" !H@? "@> |r"!H`  "!H` $|!H$x!H "`  , 9' ,!H| 1  , -2 )  & #$x@y  @M   4 44x}4  @Y  㿘2  *>  aD*`@ € H /e * & `A@ 4   @` p ``T  H $  `1 `, H 0㿘6  `*`>  !D * @V`? ?2  > א `&`8> א Ȕ`&`8&`> * aD* `@€ <H /e4* &   "2 "H 0 㿘 `>> * aD* `@€`<H /e * & @^$` H 0  2 `  p 2` `  4`   㿘 >> * aD* `@€ <H /e4* &   "2 "H 0 㿘 >> * aD* `@€ < H& R 䀢    㿘> #d`> ̒c@/  @" @ !  (    " 㿘 H /e * & ## @ H 2 p p + p`2  # ̀ `& p> זఐ H!@,  H  p` `2   ̀`H 0㿘 @ 㿘H /e`* &`  (`" @ ( `" p@  p>*@& p6 @6 @Z`>  n p* ~ D& p*  H` H@/߲ H 0㿘> א x t! 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @ H 2  p`@@3& p @@ Ԁ €   p @& p㿘 > 2#ؑH /e * &  p @ & pH 0㿘 ̀`@ 㿘`F 08 㿘 p ` @` & pސ3 20  n> *aD * `& p@€ !  p ` & p  @2  | "   "S   `@|& p 㿘`" p p & p ` & p  @2  | "   ", ߒ   x> #d`> ̒c@-~    p*@  &  & p   ' ' '''''& & & @   p *@& p㿘 㿘> #'L   ऑH /e4* &@ H 0H| +,'x#,  ( `  ` : > > גcࠐ!@[ `ऑH /e * & a;> !u/ @  &1p0z  )s`   ̐ >`_ ^ ]` `W` "p0Q( N(p  @  L  H 0  H 0 #>  > ז !@ܘ H 0`" ` 2 #   # p  #m`% H 0%> 5> E 2  d$2 x  `:!@ 2 2 ' !       d  @ Ő 6 H /e4* &  @H 0`Ɛ 㿘> #d` > ̒c@+  p @% $" "  @ H 2  p & p @@ Ԁ €  p ?& p㿘V H /e`* &` > #a   HȀ@$@"'> `> #a "  pH 0 > aĐ & p  Hʘ  H@H 0 (> "` 'V   H /e4 p* & p*   @%  H 0  > בH 0 # !@ H 0ဥH 0> #H | 2/`, "+` x& @" 2!`, 2`( 2`  v  > > > גcࠐ!@_ g `_  @2&` Hc d` 8  怤B) '> />  @; ?6 @  6< H `8 H40  H@6 ޠ$x ܚ@  d< C 6 ܒ@ א & pఐ H!@ H 02`0 " >  㿐` h  *@`z&`V`ހ &`ސ> > ̐"  `?e>#T* €@| v`` @"r`ސ@s m`ޑ*`:  @{0eH /e * & `p` @ V`ܐ``&`&`p6`@ ܒ @@  ` `p* *&`&`pH 0V``ܠ$  6`ܠ ?,%`ސ ? `> ͐ x`ހ` `p 2 &`p \@b``@]`ސ?6`ށ㿘`  ݐ `㿐 @?ΐ H /e * &  (@ e   @'@ - @ U @@   p*@& pH 0 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^o  @ ?g㿘q  p   xU   f @2``@2@?㿘 @ 2`@: !4! & 6 6  (  h* h 4(  4@y 3* @*`@*`6 㿈& >   d* *  * $4` @ d@> ͐`8V | 2 x>  `H`2`> `h  > ͒`B|6 ަ@y 2 @ L1 7  >  2 4>   > ͘ 4> ͐`ʖ #Д@"? '?/!`''! @‰#> ͐` '?/!`''@t#> ͐`| d* * " *  * $@b4` L1  1 (  @O@> ͐ > ͖aǐ6 ށ "c  1 2 `1  `1(  "H 4 `tt+8 1`4  ?@ ") $ `"`4`ऀ ,`, 2`4 `44  㿘H /e4`p* &`p ( (  H 0? 2 H 0 㿘  "V , : @ ?>  >  p㿘  >{!@! $@  ($@  H$@ &>   & "@" > p> "pa 㿘> `p? "`p> x!`"  "`> "  "@@ @ߐ (@ݐ H} >㿘>  p *  {8* > `>  "`l""("H" 222p"|"x ""  " h*$( 㿘`K ?`?>#p*` €> ```8> `x`|W/> `h`lN&> ``E >  p!> *`  +  | 0@I ?㿀> !H!> !H / / / / / / / / / /"/'@, >@ƒ >`.`-$.`"> > ͐!Xap @  p ///.`7 t6`"6`$6`&6`(6`*.`-.`..`/.`0.`1.`2.`3.`4.`5.`6.`,/" > /!㿘.   zc@㿘> ר!> ! $> aĀ8  @!ģ,`@$,`!Ā@4ڐ!Ā $!> !*k!{ $!$%> . @   z( 8@ 8$c"~! ~!> ,! 㿘 $ > "a> "!@> 㿘? @2  `@ [> !,   2h$ p  $" ` 0B"$ p} # a %$ $ $ $ $ $ Đ ̀ " p p $ p p`2 hb`$ p7> א !  p `"$ p h> ג`ؑ* @€@ 㿘?2  > a. > ` h`* @€@ 㿘?2  > װa. >  #  "h aH | @ 7`, 3 x"0 (%+> '> a,2c a(2_  ` W  ~ c! KaH |   `,  x2a, ( 2 (6 #> זਐ (! " 0* $ (` "  (@ʐ (  (  2 (@ ( ( 0  > h`ؑ* `@@[ 㿘?2  > װa.  ̀   h> ג`ؑ* ` @  㿘 l? 2`> א  *  pa `  * "@$ 㿘 l? > ד2`  * `   ?" .`* ` ``@ 㿘 l? 2` > א * ` ِ R P `b  ` ͐ F  a 㿘?2   "> $!.  @ $@ ̀   h>> א"`$ ̒`*@    w$ ,`!$`,` 㿘?2  > a. > ` h`* @  € p$ ̒ $ p(?> 2 ␰ > װa'. @  *m> ה P! W ] p `  ` ` L ` @  ,`@8 ,` = `"  H `! "  Hq 2,`! ĀÀ`  b``   d H  @ T  H   p  ?$ p| H  > q! #(> b? 2  > װa'.    `p w   "l``( m`")`(  d@ 8 #"  8 qb`p T @`(` `(#ܖ`(@ 3U  d@ 8  i Hb`p + > װ ``( # ``!2 `h``p `h* ?  ` ͔ `p   `&`  #> ה`! O "s`p`&`b > !Ё㿘?2  > װa. p  h  [``A)H /e4H* &H  p!"  `` 2  ` ! 2 H 0 `  "( `( #``!`` `` 2  ` !    `Ӻ `ӵ  אἑ* R`   > ׄ"`8 > ׄ"`8"` אἑ* @㿘?2  > ג@*`   `@$` "`  " ` `@,  `((" `   `@,  ` 7$` 6  * > aD*@ > ,2 `h i@"X w@"*! _@"]v `h @R f@"8m `h ` @ ` @E p@"!` `h `@Z`@*X `h7`H> !\@ `x 2 ɰ  &   &       ?     ?$    ?$ y  `H@`H `h  ` i `x >  `@ `h> ג`ؑ* `@@  6`  !@  `K, !: X  `("/`  "+` ` @ ` @:  `@`}@`u@" `@" ` `@ `@* ` `@,  `"  2  "  `@    $ ,  0  `@ ߐ $ ,  㿘`"3   & -0, !> > !Ē! y !3> aĐKaİ  aĀ4&a> ! &aİ "y&!0 > !X㿘!> x!> !. @    "  ̀  x!ȁ㿘!> xՐ!Ȣ > 1> @> !,`    "  ̀ ` `"`x֐!!4 `1? # @*  . 0 ,@BS / `< ( % @e. @FP '''@eZ `H  $`H@H㿘>    > > !D>b  !D  0 2䀢2 4> ʐ!    㾐   @''(xPUA xd0U8 SLVђ0T? 2`  > !,   `"' ''''g   0 2`> 2 "h"` "(@f`-h''l''h@A' x X`@  > !̤`@Eِ!' '_'x@db "x@Gxu @ex`D  `@( @d x@H  ''h''l' Y 2`h2 " x "(@ex&&`"6`$6 `&6 `(6`*6`,.`-.`..`/.`0.`1.`2.`3.`4.`5. `6.!`7.", ?",`0?"`0`, `0, ?",`0?"`0`, "q`00 RoURiUws㿘Ĕ㿘 >r & @`:   >rz & @ؒ &  & & && &  㿘  " @  t >  " &  ,:`@` t >& & ?H4($   "` `8("@82 "  " "" " H  㿘H /e# * &  @ "  " 4 c”& " @@ &@&  &  4 & & H 0$@ H4@(@8`2 `` ` `/`, a` $   `8(": ``0   ``HH(@"&"`  #  4   ""@ ""`4"" H 㿘H /e * & @`@`2` ` 2&`> "$  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**2+@` `8@ + "@ 8  ""  ( @ ( (+@   @ * +@ @ *   +@ +@ &+@㿘`U H /e * & @>`5` 2/&> 9"($  ."& " " 4b<  "  @@ &&@& & `@& H 0  >  88` 8  `@"  @" "  "@  8("8" >  8  "@ "    8 ("8!"@ ?H4(&  2 "  "   ` `8 ("@82" " H  xH /e4* &  H 00?@ . `)&`' & '`'&  ` '&  `'&  `'&  `'& &`&@&`&`&` &`&`H 00H 00-(?㿘`h ) 캐>   4 >   а 4  2 4Ѐ  &&  & @ `t &`&`t  㿐>  0# 'b@M 㿘 > bH  p*    T`A `  , .㿘`> bH * R ! ` `   2  # #   *@ `# # S@ `   @(8(82??2 @("`J@("`J@"` @("`J@("`J@"` @(82 ` (82 2 @@`?22(8 08 (2J@("`J@"`?(2J@("J` 2 " ?(8* 2 J"J("J"J (2 " @ (#`J@*(#`J@:#`J@?(# `J@ (# J`# 3   3  3 ` `( ` (88 * 2 ` `( ` (88 * 2 ` `( ` (88 0* 2 ` ` ( `(88 * 2 ` ` ( `(88 * 2 ` `*  `(8: 0( 2 ` @((882 J`  `*㿘@  "@ "8"@ 0  "@ "*"@   @v 0w?# @q&> ͐ bH* R ` `2c  $ @$?  $?# @ > ͕*"H $ "@ "ɒ`@  " 互`@  "  @ 䧒`@ 0   @䚒`@ ` &? 㿘,  H ` `@]?@^{@_ 0 㿘``,  aH ` `@]ڐ?@^@_ߒ 0 㿘``,  aH ` `@]?@^@_ 0 㿘`, aH ` `  a@ q @  aH `  `, ?#`,@^?㿘, " H ` "@^0㿘!>  > א"> ߒa" > "`x"@$  > ޒa\ "`$ Ѐ`%> '> )> ` "```:` "`` 4* ``2`Ȁ >  $>  Ԕ Ȑ< " > "c> ">ʒc!T>ʔc<< !T > Ѐ"  22 㿘 2    :  V`@ 4*V 㿘   2     : V @V2  4V 2  4`2 4 " 4 *V 㿘`(4   .   @l$ `8     @   R` 2`4`0`4@ *R` *㿘>  Ѐ```:`  ` 4* ``2`㿘>  Ѐ`> ``:` ( "`` 4* (``2`> !ĕ2`@ 2:`㿘>  Ѐ`> ``:` $ "`` 4* $``2`> a@ 㿐%> > #\`!   #> > Κ`#\  c̒( !>ː!( c̒!( @ > !> !ć㿘> > !> # <㿘H /f4> * '>  Ѐ` ``:` , "`` 4* ,``2`H 0> `` "`㿘H /f * ' > "   "N > `ؗ.``6 @   2@ & && 6 H 0㿘H /f * ' > "   "# > `ؗ.``6 @  $ 2@  & 6 && & & H 0㿘H /f * ' > "   " > `ؗ.``6 @   2@ & && 6 H 0   @Y 0 㿘H /f * ' T > ؗ* ?2  `@ d   "% 8@  <"`< < 8"`8>  $>#  ( $ 0 , l 4 ?# @4 $ 0> "&H 0㿘 M> ? cH /f * ' V * 4 @    "# 8@  <"`< < 8"`8>  $#  ( $ 0 , k 4 & 0 6 > "ؒH 0 㿘H /f * ' > "􀦠  "" > `6 T``ؕ*`@   2@ & && 6 H 0 2`" `7#֐ @6 `?& `& ` $& ` & `$` 4`& `&  " ?@& & 㿘@  㿘@ 㿐` > ΐ    2 $ 2 > {!:> "` 'H /f * ' > "  "    4 V *`  5 $ $$ 4 H 0 $7 #֒ @4  $  $  $  $ @H$  $$  "$ $   "8$    1 $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8$ 8 <$ #̀  "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   $   8  `"  $ 0  " ?$$ $  " 8 $   ZF@   Z@@ 2&   > !P  > !(  > `  "`* > ` "`㿘`> ΐ!hj6> > ΐ!d&@ ` 2 \!@ :#> ΀ 2 Qa" Y& 㿘 J  @*@  &@T``  3`8 " $@@` @4@@ 2@T`   " $@@$ ` "` @Y&ݲ    && 㿘 2`  2& ! ` @@ *` &Y} `  @ 4& 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘` ``a  `@` `` &@E yH /f * ' > " > `6 T``ؕ*`@   2@ & && 6 H 0 P& ``7#֐ @6 `?& `& ` $& ` & `$` 4`&    ?&'> )`Ԁ*` 8   $`X  &@@& ` " $` `$`W`ڀ`` &L> `  "`㿘`b` h`( h@` h`   n&@H /f * ' > " > `6 T``ؕ*`@   2@ & && 6 H 0 gH /f * ' > # & $H 0 $ (  & 6 & 0& (& ,& <& 8  @& ``7#֐ @ 6 `?& `& `& ` & `$` 4` `` 8  `W  &@@& ` " $` `$``〤`` &> `  "``&  (""@`2 "` 㿘} `z`"@` ` @8@`` 24@6``8 `$" ?ܐ?" 6@0@ @" `"@`$`@`""`\@" V H /f * ' > "  "   > 6 ``  2`& && 6 H 0 2 & ) A% ` "` `$`` " &`  @@ 2@"@@ @@@ 2@"@&@㿘$ ް  8  ``"H /f * ' > "􀦠  "x > 6 T`ؕ*`@  $ 2@  & 6 && & & H 0 ,7#֒ @6 & & &  & @'&   $"@& & $  N  `&  {&^$v 4 ܀ nH /f * ' > "􀦠  " >  6 T `ؕ*`@   2@ & && 6 H 0 ̐  " ?@&   "0  $& $ (& ( ,& , 0& 0 4& 4 8& 8 <& "  > 4 `` $ 2` $ 4 $$ $ $ H 0    0$ $ `$ >   '%H /f * ' be   4  `4$ $$ 4 H 0 А $ %@8(1 H /f * ' > #8 $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  (8 $   2$ > #Ȓ @ 8$   $ $   $ Uj$&@`}㿘 '!>    ` 8`!Ѐ`` $ @U 0 $ @N   @H  2 㿘`> ΐ! > > ΐ"}(&@ ` 2 s"@ :$ #> ΀ 2 gb8" @ ߴ&  㿘 > L"P`  &@`  (   "     "  8` `   "@ ` #@   @@ 2@& "@& &    @ `0` 8`"   $ 0  @ "  ?&`````  V  & 3``8 `$" ?ܐ?" `0`""` "`  T6  "& xH /f * ' > " >  4 U `ؕ*`@   2@ $ $$ 4 H 0 .- H /f * ' > # $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    2$    Sϐ  "&     $ O $&2&㿘`6 ` 1 H /f * ' > "  "( > `6 T``ؕ*`@  $ 2@  & 6 && & & H 0. ܤ H /f * ' > "  " > `6 T``ؕ*`@   2@ & && 6 H 0 쀦 21 H /f * ' > #̀  "& $H 0 $ (  & 6 & 0& (& ,& <& 8   ڐ  7`#֒ @6 `& `& `& ` & @r&  $&  & 㿘` `a- o " 2 2  㿘bܒ o "@"   2@ "  2"㿘㿘`   `2   2  㿘      R 0 㿘˒ ``     2 "@& "@$@`  "  @㿐> > ΐ bx#\ ̔  ˜ 㿘> #쀦]? "f +  2V` +[ )H /` * ! >  ǒ @͒ $  $ $  $ $4`` 4 ` $ `   $ `` $ `@$ `4$ $  @   `@u4 H 00a> !\@  4 H 0&@ 㿘H o *@ a   ` @ H p@㿘H /` * ! ` `   @ " ` H 00 `` 4`> c@> c> #@&4`4H 0 㿘> #d`> Βb@ ̐       @ K  @  |@g>  㿘H /` * !     @ * @X  2 @  @N   5  # 2 @͐ 2   "   !!" %> !>    !SV  6! "     `   @ `"  " > g"6 zH 0㿘> #d`> Βb@ <  `   @ 㿘H /`4 * !   > 6" ?(6   ` 2  5 `  @ H 0㿘  , -H /`4 * !      `2 8@4 "   8 `  @ H 0㿘H o *@ a   ` @ H p@㿘H o4 *@ a `   9`  %  `  @ H 0㿐`   'H'L`'P L L   P`:  U@ `` ` '` L`  `'L` `   `4 "`42 ` +`2,`@ *`|(` H 0`5`8H 0`H 0`H 0` 5`` 5`H /` * ! ` ʘ`8 π 2``  `$2` 9 2` 9H 0`H  '``| "@``" 4 ` `'d      (   (H 0`` = D<` .@ ,L ( !`@@ ! #` ? 5` ?5`f`@ t`|`?Ȓ* 5`H 0 :PE`H 0P$@L`>  ˦  3> P )H /f * ' bĒ "  6$`5 &6&&&& H 0 &#&H /f * ' b "   6`5&&&6H 0 쀤4gGDgBH /f * ' > #q "&$H 0$ ( &6&0&(&,&<&8 (P > #Đ% @4  &h4( $@4@ $@P  L  " ?@&Lu L` & %P `Z"`` `` P` 2``0P ` 5`H /`* !  2`8`?Ȑ*@5`` `   P@HH 0  ` ?5` 'P  P`LO`?`* 5` 5` ?5``P  & !㿈 ''H''X'`'&@ 2'X   ? !2+ & `  @  @  u7` 2ې2& $" x      @  x   @Ґ L  6 x H /`4 `* ! ` 2p L@ :k \@ @"e P8a 2]` 2X2  8 L " 8> Ր"  2I646 8  2=, x "7 ` "1 `2V  2   `" 9    #  x ? 6 x ?6 x= x@K LH 0 "z x " ` `8 "`8 ` > > > ΐ"Вb(f" ` zV `> j#@'H    H"@e  L T" & L& T H0"@& TH "& `M&H /f * ' V> ؗ* ?2 `   "%8@ <"`<<8"`8> $#($0,\4?# @6&0> & `"ΒH 0 `V  >  `   < 'y  L T" & L& T  0"@& T` " ' `2'€'& `V&`   `€H /f * ' V* @4@~  "%8@ <"`<<8"`8> $X#($0,\4?# @6&0> & `"?H 0 ` ' V  s`!2V& `" & h> > > ΐ"ВbP9"V '!2"2   `  > > > ΐ"ВbP"& `& d& h " * 2  ( > #h ?6  H "8 "82#耢`2H 0r'H /`4* !耢  $@"& " 2  L T" & L& T 0"@& T%& `N%H /f * ' V> `ؗ*`@ ?2@   "%8@ <"`<<8"`8> $f#($0,[(4?# @6&0> & `"MH 0 ` ` > > > ΐ"ВbP\#4&& h& `& d& h@ ﮖ % "@&&  L"& L H `2 @"  & H  @Q6 @OK@# 0  ,@ L " ` x ? 6 x ?6 xƐ xH 0 2     `" 8  V `   ː `  2$@] L2 & `& d& h "& h` "   `  @ 쀢@2耢`   x ? 6 x ?6 xQ xH 0 x耢 2X`" x@"@ x ? 6 x ?6 x5 xH 0㿘` `` 2 @`2       @ h L ,  @ 4 ,@$0 4 ,H /f * ' @ , ? 4 , ?4 , , ' ' ' ' ' ' ' ' $' (' ,''@l 0  4 ,$ $H 0   `@@[ȁ㿘?#@'P  " * `  @P *"8`"E` ?>`ä *":`@5` *1` *` `` 8`"$`` *` *4 *g`" ` 2 ``b#@4 6 `" ` ( `` {6 *x6 " ` ( ` $ `"> 4`  0c #0]> #0@ 2g 7  |#4@ 2^ 7 L@ GU 7  8 =&  P 8 6& \"E ` 8`? '> @? > Ēc"@@8. !Kf  Ƞ@+,  2 ``06 6 z`  ` ` @P `r㿘?#  " * `@ }̒  L&` 4 "HV @"CV ">V 0_";V 0\"8V  "3V 0T%".V 0O`"2 \``", `"V 0?"`"  08"``"V0/ &`  ` "@V `*" V ` %"@ 8"@!6 8 P`"`2V zV > !Ē &` `@~$@> J`$  *& 㿘 <  @k. D l`4R`(2(  > > ׄ"`8 L> ׄ"`8 |H&4$($"` $,0,H  4(H4p(p  "p`2``"`px2xH `4( L"`   "  8` 2` 8 "`"`,  " \`0   4(H4(  "`2``"`2H 4(`|` ``"4" `   2`8"`82,`   , 0  `&  4(R`2" R`2@  2 㿘   ;  6 @ @Ҕ @] L    6| 0} 6@M L   @C |㿘  6 `8|6 @7 |@4 L   㿘  6 h0|6 @! |@ L   㿘@ > #d`> Βc@  !> # L d* * @"  H@l T4T2*T0 @ @c+> `C J@G !> 6 ?6 6  6  & 66 6<& <& & & & & @& @D& D#0@  2#0P'> 4@ 24@Ԑ@' `   @  @9` `@L |U6 6 㿘` > #&` 0  6 0 2  6 2&``&`(`(&`,"`"``   2 0 20  "2 22 ("  , , ,  , ( " "  㿘 `6 @D |㿘 ` 6 @; L   㿘 ,!  @6 , > R .zd 㿘 ,  ,#> ΐ  @4 ,! c zP " ,    ,  4 ,㿘D` `, ? 6`, ?6`,{ "  D <h @`$=f 㿘 |@" @ L  \ 2  & \ 2 (&   8&  @* 7`> @0  (*`"   " "    > LH0@ 7 㿘@& & 㿘` "&  "@!0 @`㿘  @"  > > > ϐ#cȖ{"(@M & 㿘`(`   a&& ` " `0@&   "& " & @ &@``?# @6``2 @㿘`:   " R  2  2R @ !&&  "0& "`"& # "`?# @2`2@ 㿘 @ >  0 `  @` ` @` #@ 4 4d @ 8` H /f * ' > "   > 4 ``"  2`"$ $$ 4 H 0 2@8 $  Dj `"$@$`   a&& ` "@`0@& @@ 2` `   a&& ` " `0@&   "& " & &  㿘>  @     ` `# # 4 $#+   a&&  "0@&     a&&  " 0@&   "& " & &  㿘 `| `` ` " @ 2R R V`@  2D@& @B >":   8 `" $0  @"  0$  ?&0VV`@  `C` `  @ & ` @ &?"& && `   a&& ` `0@& ?# @6& > 6B P㿘 , "  > > > ϐ#cȖh#.@4  2 "  > > > ϐ#cȖ#3 "  > > > ϐ#cȖx#4 "  > > > ϐ#cȖm#5  > > > ϐ#cȖc#6㿘    > V  " &&   &@  0"@& H /f * ' T * 5 '   "% 8@  <"`< < 8"`8>  $#  ( $ 0 , R 4 ?# @4 $ 0> "H 0` 2  >    ( "$ $ "@& "h&  ` >   " &&    0"@& H /f * ' T * @6@ ﱒ   "% 8@  <"`< < 8"`8>  $#  ( $ 0 , RM 4 ?# @4 $ 0> "sH 0`" &  " "& & $   2 & &  "& 㿘 `]> `?`& +> `  " && ` `0"@& H /f * ' T`* 4`9 ` "#@`8@ `<"`<`<`8"`8> `$#``(`$`0`,`Q`4`$`0 4`@bH 0 2`   & & 㿘` ? (> ϐ C     ; (- H /f * ' > #1 & $H 0 $ (  & 6 & 0& (& ,& <& 8  2 C  A` ? & `$ $$ 㿈`Te (1V - 2` 2 > א T"``@` /Y2ޒ0"`(, ?",`0?"`0`, "w?`0&TN (㿐 @@ ``@m  2 `(@0 0" 0`, w`0㿐 @@ `A(`0?"`0`, v`0㿈`  `?   @|@ H /` * !  ( `2   2!` # ` 8  x 6! u@ 2 T 2   8    > ΐ 54 8 8 y4 8  w 2> !   `S (0찒  $` 2 4 2$` $`( `("`,`("``"`$`, 6v% L 쒄 p& 82  2` 2> א T"` "(㙐 v `` 8' ? `?    .K1В0, ?",`0?"`0`, v5`0@ SC (H 00,?`$0v"0㿐 @@' r`(  !!2``0?"`0`, d %v`0` %`@A  2C ; 2=   !! 0" 0`, u`0 $0?H /` * ! #>     8   6!cx tL "   84 8H 0  ?4 `0?"`0`, u`0 ??" x @`@` @`9` | (R/wఒ j '2  2` > ע T""(/aఒ 2M2 2` " "`('谒 5` 2 ` 찒 +` >  $, ?",`0?"`0`, uB`0, ?",`0?"`0`, u3`0RD -10'-*0'耢 R-쀢 p`` ``'` @'''''И''@6؁8` =  (䀢$% ( *  M# 䀢*=  `@'@ 'NÒ h'@Q԰ ע    '  '? '''' `  ' `@ܖ   "Z'  @" @Ɩ   @2D``$8  ̀`$"  ?ܐ"   ?"  `?"`  "  Ⱄ '̀` ` ?` "`?  " ""   @`2ܒ ,  Lkؔ>-Ԛ`( ̰ 耢 ?  #   a `$'   A M  0" 0`, s`0Ѐ p` <  "`0'`` `'` '`@''''Ԙ'@B؁8` <}  4䀢$1 ( *  K ` *@ '* ߖ ``)H /f * ' > # $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   7 2`  7 :`  `$ `( `r` + 0" 0`, r`0㿈 @@'찒 B` " '`:  '`(`G` 2` `쀢 " 8' : `:  0" 0`, qΐ`0쀢 ߇㿈谒 ''@:y   N ()ݐ)ڐ N (㿐 @@. 9`:V  $  (  `  @ ` 8'``:@ `:9  0" 0`, `qj`0`r㿐 @@ G`(  $ 2``0?"`0`, 9 9qJ`05 9:  # ː  `  @ ` 8'``9 `9  0" 0`, q`0"㿐 @@ I `(  @ 0" 0`, 9 -p`05 - ހ  2   7`  @ ` 2 - ` `9 ` 9  0" 0`, pƐ`0ѐ㿘 0 B -H /f * ' > #4 "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2 F 7 $ 9= :0$ * 㿘& 2R`    &&`0  "`0  T l  T  L T ` T T 㿘> # `  [ -`   ` `E -```2? `9.`># €`4 8@?0@m- @&` # ! @@J`    2  > & 9c  @ V  2> > A!@`   T`, |`"  &` T$`, L`(`#  &` L$`(݀ %!H @ Ӏ V : s> π` Ƥ 8@  ` /`  > ג# `L ؐ`     7 @   "`    9 `LA   `L` `T , " " & ` `T# ,` (`L " " & ` `L# (`  [ !P@ 5U  &HV  ?` "?`L@&H?&``2`0> at$` "at`0 &0`4& &$&4&(&,`:&` "+&  & ``9$ ` "&   "&  & `  9 `   & ` 8  & > M!X 㿘 "V P  8V "> ׀ ">  > > #04> #8<% !!h" 8 F  "  7@V 8& $# 0 㿘  " " @ &  "  @  @C 6  2 " ܣ > !x` H @rH > " ' ` @ O `@,  'x'T'P't'|@P 2>` d@9*td@0@a@+ 0@2 '$8 !'d@8/ d`@7t `$ &   & @9.   > t!xP` D`  a '''''K?  (0I* @ D< > &@@7 5`"1 =TV@@, )  `$`  2` =  `沔 ܇ $  $  ` $ $ $@@͐㿘V@V@  )`" V  > "{"  v" t !㿘 '& R`` 2  $   2 > ݐ!2$ & ` ?2`$ 㿘R`   a㿘4 8   $ _ GG 㿐`>  ?4,E|   J2 ( X@'$@@ `?2@M , 7$ ,  &@ `? , @% ?<,   (&  J (   @*`" ,> @?' `x" "x6 %`&`  I (FӒ 㿐    ` ?#@2  @ 4,    ? ?` " ` 8`"   $ 0  @ "  ?&`74` H /f * ' > # "& $H 0 $ (  & 6 & 0& (& ,& <& 8  X 7 6n@ $ ` & ?@-1> 6] !?"' #@ "   6F ``  "` @!x "`&!x  `!> 6- ` `?"` `!x?"$!x㿘> ap  > !@>   %p  "a|?#  4  2 > ר"a@ 4?#%> # | 4  $| `2 @" T `4  (" `2 ` >``$@Y  2 | a@> a<  &C* a@  ` @2   2  $@` 0 $ 0 `$  2 @R` 2 ?`( "??` @' ?`Ez &%p㿘 >`@ 㿘 1 *?#R 2! (` 2` 2@?2  `$@  2R   ` R`  > |  |2`2`㿘 >  0 & 0 x& ?"x& 㿘   > ! >     ᤘ    2 ᤀ2 8> S! 8`> a?"a 0@2 > #L >  @ :@  0" `"> b" "b> b" "b ` "`#   "㿐> > ϐ!Ĕ a#\ t  > ! -> 1> '> /> ""*"> ⴔ \ > "b @##@ @U#!P#!5> +>   t@,> !,` ?$ D$ H$ @$ pLL7$ 8 8$ 0L >   b:@ "  > #"%b> !> `"! $  "` ""$ > bb $b" "b$ `@ t#䀣   2:: > "b> " @ L@ :@ %%#䀢` `✕: 4%✒L`` ✑: @4%✁㿘 @  0"2' 0 & 0@5f> c, ",'@q㿘 @ 0"2`0 &0@5I> c, ",``'" @@ 2@@ @ۘ 0"0  "0@5& > c, ",@ܐ ޲`@,㿘 0 2 \ \ " \ X "  \ @ @" \@PL ``< 2`X` ` `"`t`x "`x "`t 0? 0a $ 0H /d* % @  \> #`0 "0 \`t "`tH 0 0@ $ 0@4` @͐@u㿘 0 >  0 & 0H /d * % @HH 0> #`0 "0> !@ F *> "@ "L*`  @0  0 & 0 0b& 0@7㿘 0`& 0@4}㿘> #d`> ϒa@H  0  0`& 0@㿘> #d`> ϒa@3  0  0 & 0@㿘H /d * %  0  0 7& 0 0"@" 8 0 & 0 8 $ p 0@9 p > !`@ 0 " \ 0 ?& 0 \ " 8@* 8 > > !> `"!#L >  >  b:@ "  > #b#" -& 0  0@> !> #L >   :@  0 ` "> "> @ ""> "> @ "" 0 "&  &  "` ""&  & "@" 0!> >!c !& 0> h@ $!> "` "> > b#"g֒  0 @ 0*@& 0h%H 0㿘 @> b> b*  "  P2  \2 0  2 P 㿘 @> b >  b*   @" ☑*  =>  P25 \21H /d * %  0  0  & 0f= H p@ ̰ 0J 0@&H 0 2 P 7@Ւ  @ &@" $@& & P& TH /d  0`0& 0oH 0ۀ * % @ВH 0@㿘!>  @   0 & 0"" &"" $"& @㿘> #P@ , @( 8> ""s& <:: 8'>  @o   0 $ 0⨀ $" $$  8 8$ @ 8  H H @ @̐" 8& 8 8 <"@ $ 8$ < 8 > f"@( 8 ͐  8(6& * %> !   H 0& <Ӑ 0 $ 0H 0 H 8 H@" 8"$ 8& 8 0@ $ 0$ <& <㿘H /d * % > > b> f"> > b > > #> b܀> ! > "> ϒ`"""``e H 0L > ! >  "!> ϐ!` `e H 06 d 0 & 0 0`" \> ʐ"p @H 0 p " > "?& 0& D& P& T& X& 4& @& <& d& `& l& h`"  "` "@㿀> #> "a'> 1> -> !@ > > ϐ"  d dH /d* %  > > #La)>  0 $ 0H 0 0@(H /dr * %0j 0 2 p> R" : 0@5> !    ( 0 $ 0H /d * %  8`` ": Ⱄ@%"$$  $ "$ 0 ?$ 0+> "Ⰰ@ |!"@'"'Вb@ ?耢 fⰑH /d * %  wV!㿘H /d * %  0"  #> ϐb c  0b H 0 0$ 0  ;$ 00  0(  4 " 㿘> #d`> ϒb@镐  0"> " 0 p"& 0`> !`@ 0@  0@*  \& 0@N 0 @  0  X& 0€4 0 @0 0 *@& 0e㿘> #&@> #@`*@,&  > c` "`?* &T *    ` > b> c*   2 T@2L (2@ ) 2 2 > c`? "`@"%>  `2& $ 2>  @> c` "` `  "`  "@$ > c`$ `""`İ c` "``T@> c`  "` @J: @# @/@& @Ք *   %  @-h "@y0*@& @       @/]@&  `T&  > @U> c`  "` c` "`@     W?@-&  P*@K&> c "c `  "`  "@$ > c`$ `""`&@4  `>  "` "   "@`"  "` "@$  `   2"   "@$ ĒĀ $ Đ "` "`"Đ$ ?㿘> #@`N> #>  T 㴑* @?> " 25$ 21 ,"+ T@2&(? K 2 > # 2 > #H # J(& )&@ "-&&@  2 `$ "`$&@?㿘> #@` #> > !c@ > >  |"@  Hc%>  )$c#Ĕ#Ā  ` "`"  "@ `"   2"  "@$  ` `  2"   "@$ `$ `T$ $$  T )$ , (*-7:$ ` $ `""`  T.   `?> b> c* @@ $@" "@$ $ `+$ @(`< $L (`4> ``L * .2 > `L ) .> > `Tc *  $  "` "$ 㿐> #"#"`#> !> !>  TԔ !܀`$c`:`>   Tɖ> > "c(> > #\"cp H  z > 㼒 㼔"`T> > #(* $ 2 $:""`T> Ā`A `"8`X""` 2`"``` # `` `" ` @2 `@ "``  `2 ` ` "` ĆĀ"`cĄ` ` ""`2`㿀`> # L ` "0` )`   @   0> c$0`,  "`,  > #D`" &`@`  &`&` ?`   ; @7 8@ @-  ?$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\Y[  ; @$T8g@b ] @, T?O$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\ @Q h `0$`0$`T@`  > #`, ", `0"> #@,``0" `0?# @$`0P`@,`"` `<@r`P@&`㿐X P\` d> ϐ#c  ; @0<8@ y   0& T& 00m#\@h 0"a. + 9 &&&&  L< &`@& L1   ˘ `8`@@ `H@ > #`0 &`0͐   @Y`0&`T u&`0`0 &`0 @*`"`&  w "ʒ 2  0 & 0& L& X:y +-0㿘`  y `0"\&`T\,`0> @c&`T&`X&`0㿘> #d` > В`@䓐  0(2 4 L& L  H??@$  H@ 8$ <`$ 8 0$ 4($ 0֐ 8"& 8  $  86 H> v 0$ @Ŕ" @$ & <& X: + 0 #0 0 *@& 0_㿐 P  \&`&`&`&` ` "`X` 2 `X <` ;`  T "``X@P@ `?`L' < ; `=`@#@ `(@2& <2" <`@`` *`` @+ ` ɠ *9 + <` @S < C (9 +?&` < ; @=@"  T@*  T? _&` T&`&` !&` &`&`S&`&`&`    @  &`&`&` T&` 㿘 X P > А X?#   2 ` 0͐ / `0 >00  `0 2`<,?͐`8@?Đ?/  + 77 `<$`8>$$$ `L$`0$`X`H @$`0@$`Lg    0 2 b   $ `8`T:  T@ > `P  T>  P >   0?a $ 0 0`$ 0H /d * %  \`t "`tH 0 p > !`" H@ H@A`<- `8@$`<$`8 8@"$ 8 "@  a ``  `0 $`0$`L$`X8` +R?'!㿘`` "@`,` 6 +`  & @&  .` <-?`@  .`" `& 㿘>  `#> ~!8  @(1! > А"& @P  \ 0(!(& @ @  " @`  < <@2  " @ f  @(2  @ >& @@ c 㿘? 㿘  $> x#܁     P > ؄< 8 `@" "  2    -㿘 2 !> #ؒ  5* #ؠ@}L*`"  > > #>  > " "  a}a * $  2㿘> *` > > }ڐ!cؘ     c* " cؘ 㿘> آ `@ " `   `@   Ƞ  > ؄ >   2> ڄ "c؆   "c؁㿐> ֒c(#\> > А#ܒ$  bt @9> @ > >  `" ؀ "`ܢ  @i?`(  \   4 X㿐> ֒c(> > #\!b8 8  tK 㿘<5 `` > aT* 4  > !T $  > `"!uZ " 4㿘< 4 > " v㿘W`> #`a``"@[ @ B&T `` @2`?? DE?4E 28@  2    7`6       2< ) < $ $ `$ 4 $ $ $$ (\ 4   0@@*@u0 㿐V  $   (]  @~  #"#>  @    @2`n `aX`@ > !P @   @ @2`?*  @2 &  6 @ސ 6 & & , ( ,& 0 ("@$ (aX Z    ,` 0"`0"( 0 ,"@& *@/ 2'  @<  `*`>!  €`" "& V   R` @7  2 V R 2v  @  @ " `B  & :@В@] V   R 2$@  `$`,`"0"`00"`(0,"@" ", (,"0 ("& ( $2,`  " ` '&  "@y  & "   B?:@'h`" "&  `B :@ 㿐  2'0H: ;@?`>>!8*` € "@V02     @ @E ""  "@>   B?: ' `B  : @K  㿘@( "  6`6` >@ 2   ?2    @ b `B >` @?  4&`&`6` 㿐'  V   `  @ 2T 㿘'` ` `@> "  `@6  ? ? 4 @2 $        2     4   8  & '    @     z 4  ?  4 2c  ] 4 @@  ? @ 4 2E   ? 4   @ 422  @  ? &  4>  @ @ 4   8 2> Ѐ?>   > z'"@ 4 㿘 `@2   ` @2 ``B > 0&` `@2 4 `@2  4` B?> &`  : :  :  :  :  (: ( 0: 0`B: " ," $ $" (`B> &` & 㿘 $`0"`0& (0,"@"  Y  $2,p,$ `@$0` "> ``2$> y"x?"`> y" $> y"`> #qݒ $` $`!$`!  "  > `sV#$`  @`2``& ` ,@ "`ڐ`@"$ `@ *`L /"?` ""$, $  $ > #$ `J`/2 @ `> s# > `s #0@  )> K  #qh ``$'`   ?'''''''@#}а   S%> #rߒO`$ # ?( `"`r͐#$`*@@$`J`/@Ԑ @N X `$`@.$ @`@ @@d`r# $` 2  @#u  `$  >%> `r@@m$㿐$` $ ``  `"` `@$` b*$``$@!4`'J@ /2$`'J /"`""@$$`< y J 2` 2$n $`  )$`'$` ! `  /`* @ `  /*`2#@`$`"`$`E ?$" $J`/2``'J` /" "$$` $`*@$` J`2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @@W`@  > #Ѐ 2@$$@F` "$`!"X$$`*@$`@ Ɣ "!`  ?> wȐ"` ` X @` $@  `*@$`` ""@$` "@$$` J`2!`  $` @9 2< @"2  @@ 2f`@_$< ` ߐ<  @  @@"$$` \$``? ` @2 @$`@0`@? `2`X @`2 `"  X`@"`  `@ @$2`@`   @!Œ    `  @@! @@$@$㿘@*   "&`@J@ 2> v"@"> v#@Ҕ "@@ ?> vԐ"QO  X @`J@I @&E  < @"> v#0? &  X @`! " X @`" @ @ 2@|  @!:     @@!/ @g@2&@㿐> ֒c(#\> > А!  cp mw > > > "!"at"> !"!"`> """"`> ""> a"a" > @ "a܁㿘``" `  ` @@% `  㿘  %֔ 㿘% 㿘>  ܀``@v  2`$`1  .!@uc!> Ж  x %{   $ $ @ $ @$ $ `> `$` @*  $ @` @t  /,   YI &  㿘> "0 "> ؟  ܀ " !>  "  $ #wg  $ 2  > @" `h 2 @`l 2@ @ 2`h 㿐 >  > @  al * & h`& l`4alal?# @ `>  * @ ''al `'4al & hJ   *`J8*  ???: P" " `": " D" H" @" <" 8" 4" 0" ," L" (" " " " " 㿘> > > #> ap ܖ"Г*`  #ap pH /d * % Ѐ > "Ȁ`"> !쀢`!p "H 0>  m`!@tf $  _$ @ 2 \ 2 DH 0> u#&U  "  \> А#@?> t#` `"``$ ` \"@ L $ LH 0 < @ > А#@> tܐ#H /d4 t* % t  > tː#H 0$ @$ $ <$ $ 8@ & $ D$$   X ` d" h h h h d ` " X`" d` d h`"`" h㿘@  㿘@ 㿐?> &@#   &@$ <@  '@&@ 㿘<> ` #Y @l @>` ?> * c @@    ` @ < <@2 D @7 瀦      < "  ,  $@ " " " $@"" @$@ @h@& @ @@ 8& 8& W$<㿘@@@ @a`bW & @> є" R M  L D`0  ". DH /d4 P* % P    \`2  ` `>  "! \`" ` `"``> "" ` \"@ L ?& LH 0  D` & D@N " D? & D "@ 㿘 D 2 > s & D㿘H /d4 D* % D  > s @ L "  P> ѐ X@> sy x `& L> !> " < 2& \ & \ \"`` \""& ` \& `"@"H 0 㿘> #> sI  D 2 ?> ѐ @> s> & D @ 0 H > ѐ @m> s, @ D` L 㿘> #> s! D 2 ?> ѐ!@L> s !( %& D H  @> ѐ!8@>> r!P`@ > ѐ!p@10@n D` L QLPD2P\"`` `> `\ "\> \"` P"P㿘 `` `X `d@ 㿘> #@"2 `  @ 2* "  D H "#  < 2  D @ "` <?  @ > #& 8Ȓ    &`㿈> c'''쀠 `  㿘 D  & D @!"!> rV!& @@`@@l` ? @%  ` ?@o@ @ݔ@  > r*! D?  & D P > r!> " & 8 s @ @& ~b& @ |& @Q㿘 D  @  㿘> #@㿘 @a b> & @В" P  0  X )  <? 8v D `"r D@`"2`"  2  "2 @> q! @(4  @    @ < <@2   `  @ < <@2 `" `> q~!2 @`@ 7#`@ @ 7& @      2 @ l  + &  D `;& < L 7H /d4 P* % P  > qH!> "Ȕ@" \` `"``" ` \"Ȁ & \Ȑ \"`` \"`"Ȑ& `H 0 ;` ?> (    @<@2 " 㿐@ ?* c`@ * @ؔ @Œ `@`㿘 @(2 " D  @@ ` ` `< <@2  D  2 P> "' > ѐ"XrG`<> ؐ!Е* `H> `D"`r<`P`@`/> ђb@tQ @`@ > ђb@tI @`@ > ђb@tA @`@!> ђb@t9 @`@"> ђb@t1 @`L > ђbȐ@t) @`L > ђbؐ@t! @`L > ђb@t @`@(> ђb@t @O > ѐ#q` > > q#"q# @" > U#(㿐`6 >  ܀F    $=  2$6 \#\`,-    `% ->  ؒG >   ܀   2$ G ( -㿐 > "а ` *` *  * N&@$&@H > @!!@ = 5>  {܀ .@` ''+> `X > !`qJc0`d   g0'@`@ɐ$&@   .  @* %  < <2  `  < <2`"  㿘\`  @" $`0`4 P $`4 @ "r$ @`o d k`i g @  1'@nv`X\ U `\@$d_,`d" \` B d@$ g,  !. 4 `  >  Ж `"@2`` "``$€@ 2  7  @"  $`0`4 P $`4 (u 1㿘 `   (g 1㿘 %> !<   ((V & 㿘@" @ <& @! C " @!& @ 㿘 @! `* @` `€  2  @"2㿘` -   @a2``@3H  @2 2` 2 ` 2 2`2`  㿘 '>   )>   ۔ 2> #@.  o#H 2  > o#p`> o#֪ 㿘rH o@> o#> `p >   @j! @   > > o}#0oz#؁㿘> #쀢 > !  @P  ' @c -> 3>  c* "@*`@*` ? 5   0  "  0 &H /d * % C 0 $ 0H 09  > o-# ?  > ѐ#o<``㿘`  2 -> !d` > ؐD?!̰㿐  -\#\ِ 㿘> #d` > ђc@;  t   t L`& L`Kk " t㿘> #d`> Ғ`@!   t??& t> m-  L`  & LLɐ t㿘`IH /d * % > Ғ ( p`.H 0@ޔ  H /d4t* %t  p > l 8H 0@0H 0H /d * % `l` `P  ````P &```p` 0```P &``9 %> Ҁ P &,0 0  &0( J "lH 00+0 &00``0 &09π l  p > Ҁlc PH 0 㿘H /d4 p* % p ' >  0   0 l@hΐ 0 $ 0H 0 \`⾐00Ѡ`` > ґH 00   p` H 0> Ґ G0H 0㿘> #d`> Ғ`@ `\ > k &`\ <? ?  &`D&`D l &` l`"`  l& l&` 㿘> #d`> Ғ`@ϸ  \ 2 > kȐ !P#!@  `"  "`   "@&  L`"& \ p 2& \ # L x`" | |"`| | x"@& \ P`2 L> k  # P` D  \`" ` `"``> "! ` \"@# \> b` \# ``""`㿘> #d` \> Ғ`@]   0"@`t`%&`tc ` "`   "!P!& 㿘> #d` \> Ғa@3  !P#!@  `"  "`   "@&  0 2 L L`0 l p 2-@ $ L x` |"`| x |!"  p <   > !> !2`@ :`  `> a@h > !@x@ & @ "` $@& 㿘  > l!>  ܀  ܐ @jޒ   $  $  >  ؀@4"& $" (`" @ 㿘>  ܢ  $  @j  2 $ 2     $$@܀     4 $ 2 > " ذ  <  㿘#> !> a  <:!!> `"$a> @> > ᄐ H4L(L x"|| ||x L"L> ሑ* "xx |ሆ "|H 㿘> #> /> ج"b+> 9> 7> )> 5> 3> cH /d * % !*   %% H $  9H 0  @ÐH /d4* %  p >  < > 7!h X`"> > Ґ!xk`> i!> !\ 2H 0@ " ?%"c (a G 0㿘H/` /> b܀ > #@Q" H 0> a> ؕ2 " :   > "`#""" 㿐> "ؠ : 0$  "`H> >  a| "`<"> ! > x3 2   : :`#a|  "x> !2 :`#a|"xx  $ 㿘   X> !̐ > ܐ  `@ ?`$`@ @    `@ @$`@ 㿘 D 2X  @ޒ 0"" H /d * % x`"||"`||x"@L "LH 0  "H 㿘> j! p> "d> b ' - ` Z vВ D ''''' i`@@=@ 2X[ @ @  p` -ǒ W` `a7` &``&` Z A @T`@ @ @  $ @@@ .$` - "`"`3 &`X`@ &`@  Q "<  @  m !>  @`` 2`$``а @g)  ܀``@h4 2`$`2 -     !@gl!> Ҕ     ʔ @>$ $ `  @* @ $ @`@f $ `$ p` " @ @ `@$ @ @>ߐ# $ @`  ^ @  $ @` `@ 2 @> #$ | @@@"&$Ð @@ $ @ @@*@ $ @$ @ @     * "$ $ C䧐 25 ` $`> a$$ a  #!"!" @3 @J @`X   H ` k B"`! . > M!㿐 D 6   € "> > gc! X`%> ` 2  <$  2 `2$ ``2`Ѐ$$P@ D'''''e .@ X `p@  ,! "`@̐0`@@ @     `@㿘 @ ?& @  " @ &  @ 2   @ " @     @>  @ @`> %@>  `W+"> !@ "` @"@ ` "`  "  "@> f">  `0ܐ 1  㿘> ! @)%>  /܀ "`@` 2` ?$`@ @@`  @ "``@ @$`@`'@ܐ P@ @'''''쎐  4 X `` `@`㽠> "@ @'('''$'',p 2% X  H  2 @>*@$ H+"  H!'l'h`{! > K"(> "D'@ @ @D`( X 2 `0?"`0D`, 1 E`0-  H D`0?"`0D`,  E|`0 2 @>*@$ H*Β  Hm!'l'h`'! > KZ"8> "``'@h!> !!@@B ?#H/>  B܀ `0@*(`H`` "`@@A`@ @$*z !'l'h Ԕ! a@%@ǐ` ( ''b' b > J"H㿐@@ א I (`0?"`0`, "D֐`0`@ ǔ <`  @@e @ϐ " `   ` €Ȑ    @` $`P@ D '''''@2 `Ȱ &`P )ܒ 2@ D'''''@  "  "$  $ 㿘   <   `@@  @ S0@H Ȣ` !1(,"(  @``$ @*@ ?'X'0$`\ 'T'4$'\ 00  ;0@ В   ?`\(c  ?,(&?"h g(@ $`\, 2`,> 2 ,"h", 0("`(  ?7 ?x 77   0 @ސ, @x ;(`@ , 24`@ @ ,` 2`X  @` `<  @  ,  ?@ ]   @(,0 @(&,, ?",,`0?"`0,`, C|`0 ((> "'(˒ *@ D''''' А@b  X h' l' X$Y `   > I<"X> "' 'D( ``  @`b (ٰ  LH 'L@ ͔  L햐 2  FD` ذ D'D`< ` -  !@  LdD`<  @ L LD @ { LdD@ ْ D @ D@ `P  ?pD@ } fLD@ 5 ^L`D`H "`HL `2`L 2 L> ؐ"h"`L`0D/"(  ?7΀` ? 77̀`  0D@  DL @ ǖ  HL 7D`@ mL 2D @ sH&L, ?",L`0?"`0L`, B]`0n L  HWLܒD V[ > H?"h> "'' )@   !쳐 2  F\` ذ `\@ \ \ ` Д p > H"x> "''V 2/(@   2'x 2   F` $0 2$ X H    @>*@`!'H  > G"' Z` `U @ 'l 'H'p'L't<H HX " 샐`< $`8 ` o ' '     2 '' ' \` @ f\\Xl@ @ ;l\ q @  'H'l'p'L'tH 2.X \@ lX@ XL X| 0  '$`8  / '\@  \X@ lP@ @'''''穐 : <   ` '''''ܰ & "`@ ǒ@4  - 0 @ `@ Ж Ē@ 8԰>  Ye#ܤ@$ 6 2:`  'H'l'p'L'tRH -X \@ lX@ X X 눐`$ `8 !'@ \\Xl@ -ZP@  ''''' '`@ @ EĀ0|z @ @ R  @ L Ĕ@ 0 @  2T I 2F  (`<  ? ``? " `  ( 02 / ` @ B '  @ B < @ В ``@ B  @ C < `2``  `<   >P`?@2 ` D $  ` $ @''''~'ܰ 2$ ``*`` !``2`@`@> @ nِ$ $ @ D'h'@'d'D'lQ@ P@P  %  2'`k p@ 'h'@'d'D'l-@ P@ؔP  $ 2'`G pP@ D'''''  `@ z(@ ''''' ! <  `` `  ?''''''''@ аO`" &@ @'p'H'l'L'tŐH 7X @ `@`X`@ % `?$u @ ?   `'@(@@ I  (@֐`@ٔ`X "` @ & `?$1 @z ?   餐`'@v@  `0?"`0`, >`0`?@- @ @'p'H'l'L't(H !X @z`@}`X`@  c` /'@4(`?@8 @U@ 1  (@I`@L`X  @  0` /'@@ C `0?"`0`, >3`0@ @'p'H'l'L't乐H FX @ `@`X`@ 4 `?`??#d 2> !̀`?@  3"?0ѐ`'`''@@@'H'l'p'L'tfH FX @`@`X`@ 4 `?`??# 2> !̀`?@T  3"?0~`'`''@@Mꘐ(@t@ T  (@h`@k`X`@ 4 `?`?"’ 2> !̀`?@  3"?0?.`'`''@@@? `0?"`0`, =/`0ؐ `  @y '''Ք  D耢??'?2@?'@ @'`'8'\'<'d㔐8 - H @`@`X`@  + *" " * *   * *''''@@ߐ簠`  @y '''y  O耢??'?2@?'@|@  =|   (@`@`X  @  + *" " * *   * *''''@@:@| |`0?"`0|`,  Аbx |<  < ` `  <  " "?`$| @ @WĀ  @@O " @ @ @DĔ|@x@@腐 N "I@wupr!> UY# iUP#܀ @ `'l'p'H'L't᧐H 0X \@ؒl\E0@ ` '$`8` ! '\@ۖ \X@cl XP@  '''''h 2`<   " `@      @ @ Ĕ@<@yĀ0箐`` N `@@ G` 2`(6  < 2 ` `''''''''`@m̒ ?   '@̰:` @i  `   `"@& 0" 0`, :M`0 $ "`2$@ @'p'H'l'L'tːH # X@ݐ  `  `D `@(@C S㿘勒  R   ( <` 0 "0& 㿈@  " ` 2S`  `(`< 2` ?`0 #`0#\ ``j㿈@ f " ` 2S`  `(`< 2`0  #`0``?` #\k;㿈@ @ " ` 2S`  `(`< 2`0  #`0``?` #\k㿈@  " ` 2S`  `(`< 2`0  #`0``?` #\k d d \ \ d0`,`d$b ;  $`(i$`$ L$`(Ɛ ` 2` `''@ ``@{`$ {#`@`$``@N ` `h$`h }$`$a  D$`(ߎ ]`<  T -bP d` !@ D`d< = @? 8 @o 1d"< 2 @ɐ @`@㛐  ?@m @& ` H &H婐㿘 X @`" @ <` >$#*` €   @ " @.    @" @㿘` H?$ H`@d@rp`d hl`@N'\ '''?'쀦 '' '@@$  "  @2 㿘( @`@@ > < *  @ݒ@$ @ C >@@  㿘 ( `<   2   2  2  `X " @ "  @А`@Ӑ@>@ @$B>@@˒ 㿘 (@0@d "K&@&` <?`>$#ē*` €  ( 0&  *2 @ 2 >`@&`&` &`&`&`>`8&` &`$&`(&`,&`0&`4&`H&`L&`P0`( <?`->$#*` €"@0@@ 8`$ " 3&"z@ T`@8%!@    @T`@'  a@H ` "HYH "`㿘 (@㿘@`@?#%@#>  @! "@@  @ $ @ b 5n  @@2 @㿘  (hV 㿘 (@㿘> #`Ŕ   @e@ǒ 㿐> " 8"''*` €㿈> " 8"''''*` €㿀> # 8#'''''* @㿀> #4 8#4'''''* @㿀> #` 8#`'''''* @㿀> # 8#'''''* @㿀> # 8#'''''* @㿀> # 8#'''''* @㿀>   8 '''''* @㿀>  < 8 <'''''* @㿀>  h 8 h'''''* @㿀>   8 '''''* @x>   8 '''''''* @؁㿈>   8 ''''*` €㿈> ! 8!'''*` €㿈> !D 8!D'''*` €㿀> !p 8!p'''''* @㿈> ! 8!''''*` €㿈> ! 8!''''*` €x> " 8"'''''''* @؁㿀> "4 8"4'''''* @㿈> "d 8"d''''*` €㿀> " 8"''''''* @x> " 8"'''''''* @؁㿈> " 8"''''*` €㿈> # 8#'''*` €㿈> #@ 8#@'''*` €㿈> #l 8#l'''*` €㿈> # 8#''''*` €㿈> # 8#''''*` €㿀> # 8#''''''* @㿐>   8 ''*` €㿈>  H 8 H''''*` €㿀>  t 8 t''''''* @㿈>   8 '''*` €㿐 \> ڐ''8*` €㿐 \> ڐ''8*` €    㿘@  " > TҐ!X`@   㿘@}  > TÐ!h 㿘@s   >   8*` €  㿘  \ " @Z  `0("`0H /d * %  H 0  㿘 @@ *@&   2 @+ >   # 8*` €㿘@  "       㿘> U!  㿘> TM!㿘 @! !> Ӣ "& @ ! 2c  @!"㿘> "*` €   㿐` 8`    $  ^   $ $ P  $  " $ 52  |$$ ""` 2`      $    2  $`3} ` "`  $ ``"   2 K  2 `  2  $`3_ ` ? "` 2` U> Ӓ!  1ɐ `9 2 ``      :> Ӓ!  1 ` 2` ``` 㿘      @> Sk!  2 ( " `!4`       ` ` #` >4`  ` " 㿘  `` > S1" "  !4   Д     x ` `  >4 `  "~@"#       'p  "  "  ` ' p  `     A`` ?2`  @' p   @2    `'  p@㿘   ]  "       㿘  `  /     ? $ +   "   ? $ )   2    $` "㿘 `      $`㿘> S"@ > Ӱ Sߐ" 㿘 >  "(S " "  "    "     -㿘> R%"PR  2 > ۄ" 8L> ۄ" 8| <`$" "`$`,2`,  <p  "p`2``"`px2x <L"    2    ?(2 `   <  "`2``"`2<`|` ``"4" ` 2  ?(2`  㿀`@@@~ -  x  r( ` > 0?"0`, c ,1`0_ ," 谒   0" 0`, N1`00J  ?  @"  9  " <@ "@`" `"`" $ $  " `0?"`0`, "`@0ې`0`@ $`@$ax`9 Y Z`@@Pe$ ` Y. `@@PZ$  㿘!6` D   ޔ 2!   0 "0!m(! !  @$!㿘!>  cA`v&@㿘"   H&`&` &`@ &`&`&`&` h` m  `Ti Z `e Z `D`@O  㿈'蒒 > R1"㿐   ``'%@? X `  > L .> %K "X#  2> "`<  X  "` L +> ے`J@ `"$`   A & &`( &  %`(%``  `@$` "㿘`"! =VV@@"` )  2` =   沔 v &```'t@ 'l  \  X a tH ltbP lH /` * ! ` (tH 0 lH /` * ! t` `8 %> ` `> !Ē *t  6-ޘ t` `8 "`H 0t`8 2`zt2 tx x @ @3 xtਐ @2` ``'x`'|`'` 37 P'''    ?؞P''t ''''' ˖ 2tl 'plh耢 . -`  @'h'p  (t   `( Sp "lԒ  'p @l  " 6l Ғ`;l`@?4  2` 1 = `?> Ӑ#P $  @r?` T 2` R`  _   =H 0l% \ l "tt m *t㿘  h @N)o$ $  X  h""< $  ,t$ ( ,  0 $ <$ @< P$ 4$ 8$ D$ H$ L @  !$ $ $ $  !$ $ $  $   @2  H -  㿘   O 㿘    " 6 &   0  " `>-(`  ` "`  `    㿘> O#0 㿘    㿘     㿘> NT#P  EX Ұ -> cL  & `1? L`,> Ӕa7O    8   $@   0`  `4a    &a2` @ ` =`  "``  Ț ?Ю '''''''@ '䰒 2ka`    '?'''''''@  2Wa L   K,:Ia  ' L "@`   ?'''''''@ / "?`@ 2M "@        # " 2 a  @@*'a` @&a 㿘#`4 4@2`,Ű (° jǒ `,6a``H(@&`,`4&`Xpݒ  N`1  `H`,(0'6a`> 0z{2> 0u`,( 7`H&`,`4`X " `, p 9`,*@&`,,&`X0]a  &a`,  @ @la J&a0[`,(1 N`1  `H 5> Ԑ!  + N`1  `,( `H 7N`1 23 `H2/ `,(+) N`1 %!> Ԑ! " * N`1 0L"H/` /N`1`4H 0 x> "' C - 'ܐ@ܰ :> ܒ@#  -`+> ܒ@ "$N`1 2``H2``,("``6a`H/ /3ҐH 0   > 1"(X> #L >  h l(   +*" +@ ( , + + +@ #t* > '#h#l#p#x;X#\#`#d#|##M"?!;    b`2   #@   b > 1#X㽈> ""''@/쀢        b("  "  @ ' `' Ҕb > 1p#p"@ @> "'   @'@  -" > 1P#x>  H  4b '24!H       4@O>> Ԓ@O9$ ,` @Jƒ!7' /`@OP> #\ؖM7!`ߐ@OA , )>  `%?`l 2  `n > ԘM!`@N  @N,!H@N9L@NB ,!?M?`@O  > Ԁ`#> Ԗ!L> Հ`֠`@N!H `2L> Ֆ!Lܐ> Հ`ɠ`@NL , > ՔL͒!`@Nא , >   ؔ Ԓ!L`@N@N# > Ք(L!`@N > #\0L!`@N >  > H@Nh @Nc#V @N^F` P> ՔHLq!`@N{ > X  Lb!`@NlV  > '> Փ,   `LO!`@N.V @NTV  , > ՔhL:!`@ND`@N>  > 0 p㿘 * -   0 >   2  8   &@41͒  Ӵ     լ   t Ր X X 㿘> > Ր"  l > !"!"` 㿘> #> "  o> ! 2 X2   > R&@2> # w F"@   $ "" ""* "">4!ܓ. €!m"  $ <$ @!$" $ <!m" $ <! !$" $ <> I " " ""  @ " % 㿘 `""`> "!"  &  㿘   `  24O  2 `> !d`$`` 2`A  &>  ?` 8>4"*` € - &  f  ߖ Ԗ    -㿘  @"!   ( "  > .@@LՐ J?` 2&?.@& 㿘 @IÔ   2 㿈 @@@< - 5  1 " @+ ' @ & @ @  &! Ĕ Y Z`@G"  @G Z> Ր!M !PI  $`㿘@  > !Ā`    2!% @&! 㿘 z > @   h@^> > !> cLc &`Ԗ Hؔ cL#@ &`&`&`&` &`&` h`   `T Z ` Z!Pa  `D`@G%  ۄ ۄ ۄ ۄ ۄ ` ۄ ۄ ۄ ۄ ۄ ۄ ۄ ۄ ۄ L t t ܈ ܈ \ h ܈ t ތ ޘ 8 @ p | ߈ ߈ ߈ ߈ ߈ ߈ ߈ h h h h h    , , , , , X X $ X 爝㿘   H  2 "  2   (2    eC "   ($  ` >6(`"`   "       㿘  `  @!խ 㿘 `>6ȇ(`  ` "`  `    㿘 > `!` ` `I`㿘    㿘     㿀> " '         ː !>  < $@ $``<$`$`H#L $`(<`P<` `@`<$`0$`,$`4$`8 `>6"(*` €,! ` >$` $`@ $` `$` $`$`$`  `K*`>6! € "> #> `4H  8 :   <` $`$` $`-<`P $` " $` `<` $`<`P - #LԔ  *   :  P !  <`P<` > F"" > ,W" 0      /㿘 > #  `%@`@*@ ? $` ` 2 M .2%@     `*  0@ `   > `" @G? `?`   `> Ր"(@G4 `?`  XJ Ԁ`Ғ `@$`> " > ۦ! `" @E  " X€ " " X ` `@$``@#"@G X  ~`| `@t$`@  `@$`X[ c`ap  [`*@W$`  M> !> ۰  FaT ` @F   " X€   ,@ 2 `6`  ?`@$`%@ X ` -`@$`@   !@ 㿘a `    㾈>   b '   ɰ @D  7 B 2  > !T- @> a  "  X€ " `` *  '  / /     & }>  X  t q=  K>6"d-  €  > Ր!'/ ,@J/  '/> Ր"     '/> Ր"( y 4/X!`  . '/>  !X!` - '/> Ր!\  /#`@4> Ց*  #'4!Fh //    `  = = > *&"0㿀> " '   > #`4> Ւ F3 2 > Ւb @H” ` W b > )"@ # Є #* ((Ї8 #2    E ` p | 㿘> #*` €   㿐`X``  `@  <`>:!*` €>  䀤 ~ ` ?1> ` ,> ad   > , !D@*` $ h d > T/? ҫ  `D . Q@ L > , aD*  $@  @ $@T```90.> !@ * > !d`` ?`  > , "L"@*`    , "> bL* @`` x     > Cd"p  2  > #쀤 " > CX" 2<  > Ւ >  aD* * `@  `Ҕ0  6 (` ' `> !@ *"> *bL" * ` @`   `h@   `  ` "  (`` .'' ( 2@@ > O L @Ba  > @A &@ 8 `?'#\#`w ?S" @"@8 Ht쀦 " 0B"l 㿘   J 㿈     > B"  2 <> #쀤 "<> B"  > Ւ )>  aD* * ` @  `0  2  6{ >  ( a@*"> *bL" * ` @`   `h@   `  ` " ``"_ ( 2@@  >=`쀢 ? < @A  @A %@@ 8  ?`@%@8 `H@ B쀦 " 0A" 㿘   < ` ` > Ց*>  aD* `*> " bL* ` @    @ A"Ё㿘 `< 2 ` > * aD* `@    E㿘 >  aD `(*`  *  ``,   € 㿘 < JH /d4p* %p  >  0   0 Aq 0 $ 0H 00ڠ` > Ւ  p` H 0> Ր#Ї0H 0 㿘  p   F> !`"> @> , "L"@ *` €  "    "     2" 㿘   <`- `]>    !H ` ߐ !H` "  4 @!34 > * D@*` 7 @!2  `v    Ӵ  @!` u `ِ 4 @!4 > * L"@*` @#   㿘 ?   > Ֆ 2 #8B( `>:(`  ` "`  `    㿐      #\ _  㿘> @g#P㿘> !> ‘*`" * " @K%> " @C`4` <@B@CZ <* .@B@CS * > 2 $Ta@B>   ,'"   !n!m:"`> #> Ւ# @  *@" `@:* !'48D* @4>  $6&% * ,  , @=b.6@㿘 6` &k& g2`**`" " `* * .`@ * @ d@BK> ,@@'> =)> ?" 2` 2,   ! "!n!m  `> #> բ#6  ?> Ր#AC  ? : ?*@  ?, @*`" *" * b $(!А(*"@ *`@  &@B d* "*"@ *`@*`@*`&  > > ք `> ք  (   > > ք  ` `+``   " "*@ .*@ ``  > > ք  ` `+``  *@㿐  ` *? 6*.`  .2 2.@а@ .  . .`@ .@  `   " ."       .`"2  < *`#"@ &  ?> ՞# .@ `2 @ .@   $ &   ?? "? ."?   > Մ# .@  `2 @  .@   $ * 2@ _.@@ ` .@7 5  @A  0?,@@   @ ?@ "&  " @ "  ~  .@    @? "."(("@   ( ** *  * 2 ? (@((` ? @((` ? @((`   @*((  @* @ 2?[? ?+` (@"@ `P@@ ` K> ֈ  * @   7` 3 > ֈ   @   #`  > ֈ     ?@   `  ?<璂 @a ?a @ ((` *`` 2??P`@?((@  +` `/"<+? `4< `  +` `/$0 ` '*`8+? < `  +` `/" +? `  *`+??<   ( @0`㿘`? " .`` ?` "`."` ` @: 㿘> a> “2   ;: 4 > "`0 㿘> #6@+> )> #@`4 0 * @ "  @2 2 2 , ` ȵ `4> >  `400(   2  2  2 ,"   2 @ 2" """@   2   " "㿈> #`tc 2``"`<`  &>  @   & =/ @; > ֔   륐 8"` $ $ $ $ 4`$ $ @$ `͔~ "$ 0 "`0` $ ` $ ,`t#@&`<@## @ "@, h`tc 2$ t`<$ t`@)`$ x !4 r4 j, i4 l4 nS4 p@ 찒 p \哔  c, h , i  * @4 j  * @4 l  * @4 n  * @4 p  * @4 r  * @$ t  *`  * * $ x 0`t    *` * $ tj h  " < t?c @;  > `T*  $ x#=  "`<  &㿈  X`@2   $  &  r p  h . h 0 `   n     l j i  ?&    ? h`&  , z @ 耢 2t \ޔ   h * *  i*`  k* j2 *` m* l2 *` o* n2 *` q* p2 *` s* r2 *` w* t2 *` h  {*` h  x2  *` h耊   y*` h耊   x*` 0t#耢@  u* 0t#耢@  t`*  0㿈` @ `h``0  t#@> ` ` : #x T@@2@ 2 "  P    @Ș    x '   & x $& f 㿘 h Z%㿘 > aȀ    D > ֐#F "ơ& V =$  㿘>  a   ``D > ֐# \   , `X @`   ?И  , \  5 \`ǁ 㿘 h@; l夒 4"@8  4  8@@ &2&  h@ ¢` `0 "`'?2`t `t 1' `h ) T`x.@ װ  \ @"2@& \ <".@@&2& ð  T`x.@ `"@ 8 ' 2&   `''@&@'> ` "`>  <* `" :c t t2?  @;[ h쀢 "  ?h谒 `耣@  i  t#@ H  *`  * *  ' H ` * ' t/2 t 2 ' t ' t2 ?8'  ' t2@ ?? Q  T \"@  D?*  && $`|$`:0& "/$`?$`  |    "(  " " |?  :" 㿐 x "Y  P ) | 4 *`   *   L :4 @?24      4 4 * " 4 *`@ 㿐8?& | $ x? & x!  H S* P2 * P* P* * |2 * |* |* @  4 @"%   6   4 `< } ' H`<q`H @   & 4 @0㿐 P 2* $ P  * *@# @   @" P$ P& 㿈`2`>     > א @9  `L`㕐@9``?  0)`t#@  H  *  *` *   H ` * /2 23 3 8 &`b?`t#"' R#&K耎 H  * /  < / 3`H* 7 `H*`H '* < H@  @ *   *` * +@ 3`H33 * `H * `H *  &`d'耢  㿈`@ L?  z0ܐ@9 + ?4 #v` t?#1 a4\蒎` H   *` < o (` `H3쀠*  H@ *``8'5`0``H*`H*) < H@@  @ *   *` * +@ 3 H33@*` H@ *` H@ *` '@ 􀦠2q  $ d 㿘6` *@` L?*2` `"  "    * @" ?ᨐ 8㿘   2`* `(  "  P & P `?   2'`2'@ 㿐`   q@R+ : @qbmڐ  L`9 @8 @$ 4` ,  `  * ?@, G8 ?t: L` " @ 4` @!4` ,  `  * ?@, "8 ?O(` "     X㿈'?g@7 耢` ? "0{ P6`  $ P* ` * *#  t?#@")o" R@ #@,J t` `H   *` 2  <@ H2 *@  H@ /*` H  ** @  H !*  H@  @ (  *`+@ @ H+ @  * @H6` @*` H@ *` t@ 6@ ?8@ `( L@(p 耢`n 㿈L  2  '?," L 2 *L [$Pಐ@6@7h 쀢 2t "= ? "t,08#@  H@ @  *  *` *   H ` * o 23  2LP4 $P*  * *# L( 㿐t  0 h > 5 x >  `" t ?>  8" 8c   `0W 0 2' '?, p&@& t 2  $t W     ?$J$F' h  `T?`\ `D" `*@ '``@g !`\`T "@. ``\ `\`T T P"@ :  H ?$ T T?2 H> 3  H@2 <$ @& ?`'`2t H > ' b ' '`'@'`'ܔ*  ''''$` 0" h ? ` `ܜ @ > Ȑ > @ "``J@ .2``  2 `J` .2`#  'Ԓ` "    "` `'`  2 ``2` @2 ``@Ѐ  @ " ."'̪ T'?ؘа ЀC H ``? '`. ? &     `ђ2?   @3 "% $?% $[% (Ц ` ܒ`h'C  Q> @' @'@* @'  2'` @""` , ` `۽ /> % (% $`(` $`Ē `@$`?`@  Ȕw    * #t @    * @*`< " Ԁ " '# t#@ "<`7 @1#=` `Z >  t Ԁ lȰ "̰ > ̀ `"@Ē ܟ`@$` 5`1 @-#2`  ` >  tԀ [̰ > ̀` "`(u$`Đe p @5Ē \`@$`Ԑ8̰ Đ=` W> `*@Q$` ? @;Ē`) :`?> `*@+$` t Ԁڐ#"@̰ > &"/!>   @ Ē `@$` "`@Ȕl > " >  㿈`$`x `0?``"`T 2@'     x ?^ 0`T`x*@ &`x`$`T2 찒  `$`X `?찒 \`$ `X`H @  ڡ h , , i, k, j2 ,  m, l2 ,  o, n2 ,  q, p2 ,  s, r2 ,  w, t2 ,  h` {,  h 2 x2 ,  h  y,  h  x, 0 tc  u, 0 tc  t, `( < `(? 1&`(`$`X@!谒 L`$&`$`T2@  .찒 @?`찒 6`$`XH &`$?% Ψ \谒 "  h t'`t#@`<"'  #ۖ 㿈 0    =`?? .H"%> #> `" 2쀢`@0 a@0  H * Ʀ° 0  㿐`h ' 1' h "i `ttb a`00@"`t> /ې!V #@>`<N9 `h H` `  > גa@0 " `<  `#`t*`  ` `*` * tԀ ( `<#T`e' *  `h Ֆ?`\`t`T?" *@`D`@ ``   C 2> 1!P $ 㿘 X` ` T  \2 "@  @* `*  T \6"  < \ D" .@@   ?ۘ    &  X H  '㿘  0 㿈`,$?0 &`,  *`?  `X "*찒 1` 2- `X( ' `T?4   ?` 0`XH  `"Ơ $"    㿈 0 ``節  D B  o `5 3?L ( H H@   @/{  a`͐Z  V㿈 0  * 20 ?  ; 0#H@ @   @  "` `  ` @ * @! Ӑ    x ֭ |  `@@@"Mxa  ` @  Œ  `@@2 -  'x`@@"x ``ֱ @S! ش 0 ذ *@&x xI| @&(&&$&&,(  < " ʐ >  `@&  `"`@`@ !!`f  q0l f`@@@2 @b   "a0P& && @ & &"& `t#@2&@t @k0&t`   &t`px Yp Z`@@,$ x` Ympp `$ @,@aP |㿈    4Z > " + `Ԑ@    ֔ `@   ?C   x ' `h ?ִ 2`( "p``  Ұ O "?찒 2  0 ; # 0!H@,-!$@   *  @4`  * @4` ,`  * @4`   * @4`"  * @$`4  * @4`(  * @4`* ,`$x`2`"+  #  *2  *2  ?8 O`"2   *`   * * $`,  *`   * * $`0 * @$`,$`0` 2-``" 2W `4 2S   * @`2L #  $`t$`$`  *`   * * $`4  *`  $`` $`x A`t#@ " 2 O`@@2 O`0  @*2e@ 8 O`@*'`0X4`$`0`,T$`,`P4``"L4`"`4H$`4D``tc $`8 " !*  #@ $*@ *@ $`<`4. ``8@$`D & %* @$`x`4" `` `*`8 $`<@.]$`D$`@`0 `D @.T" `4$`H` $`L$`px /`  `?`*?* 2  ?/  `t ///  ?#  $`t$`$``t/2@`*` $`h``h@.$`lZ?$`\ΐ?$`X$``O? *@ $`Tg OY'`x`8$?찒 2Z>  Ha@,Y  2$$`x> גa!@,Q  2$`x%> א!@,I  2$`x#@,B  2 $`x ! !*` ! !* * $`|'`L < 2  3* $`$`$` 2`@ ` $` ` $` $`d` &a&`h  &`l" " 쀢   U?` ` "䶒 <䳒 ;&a 㿘6`   a` "`` `  ?,ڐ`䐒 <䍒 ;`@*@$`@$a㿐! q  `&@㿘! H`@ &``&`H&` P&`P&` &`&` `Tj Z `f Z!Pab | `D`@)  㿘 < " ` <2`  p ` @@` `` x@ 2&`@; s 㿈!'''' d  >S 6> *|!c耦`  ` K 2'  㿐!`` 2& `&  2@ "` "`㿘!`  `0`4&&  z z z z z z z z> " '  t`2 $ x@e $2`> *" @)S . 2U`  ! /'' X't  'l 0''pp $  'pҔ醖 Ȑ / `p Δ w p ̔op ?'pT 2@> ##pT "@> ##db > O"8㿘 > #q# Q  㿐 `D /`{ *)  $  &  r p  h . h 0 `   n     l j i  ?&  㿘 !m` h` 0!`` `  2@ 22    ` `㿐` 0  $  $  r p̖ h , h 0 `   n 轖    l j赖 i  ?$  $` h`  t2'$` t#@   < x 2$`  `2   < T \ D" +   @-Đ  2@ @ B $` h !m!$` 0  $` h @$`  !2 @` $``2`  $` $` 0 ` `4$` 0 $`L$`  x <`  r p 0 `   n 蹖`, l`< j i $`H`4`8$`<$`@$`,$`0$`H h 2$`D@$`H$`D 0``$`( 0 xX* <`P<$@ 㿘` *  ?2  ?2  ?2  (?2  L?2  P?2  T?  D? ? ?"`<  2  ?2 $ $?"  , $  t ,?2`0 4?"4 `0 @ "`0A "`0 ` ] i V`0 `2  4 ,? ,`n 籖  4? 4`r`p穖 `h` ` ,`h$` ?" H`0 @ "   ,   `h  ,`h` $` H?`0 @ " H  H@@ `h ߐ ,`h` $`S 㿀   0 6 h  0  w vx 4 `T2w  8`Tq @+  `X'`` "@ 8 x " *   0 S ?`+`\`T#*`@ 'x* ?#\#`+@````  `\`T?"@ + ``$``@"@8 HE 쀦 "  X @@  $x   ' < '0  > 0 耊 " x =e '"H ]  W @ B Q "x`2 x`@z ? x 2  (  Ð .':`x '  B  2,``@ ()``:```@ E@`TB B?@*?4"@    耧  '耊`Ҁ  m̀ `T7@ ?` ''@*`\% @*`X  @ P @E @*p@*Ӕ @*h@*˔4``2x@ 8 ``x 42````@-  'H@%<T"@P`\T`T"@ ;   ?"`T`T?2`X "c 0b``?ǘ `X `` @"@ x <  B 4  &x  @ @aH ܀`` L  &  `T @)Ւ I@ G   耊 ?ܐ " @ b %= x ?@ 2   ܀:    E㿘   `?N   #`?㿘   < ` ao  8  5㿘  - + P> > " ''''X!`$  $2`X> %["h X  #X̰ Ͻ̀ *̀ Ϫ>   `Ŕ ے h`"   J`.   `  @ @Ȕϰ  $ '̴   ` ` $' +5/Ȓ ϗ `tt2 Ȑ $`" ̒ߐ 2`@2> $ʐ"ʔ 2 ̴   !h q  B`  s …N   ׀  ? $ > $"` .Ȁ 2 > $v"X` P `$' > $_"A` P 7\А  $($$   `,`$,$`$ ``T 3 Ř  `V ”R `X @$ /` α>`=t 2`\> #"?`T?" `D*@@ `~`` $ȕ4 `H+ + `t#@t`<" 2+ ;+ :`t#@ 4 24 2+ 5+ + + 4İȔm mk ?$> " >  P#> " '  t 0$x@߰   ?Tɚ 2`@"˒  X'p'p 'T  'pҔ Ȑ / `p Δ  p " ?̔p ?'pT `\`T " `D*@``@ ` H@"`` H> ܐ  @W H+ T2 + + ̑2 + + ʑ2 + + + Α2 + + ґ2 + + Б2 + `t@ t`<" 2+ ;+ :+ 0̖2 + 1+ .ʑ2 + /+ -+ 2Α2 + 3+ 8ґ2 + 9+ 6Б2 + 7`t@  T+ T+ t+ 4 t+ 5ߐ /T$2> "#( "T /'''t 'lP T@> #u P   "@ > #f  > Q#@㿘    O' V " B` @ B_  v9  罒  j *(㿘  -  h'D> "   '` ' ?h 0 @!!` `  Dv %` " 'Գ2`  .`D"@"`2 't `t#@2a`<]̒ @  @'Ù@ Q`ڐDD̡4:  A'Ȩ /> -> `tc 2'`<'  /   /P@&Q!  /X@&I!  ? 7`@  ٔ 2D D " &`հ   $`t`: 'Ȓ `T@%d̚ $`X`` `"@ 8 x"  8 Jܴ ?`,ܴ  @"  H  s "}?  ` vؔo" k? #`t*`   *` *  0  - +`<  *`  * * 2 ``<`T`\`D" * В   @&  H$ : :@ @SB  '/ ` ᥒ//@  ? 7`@ ?    &` ئ `H D w ` :D `"@""@` %`=`x Ȓd @  b DD`8   "@ "> " > n#` 㿘  X 8㿘  `N 8㿘 `$ 8㿘   `0` "  2  2" \T "@  ;  5  㿘  \`<? `>  ~#p T P@2 T`0\ TT"@  ;@  ?$ T T?2`  H@ <$ @ T?2` H /d * % H 00 >  ` $ D` 8*` € 㿘 > `# t !  ?  2`  "> > ##> ה!#Ӗ 8 㿐 `  x #\   4 ``0>T( `  " ` $`    `    㿘!#8#ТcC @$@ ,ӣ(' @ + 3`3  @$@ @ 1 㿘` ",. `". %``  `".` ` ". `i`". .   .  . .    H /f * ' > " "  > 4 `` $ 2` $ 4 $$ $ $ H 0$ $+$ H /f * ' > # "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2$ . 7$ & 0 % @      ǔ  "@$ $   uĔ  2"` uԐ l" `"`"` 㿘 8  . 8 @n   " >     > `@ 82"  2&   "@& >  㿘?2  @c 2   > " X `"X""H㿘? 2 @8H /f4 * '   @@jH 0 㿘?2  @  2`  @ H /f * '  X   $ X $ 2;$ $> #7$ $5$ $ "   2;$   >  $> c?  > ؔ`!t  # ? #@H 00W     )$     2 :  %$  $  $ $ $ H 0  H /f  @ېH 0 @ѐH 0 * '  $ $ @$ H 0㾈> ?b2   '@b``2`; T 2`5 2 0 ` `, '\ (`@ki  (  /H /` * !  H 0 > 6 h "" 4" " " 4" " " 0㿘? 2 @ `; L w F"@Cj@= "v@ "7/"h-fq@/ *t@'s@"k@$ w@ bo@bn@ "k "m@" "p0"{@} "k@"`Is@"q`H!bv@J  bh@bi@"`b j@"`f@"`W q@' Q "@o t@x@"$ `<B "n@ ">  "o w@".`L4 @"`0/  "~@ "! u@ "8 zp@r@" @ "`"}y@" @"   "w@ "V"g@ "N "m  v@" @>  0"f@"*` "l@ 00"{@l 0ޑH /f * ' ` ``@H 0&& 2 > "   8$` &$`  @H /f * ' H 00 " H /f4 `8* ' `8   ` @  ,`8H 00u` o@n "k  h& e @` "]  @0X@T!,> !@ H$`  D B$` !` @]&` @> 5&&`41&.,`:6+6`@(&@ $$`@",`; &@ ,`< ?$` $` $`D$`L `$`P @  $`T& ($`H &㿘" ( ,` 2 @@ 2S H /f* ' & ,& (H 00b5,`  d` '@ !H /f* ' & ,& (֐H 0    㿘>      (@8 2 `"`  @( 2 `",    @ !H /f4 * ' @   H 0 㿘 (ĩ 㿘`A?3 2  @}@H /f4* '  : "   ?  $ > #"$/\H 0㿘? 2 @H@V`?>  " ``&`8&`( 0$ 0 (@  @oa( < 2  2 0㿘#> ؀ 2 3`x Ҕ@㿘`'  ` @` #>d 0& 0 (@k @0a < "` 6` 2 0㿀''7' @6㿀H '''H7' @6㿐    @ 4   $&  `2  4 r& 4& & & & \&  D   H` L Pf T.Ӑ \ `& \   @6$$@""  2" :`& 1 D   H` L P; T. \ `& \ے  $)>  c #  & $ & & & & &  D   H` L P T.} \ `& \ 㿘  '  &      & & &   Ӓ  7㿘 X? "& X  " (Ē   " Ҿ  " (Ҹ  ( " ,Ҳ  , Ҭ @Đ㿘    2> >    "@" """ "&""㿘>  < >_#P-> )>  /%@ @ 6 !D >_ #P!D`@ `0@ 2` `%>   2 l`h   `V  2 & <㿐`-    -0%1> "'h 2􀢠> " 4 &"1> "'U " 4&"  > "  h2l2h 㿘  t ?  @ t& h&>  & l l"`p"& p㿘 l`" p p"`p p l"@ے 㿘 >   `  "&@ 2`"`@@  ,`    "`&@㿘 ` ,>  `    2 2  H /f * ' aH 0 㿘 D   H` L P T, \ `& \2   D , H L T 8  x P 0 , t `  h    $ D | | @  E"@ @: `  " * ( (-  -   & " "  * ( (  * ( (  * ( (  "  "@ @: `  " *  2" "   * H  )?? `">f#\*` €   A2  s`   J2  ֘  Z2 ` Q "  :H  @ 2ܰ  <@ @ + *  *`   @ 2°  m@ @ *`   2 `  "  : z x@   2 `  "  :  `a, @ ], [ Y  * T@ * O@ * J"@ * E"@-  () '  *# !  2   "  (  *    2  "  * #  0  +3  #     @     + 3 ߠ ݘ 2 *`*'>g$(@"> j   0q"f`  0ih > VU] @"N`"I0C 0L 0I">pP8 0A5> 2.+ 2  0  0$@  0  0       **` `?㿘!> !>oTc@!㿘> "D  > ܐ "b8 '> /> ܨ 3> -5> > > b8"< /> ܨ 3> !5> *`?# > 8 "8  #b8b8<@D*` 8b8@  6 PD b8<@&;& <b8 $<b8<@ ** @6* "<< *  W@@ @ <%@*   C@D D $D& & @ْ`b8D*`" ! 2!> "0&!!&!А &!`&!&!4&!@㎐@ 㿘!<  (@K (@ Y@( , (  @W`(,`( , `0 P>  Y+` X2`, @>o, , 4 #  $`$`  `$``"``&  $`& $@&!<$`,  *㿘 P> b@*  H o *@ g  @b &! * '>   @  H 0㿘H /f * ' !@@֒ >  Ѐ  ,`" @*`$@   2 ,H 0㿘> "8` !>  " $ > ’ " "` & &   G  & > a " "  ;  & > U " "  /  & $> I " "  &   "` "`$  & a㿘> "8`  > ’ " "`> ’ " "` & &     & >  " "    & >  " "    & $>  " " X   >   X 2  2  > &   &  "" & &  "$  㿘 <2  4  a    @ 0  ` # 㿘H /f * '  T>s {>s>s>s8 ` $6 T& & & & 䨒  X 2 @@ @ " L@wA L  X @_7! "! ! > ) > ¦  )> +> /> -> ܑ*`  `%>k ( #" (`!*`@@Ɛ@@~!ؐ@{a̐@xH `"  "`> "   "@ "/ > Ġ!,`"`& " ` 2  P<`@"`@$ @<"@ P@*   Ē  2 @ `2@8 P @*˰  P @* "˩  ˦  $ˣ >  Ѐ !@ 0"  * @`" €  2 0@ H 0㿘@  ` "&@$`` "&`` &`_{"` &` 2㿐@U  @    €? @ @- 㿘@8 1 @ 2`*  2 T% - "`H /f * ' @4H 0`@t`@?`@㿘$  L  А 8 ;$ 8L 4`4 > ܀ 0> L  ? > "4 &`@ 2 @[ 2 `& L !   /А  *`: %@ @,` * , ?Г:`$ L  `2&@> 44"4  4" > ਄     >  " 㿀> `> "  '`&#     4 > "4?`  @   @#'  "  > W 㿘    ȉ   & >n`0> a@ d 㿘  1& 㿘>  , "%  `  2  @ @U  T "   "   " @D    2  2  㿘>  " T "  "  `  2   `"   @@    2  2 T 㿘     > "<  > > "D. @ > "@9@>  `4` ",` 2#  `` @@ @   @`* "  @ "   2``2` > `` " `    2``2`  㿘 `  H ` "D `2; "  " `T " @ . `"&  @z 2  0"  ``   @   @`  @  2㿘 ,`@ ( `$`   `@` ?@n &`@"` &`@    $ >o 㿘> #d`> ؒ`@s,  T @+6 T " ![F   2!   !(   L\ِ  ` ` & & "`!?&!` L @d@I㿘> #d`> ؒa@r  T `@+q6 T L @d~@1@㿘@*  㿘\  & && 㿘H /f4> * '>   T R   R*` 4 R `" @  2T RH 0> !.㿘>  "  (@ 2   ( H> "0'@ $@0@g[!x@!'0 !@0! !z@!y@ s D"@<8z4@0  ) !F@`T2 aI@a@0 a@ja@ a2@a1@ 0 !@ " !a@a@ڐ @ !F0aH@aG@a@"3``  !J@a@'m a@'a5@d 0 !@Ӑ a~@a@U 0 !6@0!K@"`J 2 `\" `XC Dג "`T  `H /f * ' tH 0 ``T H /f * ' H 0? `TRa ` D4`T?`T҇ X" 5$```\| M"`耢ے`\@#@➐ `Tg 8"`耢ƒ @`@i @M "` @Q 2`T`  @@ @ @`T3 "@@| $ "@ "0 "`P> b@*  "߰    ` 2װ  ` " `XѰ  " #  Ű "   2 aĐ    `  `T H /f * ' `T!  ?`4`T!`T!4`T`H 0` "g`T "    2 @q  2V`T  m -! $ ! "8!!   0a"a"a "a! aa" a%  ` 2  *`a# ` @0a a   `Taa2`T `2``T "@(``T "H /f * ' @ΐH 0" > ʐ!p> "@'! >  0   !  `  2 &@\ >  >`;` 0!     7   D ` $9  2 2`  @ 2  ̀  В (Y  `@   "@"&@ > =!㿘 ` ` & & "`!?&!`Y6    㿘N@ " @IJ?`/$  @BJ?`94 b `  @@ Q "Y ``2@  4   L  ,  >   @ 2 2 2#  (    ͒ ʒ ( @ $ $  $ ѐ$ ` $ $`""`  $ $@$$ $ "@$ $` `$` "&  㿘   @  2  2 E ` "`&   ""2"`""`"`"@ l `? "` `" $ $"`$> "   $"@ڋS P ڤ 㿀>   b'``")   & ``2     ` `@ ̒ @ @  ``   > !㿀> "> `' @ W 2 2 0    "*   &  2 !     @   `(@      > ː!(㿘 `` !> $0  @D #X@    ` `#X@   @`> "> `'%> €  > ؒa@@  2    1>  !@ 2   "K?@    //  #>  < Qa@@1 " @. 2 < ` 2"?> $#Y   " #>  < +a@@  " @ 2 <  > 3!Hp> "'`" 8 T`2 8 2  & 8a 6 T? & 8 T > 6 T   T  a7а" > !`㿘\`      -0  -0     , 㿀 X     2T" T [ 2 T "  T 2  T@ږ} L A AT A Al 2`"8`4  @S  `8?$`8`4 "`4`\ " `0`4  @`0@: $`\ 2`4C A "`T> #@ :@5 A3 @   6> =!p +> 7!p@ " `! (T(沔 V ("7@璘 !"7 4 .  7(   /`@@```'`8# ```$" 4`  `ܐ"   "  `  &` &` VM I  $@  ܔ Ք !ϔ " @ X 2@!Ĕ @ +   _  @ @  2 2  ^   e 7@ ^ @n ] H /f4* '     @&$U  7 2" $$ $ " $" H 00# $  % b"T $T$@H 00UG㿘`WŒ @㿘 X     @{ 0 X "  T`@ +h>   ` @"`  2` `  @'  > ܐ"H@  !"6  &  |   & |` a 2  @@  @ , `?# @ 6@o̒ ,   !2`@2 L `T& 0 " X  ` `@Wp {  #T[0s    T!!Ē@Ô  9  54 @"N T4!hh+`0Đ"݀@H> #"d@`c@`T> # `"ge > !> # *`  > ϐ > ! T > # " gI > !> # *` ے >  > !؀ @l0@ " g+ > !> # *`  >  > ̰"H c Ŕ``'8# `$"   ܐ"   "    &&  TL Ð  & "4  c@> > ##> # " fȒ > !> # *` Z 0n3 0k`f4 c @ ^  ` Z*@"@U "V6 ?& & & 8 $#@"   "   ?`&&  SҔ    &@@2`2`2`2`2` 2 ` 2 Sb0,H /f * '   @  `SM&   0 &  2" & &  & H 0> > ܖPᰘ :  0 *@ `  *@`*@`> *!㿘!Ā      .!.!.!.!.!.!>u!  %& . Y. Z& \. X!<!  Y` &!̐ < 8 㿘!̀`""`"@ Β 7!̀2  ?> ؘ @  (2 (2    ?> > ؘؚ 2 ` 2`(@* 2(@*  㿘  "    N /"" J / 1 2  > ܐ"h} > &"p ^.@.`.`  `.` .` )   3  3   3   3> ܐ"xX > ܐ"S  .`.@ .` .`  .` C.` 㿈H o *@ g     H 00Y 耊 2 ȃH 0L  @@  2  @9  2      & H 0.  7.   H 0  7    & & à & a̐ "`&a̐a& aВ`&aБH 0 4㿈H o *@ g     " ȃH 00> @ؔ  2  @є  2  2  H 0$ ?  & H 0  `"  "`  "@q 7aА?&aБH 0 4 0 x  0            8 t 8 P    ( @ tt  T    D   ` DTlTT$$\\|DDDDdddddDMMMMMMMMNNN OOOOOOOOPPPPPPPQQQ Q\QhQtQQ㿈 T  `! | @  & |&" `> ؒc( t ( l `& P& l0$! `  / SH/  //` S>   "! 0  !  >  cX  ( 7  l 0!@"3>  #`!H  !@"<" "@*#@"."" "0&"``! +  3 @.  >  c    (  & "@0N" K@0G E@L0A ?> ؐ"\@09" 2^ T> # `"c+ > !> # *`   > Ģ!C&"! 2  M>  c  2 h  5@  & @P 0b> # `"b > !> # *`  > ^ > !̀>  `    ( l T `" lH /f * ' `` @&&`` $`H 0 > ْ`X _ (` 2 l[ l` 2" $@`$` $`H 0 㿐  H /f * '  T`&"@@ OH 0 22`@6 TH 0> "(@H /f * '  2G!`   `  *  ( :"! 2! OMH 0 L 1J !Ѐ@6!  2!Ā >  b* @ " !  *` 2!!! 2\```'`8# ```$"   `ܐ"   "  `  &`&`  OC ` ` `` &`2! T > ْ`x z ( t & tH 0ڰ 7 ` ,,   ,,  "!N t & tH 0 /( "  ! 2` "Q4 ```'`8# ```$" 4`  `ܐ"   "  `  &`&`  N͔ ` ` `` &`2` T > ْ`x  ( t & tH 0d 72`!  @ !`NK&!"0 70/&` 2" $$ $$ !   !!@&&`N,  7 2" & !&  &! " T! &!"  T t & tH 0$2! @! @& H 0 㿘#> b( 2> !> >c",㲔 > !ē*@ ",㰓*`> b(" &! $b( >| 2b. X& &!&#&#&!&!А6"6"&"&" &"&"@&"@ @@㿘> "( !! "(! 2!!"@( 2"L> 㧐","L" 㢐 㝐㿘!   !(  !!Ġ!!M  ` ` & & "`!?&!`@@H4!Ą(!Ā  !܀!`?H 㿘H /f  ! K € F* ' !܀    &!&!$ !?&!䀤 0@ ڐ 2!! '!Ā    &!&!$ !̐?&!̀ !4 Ɛ ! 2!$    & & $ !?&!H 0㿘H /f  ! & € !* ' !܀`" "!! !Ā` !4 2ߒ ! 2!$ H 0 㿘H / * '  2@ 1@~@{ @#t @"  Tn  !@i 9@a@"M_ 0:@W~@"R \U Ð T @`? T@  `? @  ?Ȑ*6 T32! !  > ",@ ` T! @`$6 T> "(@0 T ?6 T"Ѐ(& \H 0 "@H 0㿀` T  \> ْ` ( 0V ``> #\` `#``#d` #h@ (`@A 3 ;> ِ! (066"`"@&""  > ْ (ǐ!8 T`6"@b!" ^!6"&" T@  6"> ِ!H (0  @Ԗ􀢠@ 㿀 T H /f * ' > "3  > 4 `` $ 2` $ 4 $$ $ $ H 0 P   $ $ $ `52 *<"*c# # 3 W3 3 ?2 #\ > #` aP#d   (  !!耢@ !!`&!Ka&!  $ ! 2" &!!&! &! T$  @  !  @& 㿐 T! `   /  ؒ"@2  8 H /f * ' > "  > 7 `` $ 2` ' 7 '' ' ' H 0 h,2  @' ' ' !  2 `  **  2 2,@,`4``ߔ.`@2 @ @` `> #\a u ("> ِ`@> !!!耢@!!`&!J&! t   & t' ! 2" &!!&! &! T$  @  !  @& 㿐`T  $>  a`(0 0   b*`@Z @ #\>  a#` `(*`2`@> a!4 ?` ܪ>{ 0*` €4   >  "E`(`lb* @   4    * `>{ *` €  @E ,@Z 8  @90 b,b* "  @, 86@$ >  b0 `( ( b( `     }>  "@`(x`lb*@`p>z#*` €b+`b," @ 0`@  ,@ 8@  8b+`b," @ה >  b0 T`( ( b(   4>  "@`(/`l ` 2   $  b*@` >z#ԓ*` €bb,+`"  8@  ,@ 8@ G 8 b*@` >z#*` €@z  >  bh `(    0ܑ+`b,"@@c  ,@瀥  b* `>z#*` €  @H 4@0@@  ,@U 8`(@* `@>  b  b* `>z#t*` €@ 00 !@w 00 !p  b* `  x> ِ"ݒ`(t`l4 @ p> A" `* `* *` `bȖ  2`> ْ`(!8> b,€0W,@bȀ ,`bȑ2 ,`b,`> ِ#(`(+  3 u 0?0 !@& b؀@23`l 0> ِ#P`(0*> ِ#`( @ `* `* *` ` bȖ 26b0 >  # `t`(b&b 9 `l &`l㿘`T b *` @;`(> ٘ c  b* @  "b0@n 0 b,"@ @g  8@㿘`T b *` @`(> ٘ cД֐  b* ` >{ \*` €@@ 0@;  0@0 @3 0@.  ,@㿘`T b *` @נ`(> ٘ c  b* @` >{ |*` €@   0b * b,"@@  8@0@ 㿘`T b *` @`(> ژ `f  b* @` A>{ *` €@Д   4@ʔ 00@Ŕ 0+@  b,b* "b &b  X  ,@0 b* b,"@b  &b  E @ 㿘 b,+  b"@ $ +  *  "L@4 *` , "Lbܠ@-㿘`T H o *@ g bb, `(*`@  *`@ >  `ܐ  *`@ ?  $@  *  "  0;: @= * 4@8 % 4@4 ! 4 * `#>{ ̓*` €b &b  Ú 0@  8@0w 8@H 0㿘`T b * @" @`(@> ښ `8o  b*  "@>{ . € *` * "Lܿ@0  * @*`@b` 5> Ē%ܔ   """"""""""""""""<""""Ё""㿐 T!` H /` * !  . [H 00D %&"&"&"А6"&"&"  T&" '&" > ڒ`H  ( T" @`6 T "!> O X!!> ؐ "&!`€" !> > ? p "" !> ؐ"@ 6 T€"͒㿘 T!` H /` * !  . [醐H 00*> آ"Ւ T @ > ڒ`x  ( "> ڒ`  (" b @! T &!`6 T㿘#X "  ?&"!> ؒ &!"ؒ㿘> ؐ"㿘> ؐ"{㿘 T   z > ڒ`А ] (n ` k!> %> ڀ" @@ 5 @ @ "   0A >  ` C0  ` ;0 4 `"- `w ) `0 `*@ *`2`"#@2 " ` > c! `" 2 ! > X! `  &!> O!0 `P `@ `% @ ` > 8!8-0`!3 ۔  > > + p> ڒaH є (` 9> ڀ" @@ @ @ "3 `  "L ` `S 2~ ` ` `*  `*` * ` "Ȗ  t> ڐ!h p `> !p""Ȑ 6"8 222,`,`,`W,`  `  `  ` M> ː!J `> Ő!,`,`,`9,` `*  :&"> !6 ` ` `* * "2 @" "@ #X@ ɐ> ڐ!"2 ,`",`0"#@2 ` ` " > ! ,` ` `@ `% @ ` a%"<"  &"<> k!Й-0`!3  > ^"-0`!3  $> O"&"<6".0`!3  < `?㿘 T  s  U > ڒb  ٔ (D`` @> ئ"%> ڀ "@@ @@ "!  " "#`2!`"&"Ȑ ?&"Đ ?&"Ā  #Z  > "8"Đ ? &"> "`@`&@` ǀ >  pڒ 㿘 T    }`> ڒbx y (l`` i`'> "@@ U@@ "J`  -M`2K`"Ā FE` 2C&``*`* `@*`@ "Ȓ@ 8@ `> "U*&"(&"> !$`"` 2 &```,  > ڐ"z:$"$8%"&"̐  &""> > l"`> ",@`&@` ``> Z pR 㿘 T@   > 析> ِ!H3 (> ܢ" , @ `"  @  , "Ā  ! "  &"@ ѐ> ܢ" , @ `"  @  , " > ܢ" , @ `"  @  , > ܤ"  "Ԁ"  ,  `2  @  ,`#Ѐ"""€" @㿘 &"@   )> "Ԁ",@ ` 2 ` @@@,㿘 &"@ f#Ā`@㿘&"@ Z#Ȁ`@㿀> ""Ę ' "Ȁ  T&"Ȑ / , "Ș 2 2 2 , , , ", "Ā  ,   , "̘ 2 , "Ϙ ,  "Ā  #X,  *0 2`"#@   , *2 ,  0, b#2    ,  "+  &"."(0`!3  b > J"> "Ԙ   *`  ``* 㿘"   > ",@""@""""""㿘> ؐ"\㿘> ؐ"\ڒ㿐 T `@"    > ڒb ( 0  > "" `&"&"> ؐ"\㿘> ؐ"\ " @+ 㿘> ؐ"\㿐 T       > ڒb n (`4  1`/> ڀ" @ r  `   >   > !0  @ $@`  ր`> !8-` ``!3  > w p @ > ڒb  ([  X`/> ڀ" @  Z 2;   * *`  *   ` " "@ > :# " !&" > /#0 @ > '#H, , 2 , ,   @ $@`  ``" ` 2 2  2 -- - - - -  > #``> "-` ``!3  > ސ#x. ``!3  ͒ `?㿘 T    / > ڒc j (``  %> "@@q@@ 2`" ?&"`&@` 뀤 >  p 㿘 T  ʔ  R`> ڒc 0 (A`` >`'> "@@7@t@ )`& 2$&```* `*`" `*  &"@> U#"  @`> J#`&@` Ȁ``> < p4 "Ԅ""ԝ㿘"Ԑ &"ԁx#> " b 'ܔ @3  / , ܘ , , ܑ2 , , "  &".")`!ϔ b > #؁>  T" '``4 ` > ڒc ( `@4@ ƪ`   0`  0 $@@ 0 ( @"#> `` 0 ( @"#`> ``H[ ,@2`> ے p@> !@P @P`#8 @-@P@P@P "/ @@` #d> #\#`#h"#l  @[A␀ > ے`  (`$ > > f *``@ʓ2`> ^ pH /f * ' !0" ?b# &!"Ā "Ԁ  H 0  ␑H 0 @ > ے` (ؐ ` > & *``@2`>  p> ے` (Đ  $@@ 0 ( @X"#> ``` `*``@M2`> !`"+  > ےa ( ␠#\@| @ > ې@ > ۔ (aH ,2`@;> ϐ!h @@d* @12`> Ő p "@"$@0@ "#``> #\ (ax^ ,@2`> ے p@> ! k> ےa ( E d␢@O @O`# @#@O#H @O@O@  !> `> ې"a#\ @U " ,"$   `> > ې"a#\ @B "$ &!> ؐ"{ " (@@)"$`@> `b#\ ( `*``@2`> 5! > /"8 ""$""H㿘"0"#@"Ā  !> ؠ" 8@"&"8: 㿘b$ > ؐ"/ 㿘 T H o *@ g   "$@Ҡ (> ۖ"8bH "8? &"8"$ !> ؠ" ,@ 0"$   "&"8!> ؠ" 8@ H 0㿘 T "#Z &"8P">  !Ӆ> !Ģa,1ӂ"  (> "> ۖ"> ې Dbp#Z > > ې"0"H /f * ' "! ` &"ԑH 0 0 H 0 " @U㿘 T > ےb   (k""> ؐ ?&"b,€xO#HO&#HO$ O$ $ " /" @."+&"@֐"+ #d> #\#`#h"#l  @㿀 T`  "> ےb (͐ 0``4@    0׀ 0` ?@ `$@ 0 ( @F #> `c ` *``@;2`> !0!`@@" @0@* #``> #\ (cP~ ,`2`@6> ʐ#@0> Đ!`@ `4/@#\   @#  /`> ےa !> #\#`"#d  @"" ,"    /`> ےa > #\#`"#d  @n" !> ؐ" " (@0w҉" > ےc  ( N@`" > > i ,``@Γ2`> b pH /f * ' !0" ?`# &!"Ā  "Ԁ  H 0 0 ےc (ې  N@`> & ,``@2`>  p0> ےc (Ɛ 0> `c` (  *``@[2`> ! "" ""D㿘#X0 #@2 ""Ā > "&"4" "0 #@> "؟@">bАѵ"ѷ㿘b > ؐ" 㿘 T H o *@ g   " @ (> ۖ"4cb "4? &"4" !> ؠ" ,@̔ 0 " > ؐ"Ô H 0㿘 T > ܒ`  7 (> "؟@㿘 T"䀊  &"4> "> ْb0 $ (H /f * ' "! ` &"ԑH 0 0 H 0 @D㿘 T > ܒ`8  (Z"|X""> ؐ ?&"b,€p"#8 ."*&" @ΐ"/ @@ɐ"* > #\;h#`#d#p"/#t @㿀`T'T 'XH /f * ' > "垒  > 7 `` $ 2` ' 7 '' ' ' H 0 {' a   2     **  2  ,, T  X ؤ"@@@̔@2` ' ' `4  @  >  a#\ Z`(`,`@2`> !aa耢@aa`&a:&a`t  &`t' a 2" &a:0a&a &a`T$ `@  a` @&`㿘:~  & && 㿈H /f * ' > "( ]> آ"!`"U! T @P``" J`2 "" " 4"@4" ("I!! 2"> ܒ ( H`@4"K #ȟ@%!  4"!  "` $""` !" 0""Ȑ ' $","ؒ`!  ˚! 2!H 0> !ē*> @ ",œ*`        2    "   `"   22"`2"@㿘   ` 2`""  㻸> "'V#؀ t @#Ԁ@#Ԁ@ i 0!:@2d #ԐT@ d@ @ @ 3#N!9@2J " D   0#@#@29 t` 0#@#@2. "@ dt6""D @T T#8= t`v#X@В d  @6#X6#Zx.#\ #'   b >  h㿘 &"@> ܢ" , @ `"  @  , > ܤ"  "Ԁ ,  `"  @  ,`㿘 ` (>{!*` €1> ' x1> $ 1> ! 1>  1>  1>  1>  1>  1>  1>  !1>  !1> > ܐ!Ȕ(ے !ȁ㿘. 06 `# b#4`"1>  `   ` 1> (!0&!@1> #!P1>  !X` 1> 1>  1>  1> !`1>  !h !p1> > ܐ!ؔ(앒 !؁㿘 ?`>{!4*` €1> !x1> !1> !1> !1> !1>  !1>  !1> > ܐ!( j !㿘 "1>   1>  1> 1> 1>  ! ! !> ܐ!( J ! %>{T* > "> "> "> " > "(> "0>  "@>  "P> "`> "p> ܐ"x >{|* > ">  ">  "> "> "> ܐ"x㿘. 06 `!"1>  `#  !*1>  b# * 1> "X1> "1>  "1>  # > ܐ"(2ג "㿘> ܐ"ꩰ .`  !> "꠰ *`  㿘?.`#`@#> !>  ^ ꇐb `ꂐ"ؐ*  @㿐 6 6 !> #\> ܗ6  `"뒒 "    2㿘"b (> ܒb "    [ . [H /` * ! ڨH 0㿘!> ܐ"@ ؆"㿘!Ē c  6 @轒!> ܔ =`( ?>>aȐ ᬘ  $`\4`T$`$`,`X,`Z$@,`Ya $a>b` $`!> $   0`< B  㿘>  " {ڒ  㿘` > 2#`< `T  >&`4! @"`p6ΐ4  3 A`p $`p``a@$`a4 "`>"@2y```'`8# ```$"   `ܐ"   "  `  &`&`  6Ԕ ` ` `` &`2 7`"H /f4a* 'a   a ` aa@&&`6V  7` 2" $`a$` $a "`a $a`@H 00b  >  `(> Ę!  > "H #06%L /H /f * '   @ `6# H 00 7&`  2" # > #ਠ  , @ # # "਒ H > !> #*` v `hN `h $`h``| $`|H 0 㿘 H /f  !4` " € * ' !4  ! 2!$ ` ` & & $`!?&!H 0`e`@8"   >  #H> Ę! `>  @4`bH e50IH /f * '   @  `5r# H 00.$`  2" # > #ਐ , @ # # "਒ HH > !> #*` ے  h  h & h` | & |H 00j` "`P 2@  1@ @"  T @" A2 T>l""  /  /" \ "  " " " "" " 㿘  +  2"`> E#p"` "`"@ "`"& 㿘 `` ``㿘@ 2 & > ܒ8 讐#``@ 2&  Ė @ 2& > #㿘 p `mk0!50 !6""` b `@_ Y` @2&2&O &&@ G&D& &A ` `&`&`&`&`€  ` $.     *$@*`$ 2 3 &`  㿘 8 @  > <  2 c  2㿘 #< 2 @2 $ & "@  ꀦ> ܄  @2` @ 㿘> " > 5 X㿘#`Ԓ   K @k` > ݘ  $! (?>>`#X!(  2 $ \4 T, X$ $ $!$!$! $!ؐؐ`  H /f * ' >  ̚ $"$# H 0 㿘! % H /f* '   "  "H 0 T  㿘!耢 2o!H /f * ' >  "א" $! > 2`  2!"@!" !$"!2`!" !"` H 0! "6!đH /f * ' >  "ݦ#!"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8! "! $ 2 !!> Ԑ ( T  4 T"0 $ $!$`$!@zm$!㿘> c0 c`h > ]  X ! 2P i "O 7&`&!`& dH /e * & `p$ &`pH 09 H /e4`L* &`L"Q &"```H@ &"*^#x*5  H 00&"&"H 0 2! 㿘 ؀`'. hH /f * ' k$a& 2cab$a $a$a $a H*b)bH 0X@ ?Đ "㿈 > ݒ( H26 / &`2`p2+ 2 2 T` @2T2~ A@ ` 2r 4H /f4* '$  H@ 2 x`  " '`" 'Вb@ ? $ `@D&    @&&`1А  7 2" && &  & H 0t &t xu`H &@  H 0 X> " ز ' H   ̟@ H 4) ( L H" "Q"H /f4!Ȑ* '!Ȁ   %!%!$!А?%!Ѐ"!4  %   €   ! 2!$   % % $!?%!H 0 ` HȲ ` `)@@` ' T@  "@x  @*'   / `wА H    `% )>  />  3  ` `? $*j  %  )    ݐ ) " *0 % H /f * ' T* 59ݒ  "%8@ <"`<<8"`8> $ܷ#($0,y4?# @4$0ܠH 0 2 )\ "  *)T  x`% x p `% % p > P `㿘!H /f * ' >  А" $! > 2`  2!"@!" !$"!2`!" !"` H 0! "?$!H /f * ' >  ڟ#!"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8!`  `0`$!@$!$`$`$`$` / $! 㿀>  > `ؒ`␐B  ; ' e?2 !`p 2  |` @2 |! U$!  T `'$ | 2!$"" > " @6$"! @"  $"$"" +.> $!   ܀ "! ! 2!! 2 !! 2 !$!  ?$!!!" ` ` e ! @ @*  p 2 T O*@ T#@ !@x" ؒ0@Ӏ p2 l`'Β! p@x|" $ l T4 T  `"\ h ``' 8# `  $" 4   ܐ"   "    & &  /Z       & ~ * H /f * ' ` H 01c  h` $ huH /f * ' > IJ!̔`` @``&` l `$ l.$ ` $S0 & ` 2" "̔> #਒`"" "ਐ A > !> # *` " 0 H 0!!!耢@`*@$!$!! $! l $ l!`$ $!$!$! > a h㿘H /f * '  a2@ a1@a @a@"9 0!{@2  `2- / T )6 T `"# /  /@߿ 0`|&`$ `h$ `p$ b $ b$$ b($ b,$ b0$ b4$ $b8$ (b<$ ,H 0L㿘> " > E 㿘" "  M @|" > ݘx $! (> b0?>>> "%ܚ  $ \4 T, X, Z$ $ $ $"$!$" $"8$! $!"h  H /f * ' > ĖĀ`$"""b$""đH 0  㿘!䀢 ! H /f * ' "쀢`""b"""H 0 g  㿘>  Ā  !""쀤 2!`Ā !䀢 2"쀤 %& $$!4!"P $!@$!"   $"@t"l$"t$"|"H "? 6"> #$"L$"$"H$"㿘> #d`> ݒ`@Cf 1 T&! ?6 T&!-% !  &!&"""?&""- "  &"&"""?&"",, ",  &",&"0""4?&"4"H ,&"H"H2"D ,&"D@"&"t &"| &"&"" "" &"&""  &"p> " Q'@$ S@ "a8  Z N@"@3?␀@ "4a V@,? J@{? `G@ `F@R@RY@?  M@`K0 L@&?b&a&&  @H /`4a* !a @ @@H /f4a* 'a<?c $aH 0~  y> $@(p4ao l&s ib e H /` * ! b@sH 0N S I 4D$aK A 8   5р  >  p` p 2|  = H /`4bt* !bt  bp@$bp€  $bta@@> ݐ ߒ`( 7H /f4a* 'a* $aH 0␑H /`4b|* !b|  bx @$bx€  $b|a@@> ݐ W`( 7H /f4a* 'a* $aH 0 a@@|> А Ғ`( 0  ! 0 L@bl& ␐bl@ H /` * !  *`" @2a@H 0b H /` * ! > cb"&b" &H 0G "*    $ ג 2   ̒ &    G@bbH /f * ' ""H 0     > ¥ 㿘H /f * '  2@ 1@1@") @"!n @" Th 0!z@ "P!{@"[ @V  @S ?Q6 T  `  `I$ \"F / B@ /@ 8"P&"T&`"X&`"\&` "`&`"d&`" - &`"` &`"`&` "`&`$"`&`("`&`,"` &`0"`$&`4@Ē 8"t ""|"p`€"| "x`4€,H 0㿘!䀢 " 2 T @. 2`  2`?Ȗ*@6`> `  "l` !6` ,`@!ǒ ( / 2" ````8```$"  `?ܐ"  `?" 4 ` *  2&` ° 7?&``<`* * ** `  `&` `` @`!@> ݐ!x (@ @2!"h` *@"  6 2" " * "`> #$"`*"h H /`* ! "L`"&`Y$"L`@ !", @& &` `)J"0 7&` 2" "" "$ !   !!@&&`),  7 2" $ !$  $! "!! $! "!H 0 t"d` $"d$ t@ p `% % pH 0 (㿘> #d`> ݒa(@?$ "H l"H   *`@ `! "l"Z YO $ @ # ! ", @ `("0 7 2" &"," "% !  !   !!@&# (   7 2" & !&  &! `"! &!`" t"d `& t&"d  ($ 2 &"L㿘H /f * ' !> # *@ &!#  ;S > !> # *`  0 H 0㿐b,    $b,$b0& b4?$b4  a4 `a 2a$`    $`$`& a?$a 2 b` `€ ɰ  $b`   , !   -01 !a,0b(    0  ` 02 @o  p " ,  / -,, , , @Д 0 !3  "0abt +a@' '   a bp`\  `bt@`a '  ' a 2a 2a 0 !" a   & & a  2  , ,    & & 㿘> #d`> ݒa8@= H /`4> * !>  Ā N #!$! ", H /f * ' !$!H 0 !@0@VH /f * ' !` ` $!$""`"?$"H 0 `"쀤 2!H 0㿐` 8`@`` ` `` ƞ ` `( @  @!@> ݐ!@ Ɣ0 @?`>!*` €! H /f * ' !?c &!H 0 0! ` @ ` 2("|"t~@"p @  !ܒ rH /f * ' ! &!H 0 0[Y@ @"x #\`$ !!ܟ KH /f * ' !@ 0*@&!H 0 02!`/2"|"t)@&"p@ 0 @"x(@ H /f * ' !* &!H 0 㿘"t ""|"p@&"t"| "x @&"|㿘H /f* ' ` 6`&`" 2" &!"> #ਐ @ &"&""ਐ 8 > !> # *` | 0U H 0㿀"T! &"T@ ' ` (  > ݐ!x٬@ߐ` ` `,` `  @?А*6`H /f * ' !(&!H 0 D"|B8!  <"x `, 2!% ` ` `,:@@> ݐ! (_H /f * ' !(&! @&!H 0 ! !@ "x`0€  2!H ! `  h-"  @ns H /f * ' ! 7&!H 0 -;/! +" '` #\`? @nw즒 @!@> =!H /f * ' > "υ  > 4 `` $ 2` $ 4 $$ $ $ H 0 $ $  (M`H /f * ' > #U $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      8 `   $ 0   " `  ?$ `"`$0 ?`$ `$ `$ ` $ `&` 6`  !,@,`,`,``m ! $ ` `"@ &`&`      8 `   $ 0   " ( c$  ?$( Z$2X$   `9`  `  $ H /f * ' V`> ؗ* ?2 ``-V ` "%@`8@ `<"`<`<`8"`8> `$0#``(`$`0`,``4`?# @6`&`0@$H 0"! ! " ` #\`? p@m<쀢 6  !!@@> ݐ!׮ (0,` 8 ` 4 H /f * ' > "@  > 4 `` $ 2` $ 4 $$ $ $ H 0    %z#&`  &`&`` *" 3 "" ) "`> #&"`*"h !!-  T "l "`#d0q> #``  ?&`&` `&`#  6C > !> # *` Ւ >  > !̠" H /f * '   @&&`  $ H 0 !@@> ݐ" (  &  ` Ķ0  2" $ $  $ H 0  h |`& h& |!@0 " l"X` &"X& l> "h ' * | >   ਀ 2  @*   @ *  ** ޔ "> ݐ >*> ݒ*֑" b > "(㿘!@㿘> #  ^H /e4`h* &`h  `؀ !䀢 H 0@ `4 2 !H 03 `">@>`h,!Đ" 6"@&"Đ?>>>p &"&"&!&!&!&!&"@.&" T`@6 T` & d &`ؑH 0 㿘H /e * &    ؀  . h& !䀦@ H 0 㿘H /e4"* &"  "&""Ā "!"&"!$!! ;&!H 0㿘 ؀  z H /e ;!H 0k H 0c* &#     @  > בH 0D #ਐ !8 !䀦 h " "H 0+ " pu ("  $"$"$"?$"H 0 `  "!qx>  p ؀"'2  h  @2 h԰ ϰ "Ͱ 䀦ɰ \` @` (!F`>  )> *H /f * ' "˳ "  4  $`4 $ 4 $$ $ $ H 0`?$ "$ H /f * ' "ˋ "   4  `4$ $$ 4 H 0&$ `#(& H /f * ' > #d $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8     82``"   $ 0   @$@   ?$`@8  `$ ` e/`| ܐ`"ܖ ` #` ܰ > u"X㿘 ؖ !䀦p? P@\  `U@.`X@V  W@ "  T@J  O@C IF$""C&  =:$""7&  1H /e * & "| ""*  $"$"$"H 00"| 0 Q   R@@> ݖ*  @2 (2 `* 2 㿈> "?ac' H!?b2  "6 H  ?b\ ~`&b\H?# 6b U@b@ @ 2`*  `* b    2 *`  +@"  (Hb\$@&b\%+@&H /e * & H }l < @f ,H 0b\` &b\@`? s o bԖb8 ; *   *   }//H 0݀H 0Հ/bԔ 8 ;  ; *  *  },@` ,@,@` ~,@`H /e* & H H    @?0 * H 0 $b\ &b\ $P$ H /f * ' T> ؗ* ?2 `(   "#8@ <"`<<8"`8> $#($0,4$0 4> "ВH 0 "&bb&bH /e * & @8  a$aY a$&aH 0b > o"h㿘H /e * & ! O ( oH 0㿘 ̀` ؟@!  H c` p    @ !䀦Ő 㿘!H o *@ f ! {&!̒ H 0㿘H /e * & !`">   2N H /f * ' > "ȃ  4  $`4 $ 4 $$ $ $ H 0 3&H /f * ' > #[ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0$"$H 0㿘`؀`Ga䀦@C> @bP`B :  $bPa@@> |"x`"( `2` "``p#> `n*aD * `&`p@€ 0  `p`̐ >` &`p@0H /e * &  aa@ $a> ݑ> * b@  * aa $aH 0a@@ؒ ~2abb耢 4bА@͒?a0   2<bҐ @. H /e * & a 0@ $a@@> bҐ"`(`lbX` $bX$`l0*@$aH 00 4(bȀ @> ݐ"’`(H /e * & `lbXa` $a$`l$bXH 00i` ?  "` bb@ 2@$bb! " bb$b"a aH /e * & a* $aH 0s02@*  b*@'H /e * & a @2 *@ } @$aH 00 $a H 0bЀ @ bĀ 2b9bĀ 2 ba@@> "&` b`  `$``$&`$b`<c4bҀ $ba`@@> "А *$b̐ *bА`$b4b`  &` bЀ 2bЀ  @a@> ݐ"`(abЀ 2bЀ "bb*bА bȒ`$b4b  " bЀ  2a@@o> bJ#*ʒ`(faa*2 `  4ba@@Y> 2#0b`  "@`82@` ``$`0 `  "$ @+` `  ?&@ 4$` @ 2@@ 2 @a@@(> ݐ#Hχ`(#a$b` &` `$ ``$&`$b` > ݐ &` b̖*@bҒ`*2 $b̑* 2@ (4b@$H /e * & `lbXa` $`l$bX$aH 0a@@ 㿘`""*@ &""耢 `  > ݒ ((#h"@"&"> "h '"> ݐ造  >/hi> ݑ2b @ + @  +  +   * >+ +x" > #LLLL\l|Ǵ 0 ! " ," 0" * " (" $" " 4㿘  , )#  $ (  22 " " & & $  #   & , $`*@Ϗ  ( 8& (Ȑ  㿘 @&@ <&` H&` D&`  8&` 4&` &`  $* &`2``@d`&`㿘6 & 0㿘`$M  2I   2E  6  2@  `!>!(*` €#  #)  "] " Ϥ ,  *@ P    @ P`*    & LC  & L&& . & . 㿘 L "2 / 㿘 㿘 㿘`@ 29 ` 25 `6` 20  ` 2+ "! L "  !  L*2@  *#@2`T2`V. \&  &  . R 㿐#\#` 㿐\ #\#`㿀`'H`-  ` '`? ` 'T' H;"T4'TH /f * ' > "5   > 4 ``  2`$ $$ 4 H 0H I"$ `T@ (&`H /f * ' > # $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8` @ $      8`"  $ 0   " @?$@  ` @,@``,@`,@`,@``2 ,@ ``,@``` 5` % ''쀦 '@? `* @,P@ * @`@  `  :$ , P@@ @ `-> ` ظ '耤`w'7 ,@`@*r $@$ H /f * ' > ba $ 2   5 "@" "2`H 0 CT" %$ H /f * ' > #2 $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ / `@ * ?@ `'-` .` X@*`@ `T22#2`T26&`%`% 41@2& ->  ظ 耤`w'7 ,@`@*r $@$ H /f * ' > b¶ $ 2  4"@" " 2H 0 CT" %$ H /f * ' > #‡ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ / 耥`$@%`$`  %` `%`$͐ !% *> `ظ耤` w'7 ,@`@*r $@$ H /f * ' > b! $ 2  4"@" " 2H 0 CT" %$ H /f * ' > # $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ /  u耤` q' * 2 ,@`@ h  $@$ H /f * ' > b $ > 2` 2"@" "2`H 0 7T" %$ H /f * ' > #l $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8       8 `  $$@$  * ?@ `@ `  -`  `@ `<%`@T`%`<H@ H"`4`8` %`8 %`4`H `D `%`H%`D㿘`   +     4   `& 46 `  ?V`S`  Xc   *@*P  * @       :" * P @:   #` @ *?*`. *  T@"2 T03 #  L& + ,  2  @2 , @`2` 5  $@ & & $ 4  8* <  @`& 4& 8& < & @   . 㿀  'L&`"'  '  '` ?` ` ` $@ * ?    2> #ɛ 4H /f * ' > "3  > 4````$ 2` $`4`$@$`$`$` H 0`2'ǰ $` "H /f * ' > # $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`@`$`   ?`82'` ` `$`0 #@ $@`K 0'++ +  !'F`@'? * '' 42 *@'a' @`0@`2`   E> @# ''@ @@@ +> А#>  ʒ" @  L,   ' >  8Ȭ @ <r`&$` H /f * ' > b?   > 6 ``  2`& && 6 H 0 W& &$@H /f * ' >  & $H 0 $ (  & 6 & 0& (& ,& <& 8      8``"   $ 0   @#@ #@   ?&#@ ``, V*``P *,`*. "HC, ,* P.@-   :" * P@*X *` `T23 #2`T3 2"L$ *@+2   "',  @`2` `& $` $  @ $$$ " H > ǻ XH `@D$H<@ $@$D$<L"㿘r= } 㿘 㿐`2:   24   20    2+   ' 2` ! d }ɔ  >>"4bX& 8& <#\&  ?   @C &  H@ 0k  㿘@ɐ b 㿘$# @  2 ` 2 ` ` 2 2`   2 ` "&  & &  @& 㿘 @&㿘 `c `- &@t4H /f * ' > "   > 4 ``  2`$ $$ 4 H 0 `&@$   (& H /f * ' > #} $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   $  ?$ `6   $  $   @- `- - -  : - -  $($$А"@$($$   $``$  "$    2(" ($ $" ( | r$ H /f * '   $ > 2` 2"@" " 2H 0 E' %$ H /f * ' > #Ò $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 $$   "  82 `"   $ 0   @$   ?$$( А"@$($$@  > 0 > ޔ Ԑ  "d( _  ($$ 6@ 2P " @PT`$P$T@ "X&@X\@ $X$\HL@ $L$H㿘 H&@ L#&` P&` T&`  X&` \&`&`*&`2`@_ &`㿘`25   2/   2+   ` 2&   " 2``  d {  >>"4bX& 8& <& $ @̒  &  H@ 0}V  㿘@ }M 㿘$% @  2 ` 2 ` ` 2 2`   2 ` \  & & & &  @]& 㿘 @V&㿐'@` ` `"n ` `$@ * ``*    "V >   P &H /f * ' > "}  > 4 `` $ 2` $ 4 $$ $ $ H 0 "% $ %@H /f * ' > #Q $ $H 0 $ 7>  ( $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   $@  ?$ `6   $  $@  -- - & & @`    & $& (     2 (`"  (`& ` & ` @`  ( & (  v -  $ ( & $m& ($ H /f * '  ΐ" $ > 2` 2"@" " 2H 0 pH /f * '  $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 & $     82& (`"   $ 0   @$@   ?$& (@~    >  0  > ޖ ö ؐ "Y  ( T$@$  H L P T@ & T& H& L& P'@  㿘` # * <:8 &` ?& & ?& &  & ` & ` @$ "@  >  0 ! > ޖ _ 0`2` X \ H L@ & L& X& \& H/01 12 2t23L3T688:;=@AhABOhP(Q<QRSTlUV VD㿐#\   @ 㿘  &  ?   2m? 4h?`` $ a?' (   W? ,@,@ & ?$,$L$$(  $$$H$D@$$P  ( $0   (┟$$8  D ( $<,@ $   (0  $8  > < 2 >  `@/& ?␑*`  $ $ $ ,\$|$ @$㿘 "(?  "$? " ? $  ?. ,& & &  $   $ $    * q $ $ @@K  2` ( " (" 㿘  `8  `` jx & ` $`   @"& & `" $``$` 㿘 ` 2@? 2 `` >  X?$`` 8>   *& ( |*`?:  *` * @ `@Û $ q&   "  ` "   |2   q`& `2u  `" `>  d?i$`` ` l ```2 |"&  | @Β @ 2L ` "H `.`- "(`` @ ;0@ 0 @֖ `  D <*  2? D <@e*`C` ` |&  `2   2  & ?c  ) ?& `?㿘   2 0.?`" 8 $ $* ( 8`" < $ $* ( <`"  D $* ( `" $* ( $ (&  㿘`` 2` "$` `2@ @@@& @iV@`@$`$@㿘 $ D*` <*  & 42? D <@ٓ*`>  |c*` `& x@  & @ `& @ & X& t& @& d& T& l& `㿘`$`d~`0`t`p!"@ `0`d`p`a`8`, 1 ^  Y T  N  &~ 6'@ /'@ ('@ !'@ '@ '@  '@ "ɴ'@!  ` `h@ ( ?2㿘 $ 4 l d"@ @ ??9?2 $4?~  / 0h h d" T# D" <+`@& h& d& T@ "2@2@ 8+`@@ "2@2@2 #  0 d l@ ܒ@  l@`& l 0 d @ & @ ` P L*  & @ l! `2 4㿘 & p `  d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2 " X d $"@>@8 X ڒ& X X l 8& X XF d h@̒"  X l x" (& l %& X d 0`& d@  @ P L*   <& @ ,*  @  8*`2  @ <* f2  X? & X d  X d& X@ 0& d @ & @ ` P L*  & @ 0  d@  l d & l& d`" l T  0   d" @  d & T `"&  l!_ l!`"  T T  0   d" @ d& T  `?㿘آ `( X d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2  X  h& p& \`+& X x@:( p d $"@>@8! p  & X X l 8& X X`8 p  `2  p d h" ( p& X p(V ` X Q d l \`" @ l? p " & l& p d @& d 0 @@  P `*  L  <  ,& @*  @  8*`2  @ <* f2@  p? & p d  & X& dJ& ` T  0   d" @  d=& T )` ` ) 0 d  @ " d T  0   d" @Ɩ  d& T d l & d& l 2  l9  d  l & `& d& l l!( l!`"%   `   0 d  @O & ` T  0   d" @ d& T  `?x> ބ!P> > "@   ؞   +  # a@(+@ ?` > ޔ@!Ē* > "   >  * $@ +   @**@ ?  *"; > ބ!> " *>  + "?,@  ` ?@(!*@?  $`2? 62> "J  ,   2 7耤 !> "J ,  3  7ꀤ!!> "J ,  3! 7怤!> > "J ,  3! 7> "H@=!> "Ƞ  4`@V 4@  `㿘> "ʀ`Fbbbb b& > > > & Ⱈ"Ą )*t&+&+&+&+$&+(&+06&&@!0t060 H060" 2"" " 㿘.T7H.46.P*` /  ) (`@/`@*  / / / T@.@@  ..  .'@ ..T 㿈`+4@ '`  +R ' 2@ L +T'*` * @2  `<;",@, @* @ `@$22 4!,`   5 $* @@@gV @ & gL@ @& <쀥C- ?,``,``",` `?2 *   2  2 " ",@  * @ `" ?@ g $@@&6`? 2`ߑ,`xؚ    * 2 ` ` ` *` *6 @2 6 㿘 LH"= & ?@& P+T " 2  & * # +@`@`H +T '+4`P b b  *  & % % , 4 + ?&   "@ &  急 H&2`@ :`` `4 H L P*+X &&+X ,`+X?&* $ +`?&* $  ,   4  @` -+`,`2  2`&+Xe  Ϡ `L +X& *% 5㿘?  `   .<c:0jt "-.@7@ .@7@j 6j 4jj6j6j `       ͞㿘 ?      c* @R 1 +`b tbv "@.6 (&6 .@ "&>6@(6&  `v@,v+`b #@t.6 ( &0.@ #&>& 6@(&6궺b #@$.6 ( &0.@ #&>&6@(&6b .@6 .`6` ( &0. '@( 4J꺺b #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@H(Lb #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@&>@& 6(&6      @    * 㿘+; + 7)+(> ޖ"  *v $  * `"?  *` @$ 㿘  ~+  6  `+  3  *   & 2`*  " ;6 & &  ~* @6 &  *  6  `*   3 *@   & 2 *  " ;6 & &  +  6 &   +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &  1)""> ޠ" *v`  * @+ @6   * ` & 2* `$ & ; 6`* @*@  6&㿘  .  6  `. 3  *   & 2`*  " ;6 & &  .  6 &"` * @ &@Ζ 㿘" "   *  ` & 2*  `?& & 6 & @b   ?& 㿘   +@  6  `  *   & 2`*  " ;@6 & &   * @6 &> "Hd⸢ #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 &!" ` @& "" " [ "  +@ 6  `  *   & 2`*  " ;@6 & & "  *@6 &bHd #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 & ` @& " &㿘!" `?  `&@Xz+w+"" `  2`2 (     &@{&  `0p 4  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &> > bH@Ȑb 8b  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &++ ` @)b b   &  @ b  & "6 㿘" "*`2 "` *@ & . @  -2@ " >  & a@ @ *  2 `> > `>`#@ !#@ @*)` #@ >`#@! @* @ 2  | '"2# d>  TaĦ" *)  @@aQ`?`" "2@ 64  bb  `?㿘☺@ > > ޔ@ @P@@+ @ ) / @@ #@$@@@.7@ ``(@ `'`0.@@ #'@@@('@7@> @⸅(`  @"@@$@.7@ ``(@ `'`0.@@ "@'@>'`7@@@('@7@(`+> @"@ "@'@/7@ / `6`(@ `'`0.@@ "'@>'`7@@/@'@7@3  (`@"@ "@$@@@.7@ ``(@ `'`0.@@ "'@>'`7@@@('@7@> ބ+> "@ "@#@+7@ +`6`(@ `'`0.@@ "'@>'`7@@+@'@7@@ 1"d @"@@"d@.7@@ ``(@ `'`0.@@ "@>7@'@ '`d"@(@7@'@d'@     *```` ` *```` 3  *``` `?*  0`* 2 b b ( "2 (" "2 b (   " 02 " ( "2 ( " (""2㿘ڐ" & 6 8*@  & *@  & *@   & 3 *@  &   @ `*@ & 㿐 "? 2& ?& &  ` " @ 㿐 ? ` $ 2`0 @W $  (  $ 㿘 2 1?  (  )& "  `"   "`  ( ː?"  `  >ג  *@  "` ?㿘ǒ 㿘 "? ? `>#*` € ܔ  & &  @   `" &  "> b 2    > "" &  " "   & &  @ ` &  "> c   * @q  $> c( $ `@B`      @``  " "~  @Ҕ `  "@ "@  b? `& &    * "` &"  `O  & &     *` " &" `:  & &     *` " &" `%   & &   " &@   "> ޒc@ &  "" " ? ?`2   " ?"㿘` ?@㿘 F?`2@0@  "@"` 25?     `0 `  ?( "@$$$ "`G $$ "@?㿘 8 " <&? 8  `$*`(  2  ( @ @L @I (& 8& 0& & $& 4   & <㿘   ( @    (  & (& ,& 8& <0 ( $ @ p 0 4@` $ "? ,"` J>#*` €  *``` 4  `&  `/`2  `4 $@&إ4@b@耢 & & $& @&``$  &`&@& 4? && &  &4> &#&`4& $& @&``$  &`&@& 4?  *```?c82   > &#&`& $& @&``$  &`&@& 4Ҕ? ` &&  q ` & $& @&``$  &`&@& 42D  ,   0 ( @ "?" 22 & 4@ 0 4 "@ ,? ,"   0 ( @ "?" 2 & $& @&``$  &`&@& 4u 8Y " %@%&     &  *`` `?, `& 4   ! > &#&`& $& @&``$  &`&@& 41?@ ( ` `(  & & $& @&``$  &`&@& 4? & &4&   2  @>  #Ϫ  *```  *@ *`"  & 2  4    > ݘ#* *`"  &  &   @ ?2 & $ `(*`$  && $& @&``$  &`&@& 4 &&  4   ! @  > ޞ#X @, `y  *`@ ,   *`    $@ * "  & R4    @ `]  *`@ + 4$@  4 @ ! @$@ 4   > & &`& $& @&``$  &`&@& 4E?  ( ? + "@ &  4   ! @    @ג  4 #\&  `   !`''#`@ؠ ?2 & $ `$*`( && $& @&``$  &`&@& 4@䠒 2 @@& $& @&``$  &`&@& 4ߔ?`(*`$ & & & && $& @&``$  &`&@& 4@ @  @f @c 0 4@` $ "? ,"  `I& `&& 4@ 4 0 0 4@& $& @&``$  &`&@& 4 && $& @&``$  &`&@& 4q & $& @&``$  &`&@& 4c?& $& @&``$  &`&@& 4U& $& @&``$  &`&@& 4G& $& @&``$  &`&@& 49& $& @&``$  &`&@& 4+& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘@ (  ,`(`$" `(`$ @㿘 0 4@":? "`5?  ,@" $"  8 <& <W`@&` ,$@& 0 ("& 0〤& $& @&``$@&@&`& 4 2?" 8'H\'L'P'T'X''''''''''''''''*`  " H X "9"     , `" @*   ,``"@8 " *,  @   /`,` @?#  '' "@`  ,  *`#`" H`@ *  '?'p ͮ / '"¸  .aH . @``'+@`  "? " `@*8 `+@`('''  p@s`?X " 'Xp"" //'*` $4@, ""4H+ @'  / /L    `/'LT" * @ `P/P" * '4@)  ?, * ""  ) @)@4 @2@)@? @  %*.? @ F 8/ ` `2?㿐#\#`    ??> ߐ" & @Ғ> ߒb0&?㿐`\> > #\ #`!q ??> ߐ"X/$ -@@> ߒb$ %?,`> > ߐ#\!#` R ??> ߐ"X $ 2 @@> ߒb$ ?@@0 > D>  (#,"D> <   "<)> %> +> '>  -> <"<`"< @ U`<>>Ӑ |`x?h'pH "? 6"  *```"a a *``a"a4  *``a" $#\> > ߒ! ! #`ۚcĔ "? 6" $#\> > ߒ #`! ŚȒ % @`<?$`<%&@c&& 㿘  ? *`$`( ? 㿘 (    * * " " "㿘 0 4 @` $ " ,"` >#*` €)` '& $& @&``$@&@&`& 4   @e  0 4@ ` $ "@ ,": $   $ $ $ @ > ހ`  *`@ > ޒcX+`@   * @  @$@ 4  $ $  @ $  $ $_   $> $"&`& $& @&``$  &`&@& 4? @ > ހ`Y  *`@ > ސ#X+`      $ $@ $ $ $4  @ > ހ`H  *`@ > ޒcX+`@   * @  @$@  4 $  $ A$ @ $ :$ > $"&`& $& @&``$  &`&@& 4H? @ > ހ`  *`@ > ސ#X+`    $ $@ $4  (    ," "@  "$27  ,  0 ( @ "?"2% & 4@ 0 4 "@ ,? ,"  0 (@ "@""& $  ( ,   ( ? $ $2D  ,  0 ( @ ""22 & 4@ʐ 0 4 "@ , ,"  0 ( @ ""2 & $& @&``$  &`&@& 4 (m$& 4@ 4 0 0 4@& $& @&``$  &`&@& 4r $& $& @&``$  &`&@& 4b & $& @&``$  &`&@& 4T?& $& @&``$  &`&@& 4F& $& @&``$  &`&@& 48& $& @&``$  &`&@& 4*& $& @&``$  &`&@& 4& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘`(`$ 㿘 4 0@`  ,"` " `"&`&` 8 <& <R* ,@@ 2)&`  4  (& 4 4`"   " `"&`&` 8 <& <R@&` & 0㿘04@$  "$" ##@""""4 , > ޠX. .`(  ( ( @`x@> ߲#X `!d7`(`!   7 (   (> @@#X `!97 `( & (  (`@!'@@ 7'@/@ `/@ `,& &/@ `(/@ `6`@2 1 (`@ ("`@` (` (`  !/@7`[1 " "$" ##@""""4?` e 1  "$" ##@""""4 㿘?c6  @`f a !E&@`@`@@`@ `@@`@`@@`@ `@@ @`@ @`@@ @` @@ `@@@`@ @ `@@@` @@`@ @`@@#@#񀦠,`㿘> " >  㿘@ 㿐" ^Ҕ  j @,"  $!,!4!,!'!P  `,!> ߔx  (> b0>>>ߐ#ؒa4$ $ $ $!$! $! !Ԓ  7 5 +4!4 T, X, Z$ \ <   !!?(`4!Ԑr4 T<!$ H /f * ' > ȖȀ`$"""b$""ȑH 0  㿘@H/` /Hސ!Hܐ!H 0H o&4"*@g"`""b"""@H 0!Ԁ(_  > Ȁ"  22 㿘!Ԑh (@2! > ޔ 1 ` ؐ 2!  6!԰㿀> "'k  2??2  @ 2!Ԡ> > ߔxp 5 % 2!    4!ԑH /f * ' ː T @4 TH 0 b > h#㿘?2  u 2! ?# @4!ԑH /f  !!(   ! !* ' ! !!G  ` ` $ $ "`!?$!`H 0 T "I$!!Ԁ$2E$!ؑH /f * '   T @- >  `2  !ԑ2  @1   2> ¬  *`  `%>k ( #" (`!$*` T ?4 TH 0$!\F  `T?aԄA` 2`Tn2aԘ1" `T"`TaԄ2a`T" a" `T"`Ta2a`T" a" "a 2a232a 2 a2a"`TaԄ2a`T"a"2a 2 a2a"a2a2 㿘@ H /f4!Ԑ* '!Ԁ( c   H 00f a@-a@(a @P a@D 0Ja1@ Fa2@ a@"? B!Ԁh9 `4@L+0040-#ҒҀ@8( &$`\"# /!Ԁ(@ # 4" 0     /2  h H 0㿘 T aԐ ` hː @ߔ```"`8```$"  `?ܐ"   ?"  `` ?`&`&`   `" `` "`` &``" < "`` H /f4!* '!   !   !!@&&`g  7 2" $ !$  $! ! $!H 0 p @$ @$ p  H 0 x $ x㿘!Ԁ`@?# @6!!!Ԁ  !؀  !p,!!䐆!D̒ 㿘?2   Ұ H /f * '  `]@"D \@"6\ "@o w@"0 b}@Ob~@"B0 ! @" `v@f  [@" 00a @ha!@"f0"\*X2T"d& X6T6dy&    Tc 2T j2TH 0i  "Ԑ![2? " "Ԑ P2?# @K2"  €  4  2$ "6& 3&" `" @ )"'&Ԁ( đH 0" ( H 0 LE 0 H 0  H 0 㿘? 2 ?   Ԑ ` ? @# @4ԑH /f ԑH 00בH 00А* ' Ԑ  "4!> ߐ!# t Ԑ  4 * 2!$` ` $$$`?$`&`Ԁ!`@H 0 #€ _ `@4> ߔ! 3 `"ԑH 0`k `a ``> ? c` @ 8 ``rH /f * ' T`* 4` ` "#@`8@ `<"`<`<`8"`8> `$#``(`$`0`,`[R`4`$`0 4`@> "zH 0  ` "` ` J l $l㿐? 2 C  % ` Ԁ(\@ 0@  (H /f * ' > "  > 4 `` $ 2` $ 4 $$ $ $ H 0 2 7P 7 ܀('  ڐ $  E` @>  ؔ 8 $  r%$ *` & H /f * ' bI   4   `5 $ $$ 4 H 0  쀦  ` ƒ   "ll $l" "`< "Ԁ( Ih  v$h`"` ?" `?"`0 > Ģ!  > "H k /0XH /f * ' `` @&` $`H 0x $xL` 7 73 7" ``$@"``> #ਠ `,  $`$`"਒  > !> #*` K hK h $h|` $|H 0㿘?2   5  H /f  `A   €  * ' `A!4  ! 2!$ =!䐎`2H 0㿘?2  Ӑ 1 H /f* 'H 0 V`? ? > ސ l&`8> ސ |&`8&` " >  㿘#bP V  e @TbP d "/ !$"$">4!4!4!4!4!a "x$"HbL$ (bH <#> ’#"? > $" > b0> 8>>`%ܘ њ $ $ \$ $ , X$!, Z$ Ė H /f * ' `̔`̀`$!Đ!"a$!$`̑H 0  㿘@6@  bH` "` "@  t"`@X6 bH 2"L@ `"  "` "@X @ 2H /f * ' aĀ`a"aaa"H 0 W  p> > @ #'H /f * '  aU@@aT@ !G@! a? aS@ aP@a@@ aE@(   !@"D`T @  a<@Na=@ΰ  aB@6 aA@  aH@Ű  0S@P@ !N@ "] !M@   A@ܐF@"x 0 aO@i 0!C@aD@ i 0 a>@ aB@ _  bϒ Y "S `@ 2M "L  t2 2@  `X 7 `T ,В @`T' `4`T7` '   " @`T 4`T7`        2   UT    `X  ߒ  @    7$ x, `$ $ t$ d d$ h$ l l$ pH`$H" $HH$ $`@ bL ܐH  t (@c  2 t " @ t` "` "@ t@ f @ d 2 t0g@( b h " `@  2 "L    t2    Tؔ  ֐@4 $ t$ d d$ h$ l l$ pbL $ "  $ m$ aߒ i"L  t (@  2`"  "` "@V_  2 t H E   "@ `@2< H "8  t2 "1  x& \.$ `.% &( t Q%.&a ' " `@2 H ? t2 ? #@ "$ x `X 2 $ x ao  " `@2 H   t2  !T@2(%, ` "ڰ $ @ Ӱ aD Ԑ @ -Ȱ a9 ɐ " `@ 2 !"@    a @ -"& a @z$  a 2 '> @#@4 $ {Hfu r& "`T@U`T j @df  `֒ f# "Z `@ F2T H "P  t2 "I  ? 8C ! ` =`@ ה =! 2@ ͔ -` / "# `@  H  t2  @ ސ @ `y   @H 0 > #㿘 @H  t2`"  "` "@ @ @ Tߒ & @ 2 t㿘 @"H`<`t25@`x 4@ 0 ` ` `  ` `   `\   @  @ 0`2`t`> ""H '   `"L ` ` ,i * ""H#*  @1 tВ`(@,  x' \ ,/ `/ ' t `Q`/C$@ I,`,?&`  @ ,` +ג (,bL* " $*  @ tВ`(@  xa' \ ,/ `/ ' t `Q`/B@ ,`,?&`  ,@ ,` +Ւ (,* "* &`b >  #P> "'`  `  `@ 2 bH``t 2@`2`d `l `   ` `2  G- "* @d >` =`( @|`t`(@w  / / / / / / / / / / / / / //  "`$<`$@BW > T- ` >?&`   `l G- "* @ >` ==`( @3`t`(@.  / / / / / / / / / / / / / //  "`$  - ` >?&`   - "* &`  > 3#㿘 T @ @6 T@" > !Ġ"E |㿘 T @ }#" @^ T 6 T㿘`   ` @H /f4T* 'T @ @e   5   @ H 00`  ސH 00 @2Hb`t`T @X@ x`` \ 2P`2a` # "Ha 2aa@& a $at`7$t .   P   沔 H  2攐t $t @@ 2@"@    ` @`$ @ o2t`lH 00 @`T @ @ TH 00 QH 0 㿘>  ̀ *0@)H /f * '  ` ` $ $ "`!?$!H 0 `!Ā 㿈 T @ < `~7 h & h |`"H@& |  t2  x " ` \ €  `  Ô  x  2 x?#@     " x @  x "` \ ` #   @"2`0`"&  T z @   `  ` ^k" x @ d ` ` ` ^\ x @ S d@Ŕ K @ n` # 2 2T  & H /f * ' @H 00K @"H  t2  x  l \    l@| 00) @E "`\? @0H /f * ' @ H 0㿘 @   `2?> B#А# @6 @T @H  t2 @<  # > ޒ`@  2  x@d "  x "  \   }沔 h  u ``' 8# `  $" 4   ܐ"   "    $ $  ٔ  C     $ : @m H /f * ' @& $ fH 00 2" && &H 0> # " 7 > !> # *` Aɒ  XA  X H  t X`2   6  t& E t x   \ ـ ׀ H "S  t `X 2JaĒ@.  "x t L ' @j "ax ` @ј d@4 " t&  X`  6  t 0aĒ`@    t L   @9  "Ȑ  2 t ``' 8# `  $" 4   ܐ"   "    & &    "O      & "F  ?x H /f * ' @& & qH 0(  2" && &H 0> # " A > !> # *` @Ӓ  @  㿘> #d` > ߒc@m "Ht`P`P "x  \ 2x2`T # "p`T @"la aa@ a $a t`[& t@ 2Ul@C "M .   㝖   沔 㕖  2 t 0& t @@ 2@"@    ` @`$   @ۖ "`\?  @z@2|t⦐㿘"L`z沔 G  r`"A``'8# `$" 4  ܐ"   "    &&  ⶔ >  &5>J "L * t`T @""a aa@ a &a t`& t ۖ   t & t@% 2 t%㿘@,`"L (" "@y  L>  s =  , $ , , ,`bL $bL" L"bL$ " `Y&"   @ɔ   " / '  "/ D  " "@<  L  6 =” , $ , ,  $$  "!' 2ϸ" "@  K   = , $ , ,  $" '$ "  &"  㿘@* "L "  @i    4    `' `ṕ* `+ ( `* @ `" 2 "(""2 "  2 "(""2"  2  "( ""2"  #㿘" "@*@?" "@# "L@"  "$ "@"   M &" " "@瀢`㿘H o*@ a@  H 0㿘 *`"L`$  2 `? * * "*  $ ""  &" L ݖcב*`" > !Ġ"?@ v㿘 *`"L``2 2 $ ""  &" L c*` 㿘 * "L "  @  2` "` "" &" Lk   㿘 *`"L`2" " $ ""  &" L@ cݑ*`h> `"  `?' L  "-Ȣ2"` ''(<%  ؐ (<   <  /` ( @:/鰒 -``?&``( ( ڪ`Ц-`* &` > w 㿐` $?  (":  h 5@/!"݀@+%8, ` '  ᾖ?c*   #2  2 (   5(!"݀   㿘& (  ` @Ք  2  ` @ɔ  2 2  @  "   2   6  㿘  I  `"(  ;q `( ;m ` `!, N`.`, 4_`.4 4    , $ p" & p  , $ h"& h 㿘 d " l d d & d& h4f K1  d 2 d l  l l & l& p4S K  l 2 l H> "\'``נ ``) ."d`" V `` ?ΐ  l @  d//ђ  ߖ` 2 3d+' l0,d`" 1 ` `?ΐ   l @s  d//ђ  ຖؐ 2 3d ld ଖ  d ࣖ'Đ ϔH /` * ! @Р Z $ V  R  ̀@2? > :< '   Ȗ B 8 ̀@ # ܐ ' $ " #ȒtK @  Ȗ B Ȁ 8 ̀@ # Ԑ@' $$" #ݐȒt0 p  dH 0g H 0_ d#\ @~ S`` d > c@d  > c@d6 d*d9  π`, > "Ā`'`@$d! ` > ##!:`  d!   #\;`d@9  d@ɋ ' " > uې 㿀  h/'T!"݀@*e`    ߭?c* "2T #2T 2T( xT T5 T0 h!"݀@T` T` ZT`  n   'T> Ēa4`   P"` T2` 2`> Ēa4`X <"`X < > Ēa4` 3"`  H  'T> Ēa4`  *"` T@* `7 > Ēa4` "` @T T$  T 2"@ "  "ɐ  T@T #\#d#`   T"`T TT`• `   'TT` T`7 T@漣I7 T` ' ߒ (  'T>  `B :T @ `> `B : "T!`B:` T@ ( #\#d#`  TԖ T  @T``$T8  T`$"  ?ܐ"  TT?"  T`?"`T  " T  'TT` T` T` "`T F  8{T``$T8  T`$"  ?ܐ"  T ?"  TT`?"`T  "  ܫ 'TT` T` T` "`T   8< TT  ? 㿀  !" ` *`\? *H /f * ' @H 00 *2 (#%   ?c* " #쀦 耦(䀦 q l  ޹   @  `\ #\#`#d@ 0`\@l  `&@``'8# `$" 4  ܐ"   "    &&   I  &@7t ``'8# `$"   ܐ"   "    &&  ۢ    &2) 774 H /f * ' @*  H 0 H 02W` > Ēa4`D "`D 㿘a  a ` aa@&&  7` 2" &`a&` &a "  pa &a" p t $ t `$ $ p`&`` &``T$ `@ 㿐沔 c  `ڸ0ːd @G\   $ $   ,@"@&& 4` @3"@4`< "@& & *  @$@L4 4  , 4 @4 6s 6n 6j  @``'8# `$" 4  ܐ"   "    &&  ږ T  &K6* ``'8# `$"   ܐ"   "    &&  X   & 5  ٖ 0㿘`  +.`^.`N!А>`0!&`@!`X>`8@ 6`L "!6`D`&!6`D!6`F!6`H!`]6`J.`O!.`P!`D  `0.`]@.`^` @ XH o4'*@ g' t T @2 !H 0 0̀ !!@ H 0 0H /f * ' > "  > 6``$ 2` &6&&&& H 0  4H 0 0& && /Ē B?//*` ` '@ ` '/ƀ/ł`@ 2`* 2`* 2`* 2 @2 ```````777/'7//////777//////5 !> ސ 5  &75 `4 &! !   !!@&&  7 2" ' !'  '! `! '!  T$ @H 0 !!؀ !!Ԅ`? `8B 2` 8; `86 2` 8/ `** (`&   `  8 2! `8 !؀ 2  ! " `Z`?㿘>``$&`>`6`Z@`2!`2!`2! ` *!㿘"H  x  @ "  \ k 2 x`!؀  !``X`Z`? 㿐! t`T`@H /f * ' > "  > 6 `` $ 2` & 6 && & & H 0 b  & & aĒ & 3 > ސ 3  4  / B//?*'  /'/ `3ߔ H /f4a* 'a   a ` aa@&& ΐ  7` 2" $`a$` $a `a $a `T$`@H 0㿘@@z㿘"H d  x \M 2X \ "T !؀@ @ 2L! @(G`"C` 8? `  @7 872  ` @80  @``@ *&8%`  8 ` @ 82 Z `@8 Z`Z@* 8  X`X@: 2 x`&!!&!>!`>!`` &!㿘"H = x 5ג . !Ѐ@) !Ԁ@$! @*8  !؀   !܀@ 82 X! @8  X Z@8@ 2 x!:`!"`!`X:`2`Z㿘"H ! x "!, ^ , ] " , ^@/ $@, ]@ 2 x㿘`\ @$ `(@ 㿘`\ ``?  `_ "`t@`t% @ @`(* \㿘  .!"@   !  E"@ܒ  .!㿘"@.!㿘 *`]'D"H'P ' x `t 'x "tP `ڀ   "@ŐP  'P 2+  B2P B2P 2P* @2P 2P `  P/D@PP & 'P 1 &Р ԅ,`' 'd?ә,d'?`?'|բ 'l'?h'T'\?4\d?X4`+,ܠ ޕ-`|-?xT?P \* X + x,`d4 @* |'t*`T3P 2`* 4@t+@| \   +. +ׄ ?  ذ  τΆ @ ??'77777 /4D//@ P j 㿘`\ : -ڔr 2! "!@!! " !@""@ !@ɒА  0 ?㿘`\  Ӓ 㿘!@n 㿘:[!0  !!6!!6!d6!@U"!@L 㿘`\  Q `(@? 0I @  `_ @"H`" `x"@`!؀2 @`!܀2@ `2`x 㿘v"@  *!*!㿘 `^ 㿘"H !  x " t X 2 ` Q*  4 X  Ē!@a  6 t 2 x2 !@a0]!( !ŕ+` !Ƙ !ǥ, !Ȓ  ,   (    !Ʉ ! !! ">!6!6!6!>!&!&!.!@.!@""D  >a"0i"D 2"H> !i"0"H ! x @G@K 2 x<@w 㿘"H ""D |@o @m $@k (  "D  i"0@^"@\"@Z!㿘\ .`]@.`^@K`$@I`(@G` 㿘㿘> `$.`]@/.`^@-`(`tL   !!6!!6!$6!@"J!@  㿘ؐ"H  x P 2<  2 x>! `!!6!!6!6!@"!@ڒ 㿘) 26`Z6`X!`@!`@ .`Z2  v}㿘&`u * _* _h> "`t'T ! '0 a6Ȁ 2 `\  " `\`\ "O"  P "`\ H" > k  㿘H /f * ' "H! " " x  2 x!@] "!ߐ!@U "!8!@M ""H8"H ""H x " !@= $ ǒ 2 x"H " T x "!@) ( Ւ!@!  2 x T @> !hv"0H 0 22 22 㿘 .` !* @ 6   㿘 ? @Q  aR@"E aP@0aQ@70CaS@,=@<<@0!P@ "!8 !RU@/T@ -* @ " ! !S@0!6!!2 . 6!  * 6! * 6! *  6! 㿘> ’ Ԑ V > € "`> l @> se ȁ㿘!  X $!$ (> "0>!>"p>ua$ $ $ $!$!q~ڐ  , Z, X 㿘@~qm=̒  㿘&!㿀 TԐ$6 T!4 ) ! 2 !$ " T  & & $ !?&! " T`T A Aa$a t`ѯ& t!4 € s:  < "`iɒ`  $  S4   o !77ޕ* @ 7   ` `' 8# `  $"    ܐ"   "    $ $  Ѧ  ?     $ 6 U  ` $` b"a` $`a a ` aa@&$ (  7` 2" $`a$` $a `"  pa $a" p t ?& t & p`T d@`@29!4`@4!4 ;6 T㿘`  `В  2` l  G$ l`> > Ԙ oА * @ `!Ԕ @  !Ԁ2!!ހ2!耤 2 T%  A A"`Ȑ &``6 ` ``?&` &`&` <  i  h`$ h{t 㿘`X "!y + "&!t ` "`\`\ & \>  & \ ` (j`(`T?  @6 T`X. X`d& d` "`P & `P> @*  P *`  **  `  ,_ !Đ ,Y 6!ޑH /f * ' > ‘. Ե2 > В *` &! !"a А* @"@&!` >TO &!`$> TH&!@LH 0 㿘!Ԁ ;H /f * ' !耢`"!!"a!!"@ T>!!`T8 $H 0@> "@% P& \&!ԕ*    * @|*!@y  㿘! [ [@. [s;㿘 T!! !x  ! !  !x ! ?$! x> ">  @9c'@X @"! @"%! 1@Ԑ2@ٰ 0a!@%! @%Ꮐ@ a:@ua@  "Ű `T 4`T ` @)+b !Ԁ`" ` `\?@4 `-$ $`\ F )  O؀  H /f * ' `T`"`Tr6`T ?4`TH 0prƐ 8 f u b`T`@:4`T[ؐ@ !Ԁ4>  (,!ސ FO F)  >O؀ :r 2  8/ -4!ؒ @p!Ԁ``(@ !7)  !Ԁ @ !Ԁ @e  > f 㿈!Ԑ|a 4L! 8є  `A {!$! $ @   @  2`*n!䀢 $" $%! a1 2 `""`"@:J |㿈Ԧ  {` @̀`@l  2``@e  2``, 䀤  2  |X 4  a2 `"  "` "@9 0{ǒ㾀> !Ԩ b'`('`,$`0$!`4 $ '   )`2`"  "` "@9ђ !䀤 2 " > e̐ R` ` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @:  2  @>       2 `  @ `>   8@ @ @   @ ` @  㿘@V``  ` `  "``V` 6` ` `     JJ@   ` e` 20_: "  :  ,@8 ` V`4 `E ?``2` `@ 2@  "` T4& + @8          2  T    2 @2`  ` 8:`( 0 " ? 2"( * 㿘@`     JJ@ *J 5&& "@ *:  ` ` @ ``V`8`     $ $ &` &   @ 2& & &  㿐> ¦ @ " @>   , )> > cؔ#А (`#Ф@($#->  @ '> ހ #L? "?#Т$@4 쀤6$n , 6#В"@@}#$*@!#Ѐ` #Д@ 2 T`R  06  I @}j`0 0#В'˔ؖC` > `~e 7 0-   "  $L  :  `> ސ *`J:`@ 2 +  + @8`6   .  @ 2  :  @ ` *  㿘> `܀  "`ܐ  5  > `~  @|  6 .  " & & & $㿐  `  `   2  8`W 4,: @ "  @2   %` @"@׀``"T ^  w   2`$  ` , `$ $`2$$  $ $`  $ " ? . & 6` $ 4  ` ,  @ ``@8 `T 6 2*:  "T& 2 : &2` *V: @ "$@V &$@&`P-T`:   0J  & E$ T`@21,V: @&!4* "  ` > a} Ӑ Ð 2<`V@&$ː&㿘   @  \ 4  @@}I" 2 `ݒ       2`"T O  >  $`aH|  > aH| 8  ? 2" `VV 8 4,  V 2 >  & 2> "@""܀2  >  |[ap    ` H2 & 2& &  ` ```"> `2``" > "` 2" a|%  v& & & &  & & `2"`"`" _"`" Z&   `2"`"`&3V  @ 2$"@ >   & ? " " `2# ܀> > aИ{Đ " & &  &  &  &  & " "  `2"`"` # ` . .#㿘V  6   `2  "   V ` V  6    @   2  "  㿘  x   2  " &@㿘@zK x> cԔ ,  \ * " " @8*` 2`& \`!> # `># ` ># `># `>#># #  T`TD&& & & & & ( 㿘>  Ѐ !> –(@4$ 2( `*`> a{ 0)  2 #>  $c> z"( *@y@  > c>   "؀ "Д *  **>   > z"0 t "  2 㿘  2 㿘 `  0@ @ @y  Ր 2 0  㿘 `  "\ ` 2X ` ` @2Q @{! 2L ` *(` @< "@$@{ 20  @ J   0` @ `0`0 @@zݐ  m @ 㿘`  `<  `4 = @E  8&S 3Y> cܒ@z@     @          @& 8 $ 8㿘٢> "cܒ`"  " t㿘  >  7>  ݓ "$   `4 4 > ``䀢 $`" "`$  㿘  э"``"  "` "@3 㿘  `llllHdHll>  㿀>  'T'X'P'H'L H  @@2@ `" `@28  "  @y 2.  @y 2$沔 k  L Ƹ  ఀ    2 L֖ ƛ0 ːఀ  0Ǝ 㿘 `  k -    \ -J`U.`>! €  M I "F 96C "> 9A0 A8 1 8$ + 9 `€"  $ #ОB   2   2   9"& > xn"@> L㿘>  Ѐ  "  $* €  2 㿐> > "hbP#\ l  oI h> ݐ 㿘` `<  `4  @ &`` 2   P >  *` 'H / * '  `3 `€ .> +a`"' 4!" 8̒     @9 ' 8 $ 8  4"  ` 8 $ 8> ’a`  "` ` @w  @'@ ڔ H 0㿘`  `<  `4  @ &P >  *` 'H / * !  `F `€ "A  2= `5' 4!1    @˚ "' 8 /$ 8 " 4"( @v @ ' ' 0' < "  4 ' @' 4 @ j 0 8 $ 8  > ’a`  "` `   @v~ @'@ M H 0㿘 2 8> w'"X?/& 8 4 +  > > w"``耢? "`> "px0@ 0 @Ő @`` ?"` @ h 0 > "hpĒ㿘 2 > v" ?0 0& P > #d` > b@ f  3n' @'  0 @2 @w 2  @@ f$ 2 A@`` "`4  `4 / ! h@uВ @'''''' @4``4> !> 4a "4  @ A  `'@8> a "a" $@u @''''Ԓ@ a X'D@u @DD` '` '`0'`4@' @ F  D`8  "`8D㿘 4@@ `ѐ 㿘`> 4!2 (> v "2>> v"b -㿘` `  ?  e eVe e 2/ "   8 4?` & 8 `  2 @  @ " `   e "X@t @''?@V㿘 8   `" 4 ` 2  4eb " 4` & 8 4 2  4  " 4d& 4 4 2& 4    "  "   8`" e& 4`    0 0 d& 4 4`" 3 8 ` & 8㿘H /` * ! `> `* @  E /`0 2&` "   "}`407a04`` ".   ` ""  ``   4!  "  \> t#ѐ $\  8 ?$ 8$\``"4`8?"`8$`4@ ? $4 > `耦 "`&8 ې $80"հ  "Ѱ  4a2 @˰  v@@&`0 0&` D`&`  &`0 2`4  `4> ®"hlޒ  7@s l`0 $ 4$ d`@` hn` 7`  `@0`+  `0 `  " `,[ \FD|H 4`, " @ 4 h  $ $ @ $ <L$ LP$ PT$ TX$ X$ `8 "8 `   @`4@" `8 ` `8 ?$`82  ?$  4@@"  \ ` " \ \ "  - hmޒ " 4& 8 $ 8 4!` i`H 0㿘@ ?     0 "  ?  8  (   +  2 & 6  & \ @& 0_Y-L  \ `8 ?"`8& \ 4   & \ L 2   P" `P8& P 㿘@.@ @`.@ `     .@`@ *@ @r"P ' `0   0  2} 7 Ē " 8 @?@$ 8d 3b AD L$ @@rq @ ' '''Ē'Ҕ```   @s 8 ` $ 8`24`21 "- 8 @?!$ 8> t# @`   @` ?"` $ @ $ <   &   @7㿐#> a " > > > > #@cPr#> c!#\   iŘ > " !> #> V/c> !V0# $a㿘> !`  *   @qݒ && &  & > 쀢`&  "`"& "㿘4 `"  "`   "@` "`&  `"@ "  € >       > !l,  "> ?& s#  2  ` "`  " 㿘% d`"  "`   "@`"  "` "`  "@ ` "> ?"`s#> ’k! d 2 㿘> #> c#>  d -& T 2&  `"  "`   "@`"  "` "`  "@ ` "> ?"`sy kaa 2 aj  7@q $ $ $ $  d $  d "`  d& d$ $ $  "@&  `  "`㿘> #H /`4> * !>  쀤`A 2``"  "`   "@` "`$`  "@ "  € >      ך > !kR` "> ?$`s  8` " ` @ & ``2`H 0> !T㿘N 0 >   @qE  ": ,  , (,``* `(2 @"@,02`#P@ 0 )  ! @pj 0 @u  ,4 (`` $ ,`$$ `" $` (  $ ,$ $  ""  (>  * 0(22( 㿘. 6  >   (,? ",`"`""@ *v 0`2(;<<8<8A A A <8㿘`    ( & @p `    > c4 ?"c4> ’4`?"`4`?"`H /``* !`  > #쀢`   `,  )  * H 00"  > c4  "c4> ’4` "`> ސ!$ 4`"  @6 H 0> "'L'P'T'X''H  '|       ’  2 # 7  2 > p, ``K(' @ 'º  '  ' 7  > ' +#`4&@oF @ 'L@`' ` 8  "  8   [   @ * 7@p` "y 7 '  4ђ "l ?`f> #H*` €  h| X|SL @$|`8?"`8|"D|`< PD6 N| >|8 I&8> `* @  - /  "&  ` 2"   "8  "8 " 8 &8` `? `?"  "    ]0瀦0 '0''D'h Ȑ@n " "/5h @s ''' 0"<`"` '@'`T "'@ '`P6 @Ȗ @  &  ( @ 4L&&@$& T     E "^ " ``    "_ڐ -&@ ^4 2   4 " "@ " @  @` Ր?"` &@  ' &<> "  4*@ @&4 $@L< P6@ "    2&D  h| 6hdIL * &L $ &L -`"& @&"`'` @ > #<`4 `' 1 25   > 2!&   ܐ "@['   > > > ސa$ϖ  5  > S p  `"` "㿘@m: (&@ &` &`  &`$㿘@m+ , :  *" ?  @  *㿘 T  L    L$ > m   .- H /f * ' > #eؒ & $H 0 $ (  & 6 & 0& (& ,& <& 8    "0  & & & @l`  ,`-@@ &@ ?   '`` ,`  ,4, 㿘 &@    L  T L2 `,` @*@&@ ?    ʔ`` ,`)%`$  &   "&  $ߔ  &&  & ,,4㿘> #<`` @ " " @ " > ސa$2  > ސa$2 > > ސ a$X> #<`@l @   D` P X4 V T U$ > ޘ!$$ > > ސ ^3 X> #< ` `d > ު!$ @k֒ @  `  `    @' `'`''ؠ <  P 2 `$"`"" ` `"'` '0''   P24" "" 2 5`> > 5`> > ޒa$``X> #<`@kp @_   ` P (4 @p > ޘ!$4 > > ސ 3 X@    4`@I @kG @ <  0' ' D''  @''T`'ؒ  ` "$` " ` 4 4 L$  $$  <`P4 $ $ $ $ 3` "`&`&`X@j @>  "p ``" P@2d `_ @'̒ U``M'` "J`` 4F`PX4 TT D$ 4 $ ` 2@0`@ `2-`'` '`'ؔ %```"`` 4`` `P2 `"`$""`` "`&```΀ '''2` x  f `a  @jy '   ''''H /`4ؐ* !؀ %   0> ¦  1>``!.`  `@2` ("< `0@H 0 $ 䀦@ '"  &  *` * " @hҒ &TTTTTTTTTTTTUTxTTU؝㿘b@j ( .t-* "?  .L$,   6 &. . 㿘  (b @i @i/@/h@i/@`.`"* * ? @* "?  "* * $,   6 &. . 㿀> "'@?`@    ',@   @ @ &` `@2``@2  ` *  @ @ "/ @ &` `@@ ``@ @ ` *  @  @ 2&`& 2 ,2@&#$@" 2 @`` @ ,``@``@ 2 ܐ  ?*`@jؒ` Ґ 2   ?* @j̒ Ɛ "  * 2`* 2  2`, , , ,  @ " * 2  2 , , , , ` @?#,2  4, ,,  , `  ?#x*2  2, ,,  , ``!>#(-` €`` ^@\`2`` "2 ` ` "2` `` "* 2  2, ,,  , ` 2` `$ `@"  `.$ `@.@ `@ ,$ @.@  4 "@& & , , ۔     & `Ҕ ` p.` `." > N 㿈  #\@  @` &  &@   $㿘\p"3   ? # @7 / *" *  * ./h ( ` 2 * …`g4`   ' '@$ ' `@   "  $? ' $ ? c 7 /  `*`" *  * /h ` .*@@ 3     + `   `0` ` "@    # W# `  `@"@ P#   +     * @3  3   + ```2    *  @ 3   ` 3  ```2    *   @#    # `` `2    *   @#    # ` "` `2 `   * ` @ 4`    ` 4`   4` &@ ``" 4` 4` @@`?# @3`@ @3` 8 4`'@` $ ? ` ' 7 㿘!> #@@g!Ġ#@ < 1> />->+>)> ܠ (  i"0&c  $`\$`$`$`,`X$a,`ZT$@S N Ġ!Āߢaā㿘H /f * ' !  ` &!` & & "`!?&!H 0 `5 0ہ㿘/ `&"`P @" T8 @"  T @ @2   T"@2 T2 T 㿘> "!> VL!㿘! )  L @f! >  i (?`@ >><, %Ą /, X, Z$ \$ $ ,!4 T$, Y$ x$ l$ t$ h$ p$!S$!R < N  H /f * ' > `$!Đ!"a$!"H 0  㿘H /f * ' !Ā`!"a!!"H 0 T u  㿈 T `'D  Ԁ ؀ u 2   D@g  O     [  D N iD < " L 7 /> !`D `   D`` * @   D`@e  * 7'& Ԁ@    7 '& 7@7``$" :_` H /f * ' > "^|  > `6 `  $ 2` & 6 && & & H 0 2 `D`" 7?& `& `> & ` & `&` @ 6` cȖ  *@ @ & & `@& ` * &`` `*`" &`  &&``@&` &`  *`o6fD> !`2 D`" D` O  TD`( !"`i" /```'`8# ```$"   `ܐ"   "  `  &`&`   `` ``  &``("T `2 D 7a K"aD`"C  / ` @d ,2 2 . .  . `7!ԗ2 . 2 2 . . . @* 2`. 2`2`&. . . > ". . `* 2 2 . . Dpܒ`"pD  ` @ @?  D`t "`t㿀> >  #'H /f * '  af@ae@a@"B a @a@ a1@ a2@BaI@° 00!g@ 8!ja@"+ai@9 0 !J@ 0΀@ "H a8!~!h@xİ @0!K@"a @ /,a 7,a"?$ $\`\&" /   / ) `/,a`7" T +T 4T?Đ*@4T6V #$aܐ )~ z@$aԀ@2a$aaԀ ma؀ ia܀``8 ߐ?"`8$a@mT Y4T@c   // aԐ@c   //aؐ'  0A )@ < 28 / 24 / 20  2, $a$aؐ )% !$a$aԀ " 1a؀  1@cT   //a'>> a'> > H 0b > I 㿘!ܐ@c. !ؒ  $ , ,  T#!ؐ `   $ !!܀``<2  T`8 ?"`8 $읐 $!$ 2`  ` ? ( ? 228 * 2 㿘> > "aR!㿘"( r  ^ @b̒"(>  $aԀ`$aؒ`  2 $a @  a 0B  a> > \㌐$b|   | |1  > > >>u?aHL㘘!`,`X$`$`$`$`4`T$`L$@@u> b0$`$aa $a`(> e P]ϐ> !"!$b 㿘@LH /f  "H 000* ' @F " ?|!]ːPA> a" "a2"" H 0 㿘 P> b@*  @  ` * *! ~ 㿘"?$   T   (? > dM ? p> "' T 9H /f * '  TА ?!  6 T! T!6 T H 0  "    2 @ E  2 > H!㿘!܀ (`Tz $2w  @b "`Xo  j +Xǒ  2e ( +  \  X @a (> ! "`X@2 "``@K$` " @`X `>` ,`.`X$`&`>a<$` &`&`D`a$@$`  " 2 !` $`&!"!P`"$`$&"!ܐ &!,&  a1@N` > В 3" $`㿘"` ` "`$@`$`2` 㿐 $`@ a2@ T`" Rs X/ , X $  $ D$  3  $$ $ $$2$$ $"$? "$`2@@`ϒ  !Ē .  $`$` Ò`$`2  $ 㿘 X  D` ` ``@㿘 H /4 X* ' X /  D+`'0 !@#N " R"$    @+   @LH 0H 02  㿘 D 3 > " "!   $ 2   "    $ 22 㿘 `(@e0  `(@e+` &`  &`$ [`&`$h> "'H o&*@gWr Ȑ@_ ( a@"a>  a@" a @Ґa@  4a2@a1@ذ  4a@" 05@ Ԓ  a@}a@ ܀ 40 !6@ "Ē!@" ΰ @"RNɰ &&  &`$` ( r@ ( 쀦 40c%; 2  8 +؀  @  4>  Р > @@ 2 T ((a`$`@ `{ + "x QZ "s $   4$f 4> c$ ^ N Z Q< U {Q> c$ߒ J N F Q( A $  ϐ 5 1 T 5 T@ ` ) 4@$ 4%4! % \ 4@4@ux` 4`$` 4 4  T " ? @5 T H 0 > E!@㿈Zݒ 4<! M  2`Zs!$ $ @`/   @`(  2`" $%"  a1@̔ @ 0 [ 㿈  Z<` 2J!̀`@_  2``@_  2``"6 " 2! ) Z 4 "a2@ " "  T > !P` (" ! &" 2!"  㾀> " "' ! `y  a2@W" ! &" 2!"Y " 2  > DT!㾀> "  ' (I ` +> ``@  "aT a((`a`2 ` > D!㿘  '>  (   " $T ((_ $ 2㿘!4 * ! 2!!$    & & $ !?&! ' < "aDa؀ b€ €  Mh 2 t p & p & t㿘؀  @  t & t㿘 `X  $ +`D`"  `2       < C  h  $ h  l $ l㿘 T`> > !_Ra   "`"`T "`㿘  ` @㿘 ` @ [`2  [`$`" "@ [`"" ["`  [@ [`2`$`2@ "  . [N">!>!>!>!$bT""""""""""$""  ""  " 㿘`2 @ 2@> !  !  !!@&&`  7 2" $ !$  $! ! $! T$2` @`  $ `b"`$  $ `$q$ " >!>!>!✒c""""""""$""   㿘W! 29 !  !  !!@&&`  7 2" $ !$  $! ! $! T$2` @`  $ `b   $ 㿘!@"& [`2  2  2 2& 㿘H /` * ! > !> ̒@> ! `!> ` T@#8@ `2`H 0㿘> `0 `H>  `" "!> #>!?גc> !?ؐ#`4 `< `X `\!@8&`P0Հ "` 0"@ 02 `4` &`4`4a&> ` @`<> `X`0,`< P4`<&`T X `L `P!@ `\ &`P@" ` ``< @  > 8`<a` `X,`<`P}4  ͔   &`H> b \5 0p O > > !`#!"@[ $``4$&`4> a a $@a " "a $`> !, O `<   G  2 <`  H  2 < : &`T`< ,` !L > !`>  &`<`@ &` ?"`   $ &`@> a?"a@``"``@"&`H`4 ;&`4` "+ 㿀)> " 'p  5 `$ $ @Z$> ܐ"H (4  4`(  4 4 , ,  ` ` `    // " > @Ӑ"@㿘!> ܐ"H= "  ^// /   / / x/ `"`H @ 2  `2 `T> bP[O ` `0> # ( T  2  T    0I T 2F  "$ $ `T 2 `T> \b"x> c&`T`T"1 `4 ?&`4 `> 㜀"& > &`T  @ $ `@`< X `!Ė!8  > !`4`T` &`T&`4$  㿘> a؀ Y H /f * ' a؀ a $a"`"`?"`H 0 >  2 > Zn"    &a "  a  *   @  ݒ a h@@  a a؀ h>  " '  '̀ D ԸД ˔ > !, 0 H@2' < `X  T A A `@ٖ      @" <  @ " < Ԁ     ,  H @   H2 <  @2 <    `X  `  `22 Ҁ`"aĐ H@Z    > ܒbH@Z   А@E'> bY 0Ѐ'@6ܠT> bYِ 'Ԕ @`? ``0 : `@ZE ``4@А@'ܠS> c `(Y 0n`< @'`< (Sΐ> 9c`@'ܠSĐ>  cY`( /$`T`<@", `@" `X`@ "$  `X 2 `X`L"  `X 2`L А@'`< (S> cД`(Y] 0"  `,  `T > > А $`T`4 ?$`4 `$`` $ Nb    @h  `< X`  X`m `0   fa Ԓ]  (55T P (4   //` b > >9 㿘 `2`8> X  $``0" `  2`*& `4 ?"`4 `   Ú 㿐>  * @ .&6དྷ 2 8'  4? dd& 8 0 `" H`@'>  X`( 8 4   4@     0  -㿘`H !`>"`!&`&`㿘      *   h@@0㿘   /  > 0) '0%"` > "  #> a > ÒĐ @X  > Òa  > Ð a  $a> 7z!㿀)> " '͐  4 $ $ @V$> ܒ"H`   54`  4(  !Ė 4 4 , , N J F    // " > =1 X㿘> !` . > > ޔ "b""'> %> #> Ǡ??aaĐ2 : h5 #"?a %"> Ò! > Ð!   3㿐ƒ㿘 2> X p0> X x > %> #> X? X` 4> X 㿘 > X > X  > X  >  $  X 㿘 >    X 㿘> X}! X>  T!( 4Xv 8> Xs!X > Xn!` > Xi!h 0 <> Xc!p <`"> > !X[`( @XW! @> XS! @ > XM! D \>  HXF! H㿘>  > X<!Ȁ >'bth 0> X1! \\dd\ > >  $ 㿘>    2  &    2  8l      """ $ &  ?㿘>   "  2  K 8    """ $   㿘>     2   " 8㿈> 'L'P'T'X'H!( ` "!($ !(``$`0  ` :  2 ` $` "& & @a (`"0  "@& & `(``(0u> 0r  $ T`l `2Mu  0a"`"`8 @2D > !,'' ` ``t`<`'`'`E `2` 2@8 ? " &`@XȒ 2 &`> "!$ `` ``t`<`'`'`2`0< 8 2 `N$ 0 " > !,'' ` ``t`<`'`'``2)@8 "@@ 2`?`>'#ؓ*` €`( X&`@Xm &`> "!$ &` `` ``t`<`'`'`2`0 "T`<` 8 2" `"0?@> a, a, 2<0& a,` ` 2`<```t`(`@@  ``"~(@ 2``w(&`` "`` "` m k i&` `"d b !,( 2< H@R  # T`K<` 8 2 "  `x# 0<?@a,`0& a,` ` 2`<```t`#(`@@  ``(@ 2``(&` `" `` >'#ē*` € &`@:㿘H /` * !   ?8  &   T`2& ː? H 00@  R& @Wg 2 & > "!$& H 0㿘    8 ?   T`   `@ 㿐> a$ Q H /` * ! > !,$a$'' `4 `t`< '+  ? $   2  ` @L   @G  $  $a$ ` `t`< ' ' 2 H 0H(>   2    2H@H /f * ' > "Kݒ  > `4`` `$ 2` $`4`$@$`$`$` H 0`?> #Ȓ `$`  $`$` 2* *2" ""` ` ?$` $`*, $ @4 4 `> ` ܐ $` $`  @  '//   @- > Òa(`  "` > > ,`" `,`( " `<`2`, > ,`"  `4`0 " `<`2`4 <  8  ?     * H"*  @"   *  @   :@2㿘@R"   . ``:` `*`?&@ #: . 㿀> " !'@  !@ 00!@0  " {@z > !,   2 < a@"'a@"< a a@a@2 !0a#@ a!@~ !@  !a%@t !      2 < H@2 < !@2  "- 1  R > RR!t    , |@Q |H /` * ! > $ <a,` <$ @`""`$  $ "&  D  T d $$ $ , d, E, DT "$ , T, U$ $ tT > aL "aLH 0/    װ  "    H ``<` ` 2`<`H 2`<` ` "   1 !@ۖ  a@"T a @a@E0a@Đa@@00!!@ " D 0a4@za3@ wq!#@ "T !%@0k& H& L& Pq& T l  T& X& \& `b& d& h& l& pY&T V H /` * !  T' X' \' `'$ T$ X$ \$ `耢 a $ T$ X$ \$ `H 0"   $   ܐ T$  ֔ H 0  2 $ T$ X$ \$ `H /` * ! @    H 00#  H 0$ 4$ h  H /`4 E* ! E   2  D & H& L& P& H@" 0 @0 $ d4$ h8$ l<$ 4$ pT "! 2@  $ T$$ X($ \,$ ` 2T`"T@u T  !   $ T$$ X($ \,$ `  H 00 " H 0X␰ H /`  ى.* ! @4 ` "`&  "@ <`" @ @"`@> "!0 @ <"@ x " @A$ x Ԑ?$ "J H 0@{ -耢 ␒  > 5̐"> "'2 > P"!@ "!@"Ȱ -0!@2ð - @" 2  2  `  2  @  "  8  !@ "4l!@"  -0!@(l - @2 @O @q m "e  //Ԑ ai@N  @0Őll @@ 2[   !@l     `2 l  2  09 1!@p D DT  T T0@N!l h&&  @N @  D DT  T T d d a > 4"@㿘@x> "'H o&*@g`D &`D'`H`L&`H''&`L `P&`P耢' a  &`D&`H&`L&`PH 0l"H 0> #d`> bX@א   &@`D&@ @ ?0 @ ??&`,`4``,&`h&`4 &`,`,`d`4 @ @ &`(&`0`&`$T  `4`0`,2`(&`X2 &`8 `D &`T`H`L&`X`P&`\ &```U   @TT  `x  "8 'ܒ@Ր&`x" > 4/"h㿘 X H h > !, `T  "HXh 2 <@ 2<  <2     $ 㿘` 2` N `T   `X`H`h > !, "4T `T  " H X h @ 2# <  2 <T ` ` ڼ ` $` T     ڮ    $  2 T ` `  ڜ ` $`?1 /`2`>  @ "1 > `T"(`` "$`b 2H"X" 8 " 0" (2  2`@ 2`T p> b'H /` * ! > !,` ` 2`<` `t  $@      $ 2   $  h&  6h  2 @H 0`  && & , 2<2&  6H 0F o 0 `" t & t "`t"t&  ` @// ' a1Ѐ  `"  "`  "@ ` Ґ?"` ̒ 6H 0  H 0 > 2"xp> b'H /`     * !  ?  &  `"  "`  "@ ` ?"`   /'  a2Аy 6H 0b > 2r"㿘&&   g  & > L"  \  & > L"6 *`2``` 0-*0h(0#~0> ÄP(> x*0@h (0 ~> ÆP0(@ ` *   㿐#> b4  !> > !Ԛb#\ ؔ  Cp  $b4!D  7@K $ $ @> "> , > , b> , , H /f4@* '@$ $ ` &`@" &@ >`` * ` $ ` ` *` " ` >` * "` >` *` $  < ( ` ` *` $`` * "` < ( > ` ` * " < ( > ` ` * @$ H 0 & ?$   @2$ А!$ h$ а 㿐 @>       @ #@В> !,`" 1 > 2  8 2    ` ` `U` `Ѱ `< 8 `6`'@  , 1  2",2  /# 2  ` %> ÒА 5`@W    @  @ 2 0Ж5` @G " ` @R  2` 0`& 826 > h > > ".b2  Q #p "X> > "&b**`, 2 2` 1 5> ,@NA$4@ #?@?* 2`@4@5: 4@ @ p Д  8@ 16 >2 1@5> @N4@ ?@ * 2`@ 4@5( 4@ @ @ Д  8@ 6 >@$ 㿀 @  ``@p h!"` > JŐ"耢 " d  " _ / I> !," 8  ? H2  8  T`" 8X&  8 2 8 @R` @t H 2  8쀢 7 1'3 `'`'  @f > " 8" 0 2  > 2 ` 12` 1$ 8 $ ( @4 < #\#`    @uߚ 㿘 @ `> $#X#X` & `& (`& & $& (@6 < @ `@㿘 @ K"` " H H " h h!@" 0@/ H /`4 * !    ` "`"  "@ "   ` "`"  "@ Ȁ " @om ̀ " @og Ā @rH 0H /f   '"@* '  `"  "`   "@` "` "  @ "`"`  @ "`H 0> Ð!Cx㿘`  @H&`  , , >4  8$ 㿘 @  @2`@ǩ0   @H&`  , , <4  ($ 㿘> #d`> c@^ ` `` h!2  (2  @   뀤X H`& H@H @ L'`0'` '`4T `4  ` `0 ӄ`㿘 H & H㿘 / 7  / @ @  .2  >- 2 @2 `v  h!"  , 2 0 2  4 2 8   ,   ,  ,  ,@I  2{   2  2   2  "    2@ 2 @ $ 2@ ( @  `   `  ` = @I  2D  <2@ 3 2/ ` 2+ ` 2' ` !  h!2,  (   2$  <2   8" 8  8 `2     `"  6    2U >㿘 H 7 H@G  @ `#2,       $   (   . .  &  &  $&  (~&   (  . .  (r& 㿘@ ` @28 8 9?"8&@2@@   < 2@  .`.` H&`` @G? @` `< T`"`@ 2  74  2 4 7 4 > !, 2  1б &@< 8 2 D" D> !,  2 <  D 1'  DH("    >  ( "  (  > (" >  ("   h!"1<(<>    @("   @( (<>   ("(<>    ()"(>   @("   @( <(>   ("<(>   ("H 㿘@.6/  7 @  *  1 h!2( ( 2$ <2  >2 8 2@ `"  "` "@ &@" #@&  2 h  > "8` (+ > # 2H^3 㿘` @. 6/  7   *  6 h!- @G  2( <2$ >2  ,@G{  2 `"  "` " &" $&  2 h > "8`> H #`,`> 2`H#,> #H2`㿐@'> Þ!> Þ!Й.Е3     * @@  h!2 >3 @2 < 2 8@@2 ( 2 ' @ !Г3  *     h!2 > 2 < 2 8 2 ( 2  > "8`> #G3  @` "` "@&@" &@& 㿘> #t>  #tt .t  2`` ` * @ *@ h!!6 >@2 < 2 ,@F  2  2 2  $ 2 (   2 h > @F  66t t`  ` * @ *@ h!!6 >@2 < 2 ,@F`  2  2 2  $ 2 (   2 h  > "8`> #F6 ` "` "&" &&       l                            㿘> ! `> "b㿘` , > b "b?@ 2%`!  @*           > Òb` "` #  @"  8  @ @*  8  `(8'   0` - H /f * ' > #<Β & $H 0 $ (  & 6 & 0& (& ,& <& 8   . [`  &  ܐ"   ?@& `( > Dh > Ð" .` ``" *"` "*  `2 *2* 22*ג   2    $?쀢 : > D:  ? & & & @& ? *@  #?* 2* 2 " "0ϐ 㿘  @z㿈'L'P'T'X'H '@` $> Òb` b"`@8 @ :  z 2 > }b "@& & @* > Òb` A"`  "@& & (4> â"*  `" `() >9!*` €n>9!\. €   _b Zb Ub   { `#b  *`@`<  8 "<b  )2 > ߀`C0@6b` "` `*``0@ 2 b` "` * >  " #  > Đ  > ޑ* * b< * `@  0b` "`> !耢`2R/  # bK/> !쀢`> !耢` `  # b`Đ "`Ā`b @/' 1' > !䀢`` $Wb> >  0" b0"   `p3?0 k /h'  2    T 2X " X&   В b``  "`* `@O" 0K   > !`?b`#( `  `*` @`8 b` )"`> ߘ"@#  > ߒb0"`>  " "  ' Қ쀢 > !`> ">> Ў`쀢 " t"  @(0Jp>   b'   `'e-`   ?  ". >  $a,  H   T`" < X2 < 2* Hؐ@A ܐ * / ʜ"؀`2`X> Ĕ4T`"T|    H`@ "`X`8 ?"`8 H $ ``,@ ˤ   0    % "@ 8`  D 2   뼒  % $ $    (  `@ހ   4     *@   % "4@* @$  "`&  "&  ~ ? @6 @ b.b > 'f 0㿘   , "@& & 4`@"@4`  "@& &    @ 㿐@^T@Aa* &. . @?#㿐`, @   3> ߐLa5>   a` &Ha μ &  *#\ > ߐ"j 㿐ɯ  "'  4 >  0   ˗  L"L P"P T"T X"X> ">=b  㿘>  ΐ" < %LP  `   * $ > ߠ`< \> ߚ"` L b`*@( !' < \   "LP "Pɾ 㿀> "' 2 4> @ݐ @  2$ L   ' ''  ' 0> `> ޑ* *  <*    " "& P" > &P p㿘> !> > Ð"#֒a`?㿘 2 4> @       0㿘.`  .2 .   ,,`6 중2 @@6 , 4 윒@@6` ,`6 㿘[%?'> )!$4@Cj #c4  > > 2&J2`$ > F2`($44` 2 !>  4 ,! > 2`* 5> 7> 3> 1> -> 4 , , @CB*  `%#$4@C8c4 $4` >   ,,`2   , @C&4*  2` , 2  @@4` ,2`z ~ @ #` ? 6.&`05~6|㿘> "|a/  > > c0$> |> > )>  *`, ' $@?ူ?4 $>  (>  $b|@ *`.2`;5b|> `&> ~ . 6 "H!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"0!!!!!!!!!!"$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|####$$$L㿈' `1>  `> #\ ` 8A  8x"K7"""#g""7777> > `77777"7#\   66   ؔ  > > ?& ؔ<#@ *"@ *`" *  *  * " * "> Ē`: > > %> à`*@@ 6*@> ߐ!  @/> ޘ"<+`" + " **" "@ * *`  @ * *` @ * *`" "@ * #@*`"@ > Ę  ``2 `4S```:+ `4@ #> Ēa> #p"` , ," > bĀ > b> "bԐP@>   P +  2`*`@ (  #@  + `2   > Ú!+  2`*`@ (  #@  + `2> > Ē` @B!> > Ē` @B!> > !`@Bݔ 㿘H /f * ' > ̀` ` """`?"H 0 ` ` > >R!@ 0ց㿈> !,`'D> !4`"!4  !4Ē  'D  $ D 2` 2`4`X t"`X `<`4` l"` @  'D4` `"`   "  2    T`2 4`p J"`p 2 ?  4 t `" =" t @4  4` 3"`# 4`t "`t @D4` %"` 4` "`$ D 2"@ ""  D D  D>    `@ ,``"ct@  D@' "   T`2  < 8 \D`   'D > "`> #܀`D@   4 s4`$ "`$!,D     <  @2< t`@   ```@ 2``2G 4|8 "|  @ ( "(D042> "``D " H o *@ g  ( @]  D#\ @b H 0 94D@0S ?@D`    'D4`  A"`  H /f * ' > a䀢   H 0  > Đ %aH 0 > "܀    2  @2   @2  @"  2   "2 4 *` `" 4`` "``H /f4%a* '%aH 0 0  * 4 *  i 4%> `> `  $`@9`d $`dH /f4%a* '%aH 0 0> Đ"4 `d $`dH /f4%a* '%aH 0 0 `$*D" @" 'DH /f4%a* '%aH 0 0z`@ $`@`   `,`4 @H /f4%a* '%aH 0  ΐ < ` l9 7 )5 3 1D  H o *@ g  ( @\v  D#\ @aƘ H 0  44(D`~"(044> Đ "4 ` @ > ޑ* *  <*  D  0dD> ,=H"8  T 40 ", > ̀`"!<`2<T"<X`8 `0`(2 <`  `2`2H 㿘`  ` *`  " & -&   :  ,> > bܔb܀ &@" "b&` <.` ` .` `6` &`   &` &`3 `2l` ``   `  `   + `2` 2> ` ` `  `@` ``  (```   $ `>  *`2`"2`5``  ,`)>  @ "@ "@` @`"``"``@"@> Ē4""?` %"`  4`2 @` $` " &` `  $ $@" %@$`  `  `` `@` `  q `? @c *   > Ĕ4h`@c"h_ ` !> &@4>"> b?`"b  40"?$"m2 5``%` `%`@`"``"``@"@  @ * @& @  *  "@&   @& > Ĕ4`"> Đ"3> b ?"b㿘 "'> %>  ` "` "3Ւ? $`"  "` "@ 㿘H /` * ! H /f * ' > a䀢   H 0  > Đ %!H 0 > "܀'> > Ģ!4 ? *`  `$` 2 H /f*  %!} $'%!H 0 ``8 ?"`8$H 0㿘H /f * ' > a䀢   H 0    $H 0   "> b܀  > Ģ!4 `"ܒ`@$`"܀ 2`H /f4$* '$H 0 㿘 2#> Ĕ4 `"b܀> "*` > ߐ : @?> āx  `-` `  ` 3> ߮cx``  ? $`D"u ``NѪ%@`2ͪ%@> "`"ߴ   ؤcx $([ 2?`%@ϴ   '@%@{ `2 (r  ( @'䀢  H% d  < , 8 @ @ ?  ? |> ߐ c|K > (#x   H@'䀢  H;   d,$ 1ꀢz逢`v 2  `` ` ?*` `i'H%@ ?   "   ,$@V $$@  N%( & H   <> ߐc| 'cx  /. 'ܒ ܒؔ  /%@` ``  > "`@(    ?  ?  $  > Ēa4`P  "`P㿘> Ġ"?` #> Ā` #> `8 ?"`8> Ģ"!  , $ ,)aa   @ > ā㿘> " `@> !9Y + > `Mk?2 > > "ct"H㿈   //'7  "D  4 $$2: 8 0 `> 3 8t4  `"+ 8` "#` 0  @2     `@8^ 2   8 ?$ 8 O  2``2`  8 ΐ?$ 8 㿘!> #t  :  #tH > "Г+ `& > !( 8ޔ #t> `L* "Т  "@ > 8͐!H?  *`*` `ܔ   @   %> "Ѐ "@8X@$@ > " H`$> !`8 㿘  @` , ?௔"  "`&  "& @* @@ $@㿈> "д `    > ` !h`8t ` ! > `' 2 `> Ĕ4(`"(0ǀ   * > > Ĥ" /> `@    8 ?$ 8> Į"!  ,,`$      0` D8     D`@8 `?,` < @2>  4 0.>   (> "`$`#>  >  @"4` 0 >  4 "` 0 Ц   > ! 7> "̀`  !#\  @ > Ĕ!4(` "(> Ĕa4$  ""$, ",(A>>#* €      P   < \a4`L "`L Ɛ0㿐` ? ?`w>? *` €`> !d`v  > ߒ  "m!> ߐ   ""Ĕ` !> "Ԁ > $bW$"Ā S!> "Ԁ O> "_ H$"Ԑ !> ߒ  "> bԀ<"( 07  > Ē!  .  > Ē!  $  > Ē!  > Đ!#\   ,0 >   -#\" %&&&$&4&D&&T&&&d&t&@ 2 22 > ȑ2  > Ą (   2   @2 2 L2㿘`d> #܀ 25 *` 0>I *` €@'@#@#@@@@@ @ /@  * ]㿘> #܀ ) * ƒ `k&`m`j  * `n * @| @ @@ .㿘> #܀  0a3@a4@ 0@40@㿘H /` * ! :  4& 8& <& H 0  H 0?& & &  1> @*` (> Ő ` ( 0 4" 8"@ <"  " 㿘#> c䀢 >  R aV4 V 2R - R ``K -"I ` (E ``> > c܀ ""c8 0> Ȗ  8ڐ!> "b> Đ#H@3r!> +" !> >Pb< H 1> !Ā`&` H:`!> >X #0bX!#0!> >Xb# !#c䀢 > a4W  㿘H /` * ! >   `#> > Ť `, 2 * "@*`"@*`@`$  @  *  2`@ > > +> " H"`6 > #0> # b*@ @ b> Đ#H@2!bS 8> +" >  |@2$b> > " "cܑH 0> #䀢`> a3  㿘>   @ > Š ` ,`@ l@J@& ,> > "cH @ *@ L" ""22L $ @  #"@ "  "  8  > + @ "`> +   " "$  >   > +> "  *```*`>  "  "   8  #   "   >    "@h> "' "  (  `(  *`" * " > ő* ``  $>  0 "G"  2  1` `> b3 } -  8꣐!Ģ@2!> 8 4`( @@1 >  "`T`T @> b -!В  //'` a1Ѐ QH /` * !  $@N$  $ $ $  #,  ,  @4* $   T$ $ $ ,$ ($ 0$ 4$ 8&$  `2> #䀢`"    > "> " > #\ bH#`   2   > "p> "'>S Tb "       ,Œ 8> +> !> +"`"> !Д  , //'  a2А@1L lb > "㿘 "Y  >  `  M *" > ő* "  * ``  $> 1H o*@ a `> ߒ*`" * " `$* `24`*`2    ?* "@*`"@*` 4`H 0#䀢 > b`1  㿘>   > Ţ ``,  l`l@0&`, > Ĕ?*" > ő* " ``*  $@  > Ē@ ?@ > "4> Ě#H @  ,  L`" `""```2`2L $ @㿘 >   `6 >  `  P`* @(@ / &@ > `L& p& p㿘@& `& & D& 4& 8& <& H㿘@ t L`" @~`꫒ 8 2@`"  "` "@꜒ 88>  >  c' , P "  `  ڊ P  ڄ ,@0 $H /` * ! b > #䀊`> b 1 nH 0 > 2` 2`2 2   > Ĥ b, J > Ī#H7> 5> 3>  2= 28 L"4 *`2    #\0͔> #䀊` c 0 L LG$ L$ @ @ ?-@ ` @~ 8`2  2 -  J> #䀊`> c@ 0,@  @2 @2  @ > ĒcH @?*@$ @   x 8   H 0 7$ @$ L$ t@ $@" "$ H 0 " > #h@> "  '"F  , B  ٍ ,@/$ $> #䀊`> cp 0( H /` * ! b   H 0 1@ t& t` "` "O 8H 0 b > G#㿘  L  x    }:?㿘> ߴ#` >  c /Ę  $   2 #> `#@/  $`>  c/ F  B8 ? > H /` * ! >  `" ג " H 0@y` `  #`$` $`,>  c/o   8   沑H 0 7 }d      2  蕒 8H 0ڰ 7> 2` 2`@@ 2 @2 @ !> Ģ@ @,`@   2 @2 L " 2 L 1> -` 2  *" * > Ŕ`" * ,@2`  x 8摔  4 }  *      '   *` *`*` > ߐ $c>   " 6 >  .ђ`0 $0 8 8|)H 0Y 7 $ > $ $ @H$ 4$ 8$ <    *< ,` #  P+ *@  &+ 4 > !$ t$ pb@ $@ " b " $  $ L  L` "`ϒ 8{H 0  ` "%%%H 0 㿘H /` * !  1> Ė#H  4`> ",` -> Ī"  @ $?  $ @ ?- t` %>  t $ t t  `  `%` >  `H .% 2 @`Ȗ#HH 0> !Ā`&`> Ő H;:`㿐 >   `*  $@*" > ő* "  ``* `,@ `$> #䀊`  *" * > Œ``" * `,@ > `p -ڔ> Ģ > + "<` &<, 2  ܑ*" * > Œ``" `,* `"Ұ      *`2    *" * " * @  P `2 @IHD"@ "   +  "@ + А"@"@"@ *`" *  *  q" `.` {{  `  `  }`u 7 b&D&H`> *`*` *` `>  $``  ܒ ]" ^ >  -D``0 7 U$`0  @ `8`< `4 `0 `" " 4`8 @&4&8' , 2  @`    `4`< @&`4&`<` @J @ * 2`@ `l ݠt @It"  @ 㿘沒 z   , `  `  }` ` 2 @0@`㿘  `@% ?& H /f * ' > "$  > 6 `` $ 2` & 6 && & & H 0 P!> #Ȗ  &  & 沐&  z  &y0<#Ȑ ܒ" @4| 2>  ##& & & &  "&66`$& `(& 4 ,  `&  `@K*`4  ?& ` `2@a0@~㿐> 'L  'P'T'X`'H@ 0i> +  @/ >  > ő*`" * " `*     " l ( 2 l 2 > Ĕ`ym"> #䀢`?>  `, 09> + "`> +  >    "@ " & & &  ,& H /f * '  @`y<"0 &  2" "" "H 0㿘 # > Ĕ,`y",01@ `2  "& @Œ0"@"> aĠ T@)F d͐0@ @u  > Ĕ(`x"(0@@H(` ""H 㿘H /` * !     &&   ?& " " @a& H 0㿘> #܀`@ɐ   > aĠ T@(ϒ dV㿘H / * ! @`#> Ĥ"`@(`` $&  xc& $ $$H 0  ``2`H 0 @H /`4 * !     @   @ 0&`  ,'  //  @ޚ > #䀊`> Œ``& *` * " * "* > `:* H 0㿐H /` * ! @F  "@ "   +  "@ + А"@"@"@ *`" *  *  O  2  c& & & & H 0㿘` & 2@0 * @` @ @" <@ @>  #> # F 7> #耢`> ``ؐ *7  2 2 㿈 ' ' ?>  b  -    "     & 0 ΐH /` * ! :  2 tH 0g 1`* P ` 2!@` @2@`  @2@`$ @2@`( @2 @`, $@2@` 2@`2` P J  / $` @E$` $`H $`L $<`  <`(<`@$`$`<`8$`$` t$@@7$tH 0 H 0  H 0 7㿘  @KĒ 㿘 "  ?{>  b v -H /` * !   2  H 0] 1   t$ tH 0O  t +    2!  @2  @2 $ @2 ( @2  , $@2     2  " ""`t@ӐH 0F   H 0 㿐 H L"" ''Вb@ ??  O @ @4 8$ 8@ & H  + & L> @& > 8 8 @`C >` B@> 8> @"   8@8   $ <@  ~ ( @@y , D@r@r @ k& h @  @) 8& 8 @8  < $@ @ (@  D ,@@>@-@ 8 @`C >` B> 8> @ 8 @8  # < $@  " @ (@8  D ,@@ & H  +& & L> @> 8㿐`@ H L"" ''Вb@ ??3> +` ( @< > #` *"@ @ &`#` #` #` ;` (;` #`(#`, 8;`0 @#`;`8   #`   ` #`  " ` #`  ` #`㿀> "> + '  *'//ဢ''R'# H /f * ' > "  > `4 `  $ 2` $ 4 $$ $ $ H 0 > > `' $␖   $ v$ > # v> Ģ"`> ܒ`$` 6 >  'qa`0 $`0 >  !H.@@"H`(  :@""L:8В@?@#`#d?/@#`#dd``` c"@> |*`" "#㿘  " c> *` |     `@2 ` > &Đ!X" |" " $& & 㿀@C(> x@" "x$H /` * ! "  >  |4 ,@`v%@?/"?a` H' L' @' @'@?@@4 H0 $.  H' L' @' @'@?䀢   <" *@*4 *@ $ %@ %$   8 @8  < $@ @ (@  D ,@R `2H 0㿘H /`* ! H 0> !>  t#0㿘>  b"> 5> !>  e#4@X@x@xxxxxLLLL~~ ~~8~\}}}}}}~~~~~~     L > "''L'H'P'T'X'l 'p/g`  `h!l> %{!l `> %s! @dtt'll <* @ &k6> `* *` > 6&48 "8.  'p $@ `/gȐ@$x @`4 "8@" @8 ?"8$@@   ,,$" 2 ݐ >    \@.< 8 2@ "@`> !, , \ ")<"% 2<@ 2@(@`2`P> Đ!4 Ta A`@`< \`X "`X@`4 2`0< 8 H& H /f * ' l { l``$"`> !$ $` @E5`( l?'pl{v #\ p @J~ lH 0p ?N "'pPlH 0B {  l`@` @ l` @%9  l{`2` '\H 0l` " @  l` ?"` < 8 F g@` < \$@ $@ 2|`2@Ȑ@#b @`4 "8@" @8 ?"8$@@   ,,$" 2 ǐ ~>    \@.< 8 2@ "@`> !, , \ ") <"%  2< @ 2@@`2`P> Đ!4 TK A`@`< \`X "`X@`4 2`0 2H& < 8 `l !"2``    .> Đ!4 T Al  T T@ `"  T 2  `2  > Đ!4 T 3`" T3'p  > ,`" ,` 2`<`H& ,` ` 2`<``t(     2 l  > ` " l@ l` ?"` l@Ք> "`> #܀` 2 l l l T &l0l|'| l T   1'p2 'p \@l`!2`? b 2 ` `@ " ` L  ` 6 ` H /f * ' > ’c@ l   A'pH 0ll 2  H 0fȔ\@CD 2 > ߐ A'pH 0vl"Ā`Z@Wl SO> ##:`  Fl   A?Z 1$@ H 0`2@ "' 4  '  /'/'' '  `$ P@` `8 ѐ?"`8$@ (" ( 'pl? @2l @[ 'pH 0 pl y(  l 2 ` @Gې`ol A`    @ " @А l`  ?   @   @ l` ?"`  l4  Al'pl.> "`  x۔   Alo'p@" @ "  4@#(82 "6  @ 2 6 l>  4`" x "xl@6 l > `a,  "a, > c`0 "`0 l@'pJ@ ( \'p@4  > L  a4 \P 8"P> Ēa4`L @"`Ll@\  'p 6'lJ Gpl l`"`p   l@'pol 'lp @> Ēa4`D "`D@$p!Ȁ`> `8 А? "`8p (> "Ā` l "@\nݲ> " > ʐ!㿈  `-`&''nȐ ( "'@Ɛ ?& '@  > IJa4 H /f * ' > ") > 6 `` >  2  $& && 6 & & H 0 > '#ȸ  `& $$ $  $ $   #@6 @. = `**` $& %?Ȑ*:`@4  @ 4  & "@ 4 4 n  E&& &  @    & `x`&`x4 @Ē4 `H &`H  s'@ $ p&   44 @ 24  > Đ & a4`x "`x> Ēa4`< 7' "`<4 @4 'H /f * ' "  쀢 > Ĕ4< 7'`"< &H 0 쀢`  m& 2㿘 ?` c @ q` 2$    $ " :P H /f * ' > "  > `0` $ 2` 0   H 0<?     >  `  &  6 @    `& & cȲ  &   P&   @& &  & ɬ   >& 4 㿘  `,`쀤`'`  $?'> 䀢 `,  8 x  q$@` 〢 ?& ,   㿐> # `   ' * 2`>X#*` €`@ "  2   `>X#*` €.`m.`t`h &`h ?&`h`h &`h ?&`h`h &`h ?&`h`@&ܢ "ڢ  2բ  "`h"`hɢ " `hŢ  ?&`h ?ߐ &`h ? &`h "  2  8 ` " `H /` * ! ``"``"``"b``"H 0 `  H /` * ! ``"``"``"b``"H 0 > `09)`04> "؀ 6/.` z 2) '.`"܀ 6#.` n 2 .`> " 6.` a 2 .`> "䀦 6 .` T ".` `* @C `<*@ *  &` - Q  mɖ 2F "`   *  `Ā    @C `'" $   @C`" `Ā   ․ @C{`" `Ā ـ  Հ @Cn `" π 2`ɢ  2   @F   &`  n ս    7 n&& 6 6  mZ"%" Y`2"AS`?* 2  ?VJ `9` "`@C `<" ?* 2  )VJ `#` "`@C `&" ?* 2  ` "`@B`" ?* 2   n  ` "`@B`" ` " `H /` * ! ``"``"``"b``"H 0 ` # H /` * ! ``"``"``"b``"@H 0   * ߰j۰`>X#(*` € i '` "$  $ ``ƭ  iِ ' `>$ >X#*` €6`m4`t`h1 `h2 `h2 *`@1 i ' $ `h  2   $ " `  "` `` w" i ' $ `$ >X"*` €`Ā 2 7`Ā 2  7`Ā 2  7` 7`Ā 2 `̀2V C2@  i: (-$ H /f * ' > # "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2$ i  7  2Vl   *㿘 `i`&`  `U iQ La`   F `&`  /`@^ `$4`  "0`   `- )'``2$@` ?&` ,`ŝ $@` ֐ ` ,& iD x> "@'   X 5ӯ &@ ,$,4?`>Y $*` €"  2 > $!,`  `H2`<`2`  TT@"װ 1$"Ұ  2ΰ  ,"ǰ  2ð  8 ,"  2 <8 @@ 2   /'ؔܐ *"؀ " 15 <> !,`  `H 2`<`2` p TT@l @` @`@  ,` @2`@2`@ `f 0b ;i,` "@ Y 7 U4"R  2N <8 @@ "D   > !,`  `H 2`<`2` "0 1 @ ,` @2` 2`@ ,` 1 ɢ`@ ,` `$?@  ?4 -  "@@@"@[ 5&@" > Y"0㿘 g   &0  # -0+ ``"` @`> !,`""` 2`<`""`H"" `` "` ` ``"` `*  -㿘     , @ X  ,  5㿘沐 h  ` 4 `@z*`4 1 㿐  @ +   " @{: * ` 7 `  <c7 `   0 , 2      i0 2@ T<dtLȝ㿘> Ȑ!9 㿘>  > !  `4!"`D h!2< u`"8 @248`"( @2,(` @2$沔 h'  L`4~ gt @}ఀ  @䀤2hL`4~ gV0 }ఀ  0     x > g>> Đ!4 0 4" 4" 0㿈 'P'T'X 'H'L h d V`  ?`#@U ``' 8# `  $"    ܐ"   "    & &  gB        & 2 mG 7 .`6` u.`  6` 8&`&` t " /.` ?#fʐ- ( @ "`  `@ *@6`f  > 6`> Ēa4`\ "`\  W H㿘`  P  Lf< k pd1  0<;m9 0' `" ` 8`  ` h  ?$ h #f| e ' "  h "@    c   㠔<㿘``  ź ``2 `.`>d", € "`> m"@ >  >  DH|c > Ȓa x`u, u` "p 9{  2> > J"P#܀@ A _ >  `"U 1? 8O 1 "K$ 8 "F 1C$ 8 = >  `2 6 1? (/ /z$ (+{'`   8 (2 9 x   -H S> "`e㿘> > ȑ* b* @d"".$@4 4 $  tg!t t@!t``* 4W <"4 8 4@ <4 p $ $ $  $ $ $ $ $$ ( $ ,$4 $ 0@Ғ (4 pT  tt`tttttttttt<㿘 |` @!> " ,  @` Ԁ@e  `"`& "@` Ԁ@"@#> `d"  +>  ``"     `" $)`  ` $@ `$!`@` #`` ; Bd;`Ԓ0g:"&`@&```#``Ȓ ; B;`d ` "`&  "@ "$  ` " $$ 6 " "2 g $ 6` $ $" & & $ $" & $$V h $Q  "M     d ->  L `&   ` `  $` &   "@ |`"  `h!"  `H  @ﱔ   " d* zݐ?``   ʔ zJ   㿘   '  @ 0c0@@!>  ``|> 'L "`|'P'T'X''H'7  # 'x't'p s7f @2    ` ```'0`8 cĐ > `@ j   @: > "p     "'|`'`"3 s  '||<`8   *' ݐ  #|  /_ @ !( `"  "!( @vD ?& a( C"a( * *` @2` /_ 2   ?#@ 񀦠  2    2   ?#@ 〦  2  2   2    Ӏ    @b ( `  "` 2 , "`  "` ?' @@j    @: > Q"p   `  "`'t 'x$ ` 2 @B @2  2  x '''x' ` ``> # O | '|> `#'`2%`Da`  "a``> #   |> #'~ `2`Da  "a > Vh  (`'TH-`@  ǐФ@ @  ``a |//` '/|7/'7 // ' ' ' '/7/ ' ' ' $'7  `h7f`2 > `3 (> `̐.   |> `l' > `"   l` %`@` o`m#\@ c?"  `D] P@ GVh >  ؀`2 @r  "  "j @2W 2` `2W 2  @  |  2W 2a m"aW 4@jxt#\#`#d@ ZX Vh 2> " j H o *@ g  ( @4  #\ @9њ`" `H 0&N A@8 `Ā 2`Đ@<ܔ   $`đH 0 `` 2 `!x "`"`!x` "``Ȁ 2 `!t "`$`!t` "``̀ ! $`!`  "````"`"``"@$`H 0>  Vh &,> !> 2`@:`8 @ ݒx t$ #\xt@ؚ    P" " "''_ ` 2 Vht@ &ta< "a`B ;`#`|`  |`h! `H  @  |yOt h" *&t`*&`̐"@ &&`V@24O 2 > !Ġ2`@Vl:`  vk | @2l P 2h P L P"@ X T" 4 4\ P  䀢 "a @ a  #a Ԗ@&ԕ: ``@ B  ;`#`|`"  `h!"  `H  @w   _  Lbq@ Lvv   t >  ``&t> #x&tt@'l L" X T"@@ 4 `& Ԓ"@@ & Vh &Ѐ 2`T`a"@ `"@ `` `"@  `"@ `>  `t@@ =T   &&k&@ Vj`$tp& tܔ `&t& &Ԑ &>  ``Ѐ P  `t  &ta0? "a0`h " a`s"> !> 2`@㈔ :`6h8t ` `KJ.H.IH /f4t* 't   H 0  &tH 0   ֖H /f * ' t* &tH 0 0@ "@  p &  6h &Ѐ@"@aQ `ؒЖ < `ДB;`ؘ '#`к`?&g& !`2 L` <T" 4&L :`` aB #a#`;`" BT` &`6ߠ?4t`2`t&t`` < B #` ;``` < B ;`#`l'l@&"'"66  Vh  " @`" В@ $ <   )# В : ؖ B`; Vh 2 Ԑ" $@AЀ y`Ԁ@t`t &t`" ؒ < B; ؐ` "' L@  X" `` " $ &L&L"@ 4&L&L&T`,`X@"hԀ@gh?* : `>g \*` €>  `t@R = 67 86h `M" `> `t  `;Vh K JY> `rW"> !> 2`@㈔ :`6hQ8t ` `KJ.H.IH /f4t* 't   H 0  &tH 0   6H /f * ' t*@&tH 0 ?&>  `*`@( t@!̀@  8 p@ 2 t@ &t& &&$aL "aLa4 "a4` @t*@&ta8 "a8" 4  Ԁ@@"` "`26nn  $ `i> n L* :`@ V6n  p2 @̀@c6n( = &$ &t &t&0!!P`B  Vn L '@e   'pp & Vn L @ 2Vn$& @<$ :6n@5& 6nVn`L@&6n" ` "`"   >`B`;  # @Z"@ 0" 4" @K"@ @24 'p 2 > !Ġ2`@Vl}:`ΐ $p r@`LVn  H?# * 8 & " ||`"  |`h!"  |`H  @Z  |@   |" & |t  t"&  qt" `h" *&t`*&`̐"@ && ,&Vh "$   0E/ 50@ >   p> !> 2`@:`HP )6h' 6h@> !ē2 :*"@ P6*`ps @> !ē2 :*"@ P *``0` @ @)` @ @"` `  2&@2 &a "a&&@&&@ 'p` ":"6Vh 42 L> c (6-ؔ@ " $& L"  ? ' H  @7 nѐD ?.D@ !l@ؐ"@ 4& 2Vh`Vh H /f4t* 't   H 0  &tH 0 Ԁ@ol kVh gH /f * ' t* &tH 0 t >  `` &t> #x&tNԔ & ;`  B 8 ` |`"  `h!"  `H  @   lZ\  L\ݐ Lq p '  #\ːH /f * ' t*@&tH 0 t &t  @@ `Z`"A Vh <  ptԐ `&t&Vh "    (  > " 6h6h 6h@> !ē2 :*"@ Pﲓ*`n  !ē2 :*"@ P肋*`  "pt  pf> *:`ऐ 9  pf> * :`l - p`t p> @ېl> a  ""a>  \> >  #`` 7`4Yt`@&tP> >  T> >   `X !``   @ 8> ` '   @ (> "| @`t  f> *:`ऐ Ř 0 f> * :`l  YE>  > ."0> \7" '  y`s>g |*` €`2l@ "h@V h 4d@`  \4 `2Z@ "V@V h 4R@ t  @& t`@8G.!K` 2E@ $` `  "7@V h 43@ t> !& t&!T)&!L %`2$@ " @V h 4@ t"& t@e@`2@ `@   2?@&`$ t@``~ $  t``@$w t$I !t ????'??  '  + &   // /'/'  //' ''/'/'' '$'Đ Д@+c  2  tV h  t ;& t t $ 0 > # !t#\@  ?@ ]   > > `a? "a `B :  b > "" X   #?쀢 ''`` Ԑ" 4""`""   "  & @ؐ Ԁ & & &  6 Ԗ ""  Ԁk  䀣'"'`쀢 `" 4 䀢"" "`쀢 $ < "`"`   `''?+ 䀢  쀢 ''`"?"`"?  $& Ĕ  "" 耢 4  &  ?  + ??"" & & 㿐 ` ` @ !"@   >  !ؖB:! `&  p >  "0 , "  " 䀦`"@  ݀!" ؀ `" > " & `$ $ $ $ & &   p@ "> `L 8 $ $ " )> '>   ,   $  p4" " 4 @  $Ф&  V?  " $ $ @  $    $  $  p" @ o L :$ 54 " /+ ] $`$@  $` $` " `4$`  $    $  $  p@ ?"  L :$ $   & "  @&> " ! $@$` p@ "> `L 8 $` $`@$`$` $  & &  㿘 (V h $ `&@   #> `"& `" 4 @`Cb ?& <& ` &@&` &  "    㿘` ̀@<  &!0` ! "@" p  p&!  㿘 >  8  &> 3" D D `*D*E " ̔ ?& *`8 4">  8* *`8 * 28 28(& :(8"(  2: 2:`((282:*`8<"02j @88*`R:(8882l2l  2l2F㿐>  x |_ p`!t`< h` ( `P  :"@d7$6"`V``T `\+"> "Ā``\!" (E' `\"a @ `\ "   ""@?쀦"`!t 2`\a @ `\ * "   ""@"?`x * `45!*!*   ؀@* 8 @* t !5!(?􀊤2?쀦>  p*% t%!d %!`@ ! P%!  ` !.  * .  8 %! %! 5 p t  ( tሀ  2 㿘 | p @ )`@: `P@@ N> c@ 8 j`|`P@@@ => c@ 8 j`L㿘``̀@  ``ka $a0`$````p" @ @ $a `& `$a $`` ``p"@ a "@ " $a ` ` > " 2 \   (! \ ` * (> "x쀢 * 㿐>  ` >  ""   > > #b#\   _ 㿘> #` fC> f@"`h> "c U  " h & H>  h>  r V*`@  X@ _ & H>  \>  r  V*`h  P  * & H!>  @ + H* @> *`@ & DH /` * ! >  @ [>  `B `:> "` 4`@`"`D` "` *` * ` " `@"@$```"``"```"@ `D`* @*`@ `2`#?%#` "` S-` `" >z`8 ? >z"`8>zal/1 />  5> ta\>  9> #/>  5> ja\ !p->zB:!p`  * @*`@   :  " 2> # ` 4`@`"`D` "` *` * ` " `@"@$```"``"```"@ `D`* @*`@ ` 2`#?%#` "` R` `" l`8 ? l"`8l踔躒 & 6 ఑*` *  &    &   2>yb蝔đ2`@ H:`虐a\ & a\ "`&a\& && "@$ !X#`4B %#;!XH 0㿘H /`4 * !   H 00 @>   `P 9& > `B : @ `6 > *`2` * *  &    &    >yb+> !ĕ2`@  Փ:`&H 00W> `ahB:ah  6 `>   "` D*` *   "  "@&  `"  "`  "@ D * @*`@ `#2`> c?"c " Q `" >z`8 ?1 >z"`8>zal͐ϒ H 0㿘H / * ! > #H 0㿘H /`4!\* !!\`T >  )> ``> #P` 4`@`"`D`* @*``@"``@"@$```"``"```"`D*` *  `2 礐#?%#` "` QM` `" >z`8 ? >z"`8>zalOQ 2`&!\H 0㿘 `   !> >  h> ``*`@ `@ ې `> `> ` `*`h  ˒  * >  @* @> *` @&H   H 00(*    H2 @ T@L 2 @ p@E  2 HH 0 㿐\H /` * !  2 `H 0װ  @`"  `@ @"  @H 0?` 4`@`> ` "``D*` * ` " `@"@$```"``"```"@`D`*@ *`@ `2`> c?"cH 0e  R``    <2 * * @$ Ā " $ ` "` Ȁ " $ ` "` ̀ " h$ ` "` h  a h !$ h s, s4 >   `$ ,` $ 0`$ 4` $ 8`9$ 8 $ `$ $`ߐ   ` $ H`$$ L`($ P`,$ T`0$ X$ H`$$ L`($ P`,$ T`0$ X`4$ \`8$ ``<$ d$`  OP  ސ &` `    0 h!  @~ OO` D`t D &`t`2` 2` .aK``2`.aJ ` .aH`2`.aI&`t` `t!&`t@ a  &`x@ e 7Oް  ` &``P&aP`&``&`&`&`&a&`&``  )> `t  &`t a0 "a0`  `t"&`t` %> `t$&`t>  > 2``ܒ@  P &a6`h&a,&`:`l`8 `"```"`` `p&a Ġ``&``2``@`V`l:`&`&`&a&`D`@ $ ``Ԓ@a"@ 4&a`Ԓ &aXa`B:a`` "` O` `" >z`8 ?y >z"`8>zal 0/`  @ x  "`Z3` "` N` `" >z`8 ?Q >z"`8>zal > ?`B :㿐H  *   2 H 00d  ?" $  H 00U 6 `>   "` D*` *   "  "@&  `"  "`  "@ D *@ *`@ `2`> c?"cH 0> x`B :x  Ne `" >z`8 ?ː >z"`8>zalgi 㿐H  *   2 H 00o @"  H 00d``  `6 H 00U`6 `>   "` D*` *   "  "@&  `"  "`  "@ D *@ *`@ `?2`> c?"cH 0> `B :  M `" >z`8 ?A >z"`8>zalݔߒ   D P L" X T\"@@ d ?# @42tt$" 't> '`ഒ ' 't$d'ܐ 7В `#\h "     ȸUd !>  `B  :ࠀ "&Mn&&L@Ò  ` h @`" @" h> #-    MQ @* @&  T p&6@&& 6`  `U2 6&@&Lܐ !! 6ܐ ` `2**@ * c 2 &਀ #> !> ?# P* `ਓ2 `*`  2  & P* * ` < &#> > `    6 ܀"$ 6܀$ 6&@, 2ࠐg` " L `" >z`8 ?* >z"`8>zalƐȒ ``B : H>  U b ' `0    (  /Lݐ / 2     `  ` 2 `2  `L> , #ȓ2` ^H /f * ' > "1  > 6````$ 2` &`6`&@&`&`&` H 0`3-`cȑ2 @`-`H /f * ' > # &`$H 0`$ (` &`6`&`0&`(&`,&`<&`8` `Lb `c= 7-`` @2 &` &`&` &`@T  U   ( `  X% t- %  V4 r5`  \ (%  `%  d%  h% $ x%  |%  %  - %  V4 r5 ( 4 $< *`* $  , >  `$  R,  B  4,, 2 , , @A $ 2 `@#@$  @B ^*$> `& P$ L$  aА@h @d  U T/ p/ q/ /! ` '` '`' '''`'' '$'Ĕ @    `| Kx , , U #\@ i 6 `e Ka  ,, U   0%@564@^4%@* 2 2 - - 6"4 @4 U  "  5> " -%@*`2`  `2`-- -    | U   /> "Ĕ `       <@֐ -    @ " >  #x` ` > L  &    < `  2   `  ``  ` " ``<" > "'l|' @ 'hഀ 'dt$ t@'p@p 'pp  >  ,Tl"@ @ pp* $ p` @t $t'pt*@$tഀ  @< "@ > hThഀ# @l 2 Lr>  LTn@ &Lr_ "Lr  'h " p "@  ̀  " $ Lr 'l |@* ? P 4jh  `|  "`6p  =4j4 $@5p2`  @   'l|@ ?PL "@XT" 4 `%@ vpt  @"jtLr 2ft@2`@ `2_t@ Yh 2Wt? I#* 4(Ԑ" " 6Ft*  6Btt2>t 2;t" 45t "0t ",t"  4 > !Ġ2`@Tl):`z   > 4 @4j t      .>  .>  ( < 6t଀`1$  // 7~~l   ̐ഀ  @At"@A $ t   @" t J@#@%t ` 2t 2t  a"t> P@B` "L  " " t;> $1> %> @ *@` *@`'` *@  ` *@*` ഀ F(Th B(t ""=(䀢 8 $`"`B 3  :    6*  쀢 ''`" ""`@ & *@Aa  (((>  #"@@ 'l ?#Ȑ(`> #"tLr  `2``l "`l@ ``X`P =`B ;`X #`P`H`D =`B ;`H#`DH /f * '   > `4` $ 2` $4$$$$ H 01#Ȑ -H /f * ' > # $$H 0$ ( $4$0$($,$<$8 HI #Ȕ 7'x$    $ `8``"$0 " ?$@$4 I $ H  $G 7'x|@ @@"} |@ ``h "`h "`x "`x" ``p "`p`t "`tH /f * ' ^  > `4` $ 2` $4$$$$ H 01#Ȑ -H /f * ' > #2 $$H 0$ ( $4$0$($,$<$8 G #Ȓ 70'x$  $@$$x`2` > ː#&@"`> Đ#ix  @  ?t  `@`$`2  24 "& hl 2'l `&  ' Б=`Ȗ B`C 88Ԁ&  , 2`<**` & > ` (@t@`aD @ "aDt `  `" @t 2 . *$t`aH  "aH. P2 ?p& ? I#* 4Ԓ"@ & 2 > 6 "@` @ 8  6  . $t$YА@a @] t     /+ // '\ /'/ ' // ('\' ''/'/'' '$'Ē @  2 `" t #\\@b 6ts t "    " LrLr@ $ *` 2`?# 8"6 @  @ (6 Lr  4 2k  $ " t `$$tഀ  h" 2@"@ $0  $>  `$0$4 "ഀ h  2:@> !Ġ2`@Tl:`֐4 " 4j 2 @> !Ġ2`@Tlk:`ۼ4 "  4j@"@ 4$  Th L> `  t @`"t@,tLr `"t`a@  "a@t "  xU"xQ`2| `t't*| m* *> "|``H `K 1'x ?ؑ* 2 2 , , 't, |@- `,   *  * *`@   2 2 2 , ,, , | H  @ 'xx"'dx 7xp J$ `(x|@?B A22 tTh x 64Ft > #x-xt@8$d`@  @t`   $ t@"@ 4$tԒ $X$t $tld?v'd >  >  㿘!8V!:* :   `:> C !<&V j>  * a  x 4 x> !Ġ  2`@ Q:`ڢV j  j`6 j㿐> > #\`( !   !> > #\`0"    >   " !> > `8#\ "В   >    "> > ##> `Ԁ ; <"`> cȐ < (>> ސ H@ "Hk@<㿘x P| C  2t "   >  #> #  (& > # `( `-& H /f * ' > #֒ & $H 0 $ (  & 6 & 0& (& ,& <& 8  2tCf t  "' N>  @  4 , 8?$ * 2 ( 2` 2* 2 + $ 2` 3  # *4`?,$ 0 $ 4 $ 8$  $  $ $$ ($ $l*  3 3 3 ,, , , , , @, ,   (4`>` 4@* <*@< $` 4`4`$`$`,` 4`㿀> "'   |`@ T P L X" " 4 !t `H@2    2 B  > #Ȧ   &2  < (. C &&2"  <& ``'` '`$'`'&`` &``&``&` &`$&` &`&` `( (& `` &` &`` 44 2 &  <`( 4`  (`& && * <*@ $ $ $  , !I=?#44 :4 T ` ,@,`,`,`,`   |@ڒ ؓ*`2`2`,`,`,`4  ` `*@  @N (4  ` `*` * 2 2 ,`,` |    @ @ 4` 4 @U4 > 4` "> ,`Ě `  ( | ϣ  > Ԑ X㿘>  ` W @b!&& >  z>6 p `6!(؎> !x Ȣ  ,`؄`` >ah{>   >  `&  >  | *`: *`& t6!:& |6!86!<6 l6 l$ 6 l&!$&! &!d&!` h!  &!t h!> - s> "- t% D㿘 |V h  `@6 h> ``  "` > `` "``<V!F 2@4 8㿘 |@H /f4 t* ' t   H 0 0& tH 0 @^H /f * '  t* & tH 0 @8 t  ?& t : ` !x#> `0bВ 2` x " tA t & t ϐW $D 㿘H / * ! >   H 0> `` "`㿘@  %> ` "`$` "@A @  㿘> ##@M> ? c`D "B`H /f * '  t "  H 0   $ tH 0   "` `B `#@ ` `  `` `` ` `  `?#@u s q? >5!  >  "8 `_> $ #  G`@ M@p  B> #W`  @@ 04> @ .D`*` &a"> "8  0#`> "8  A 3 @ 0 > #`##\ @o x> "`>' `  > ߪ. #  ? >5`!Ѐ R > "Ā`LJ>  `+`  #' '  "`D  @ !@!d두!`   t*@$ te> t  !h<$!hh$ t$!h$!l 4!p ]4!r"  >#P F>  `' *`'ܰ  # ;ܒ > `@ 6 `D "3 @,/!@<+ Ā&#`!c A 3 @@q   //7 '<# > ׹  h%> '@L  > b   //'#`> > $'''##\  @n  > ׎ 㿘 D & ` p`4 2  pp  p@2 `L ? ? $ `㿘 DR    4 |ޒ? 㿘 * 2  O   Lv   $!\ 6  4  㿘!\ @ !\ L&!\   㿘@P > \p  '@O`" ``"8"4  'HH "7R'L/Q/P@O $Ȓ (@ ' ' ' ' ' ' ' $@''@% "/'@Oǔ ('h'X '\ 'dX'`@O7h 2 * "@" >E "!\ ?!\@O @Oϒ " > ֙ > 㠖     `(((2 *`0㿘> #S > " > c  ?`  @ > > ""3"2́㿘> "a/  > > cȀ""̑*``6"2 P> b? * .  㿘> c 2>  @"c> c| 2>  "c|> c !>  @"c#x > a@r $#x㿘H /` * !  t@ `H 00 & t>H 0H(> |> `> ("#"`H 㿘  ? 㿘 " & #>  bЀ & `> b'H /`4 t* ! t  H 0b3 |`/!h * p@%!p7!r* !n+ * & t7'`(!> ߠ" $ > >#^ (H 0b j`*`:  6 j > 6 j``$ "`$V!F  < 0>  ``( "`(!8V!:* : !< : * V j>  * ː !<* :`@ 6 l6 l`$> ǐ 6 l> !Ġ 2`@V l:`> "Ā`"=V j |"9V jV h 5V j 3 @ |`"-V j " !t 4 "!t L 2 V j!t` @  //(' " V j L  $ L xV j $  h |!8!:* : @6!:6!8 h&!0?*  2 !&  & >  ` t 2  & t ! 8  p2 @ ( B&!  t!@ &!$& & t 6 nT`"TH 0b > ԡ ؁㿘H /` * !  t@   > H 005``, $`,!8V!:* : !< ;  * V j > >  !,ㄠ" >    `0`$`0 <0h . r. rH 0㿘H /` * !  t@ > H 00W``4 #`4V hC  | @`+*> > #  > > !, "@ @.`8`#`8 x   ? L 8> !> 2`@|:`ؐ0 > !> 2`@{:`̐ 8H 00<`"<w #>  !,"@ @ > !> 2`@|2:`у P0YH 0DHE E<EHHH(HXH|HJ,HHIXIIGOpOpOpOOOSSU(U(SSU(U(U(T(U(U(U(TLTT㿘@㿐 `  `  @@l   ;[  0H /`4`* !`  ` H 0` ` ;7   D h`d.`>" € _ 8@J [ ` " `T` 2` x4``M D h!@h]EyA >   h!@hM i  0  -4 h  C   2  2  "  "  2 > 2 >?#@2 > `< @8 '   >  @h 쀤 @i?! < 8 ' հ  >   ̀  ŀ  $ xx 7` 4` t`"`PL$!P`PO1> !> >  "2` P@  4 hۓ:`, 8$ $ $ $!$ %$  -@ h!|0~`  P1@ |0`  v er `|P]i 5d`&HH 0n `H 2`` @"R `!2N  !D  H  D #&  !E>*@ !D :,!D`|`"@``" 4 `|9* 7P`|  , r $ , r h!@j,   h!@j<  >  耤  `  ,:`  . H 0㿘 H /`4`* !`  H 0 6 9DЀ D`  @` ` / @ tH 00i  Y *>'S *"P  (L ` t D$ t ?A$ t"?  (: `$5  p@41 /4 p"-  () T h 4%  t$2! `"$ $ "  8T h  $  ` t$ $$ t ;$ t*8 0& 8, ' " "  t *"  *  "@ p "@ "@ t $"@H 0㿘` > `P  > > >  O !> c ` 2 2`h` ? 4`` 7 4` h!  "at 㿘 |V h` @D   T    MQ, L@  㿘V h`>"*` €6 h  6 h V h  |Mr`@V h  > !> 2`@:`Ӡ P$`> "'   @ ␀   @"  ޔ" 逢   ؒ @|ܖ Ȓ @|Ӗ   | H /`4* !逢   `> #w> '#' `" `D"  `@ `2  Z 5H 0>> `a  "a`> #  > '# ` `@  ?'`@`'?''H 0"&@J" > } 㿈` ?`r>#*` € >   o   h  > Ò!P @^   V   N >  b E1>   ' W 29 @&> " < 2-& 1>   ' < 2 @ > "Д ! 2&  >   *#\ \lpxmpnpo,ppp,ppqpppppppppp㿘> !d> g#܁㿘@@!> > b 'L'P'T'X'"'H   2  '|   0%  /   /Ѻ  `@ =   @:> !    `` "` "㨀 $9`〤  ?#"@4 "`` "``" @'`'`'` '`'2 2  2 ?#@    ?#@ `  "` @xd* `46` "`/  ( 2 ?! ``("`(6"`b @I]* `6`6 "vb& `( "`(`  "` > "t`9> "x`6 3 " 5Wb 7–  9O 2 ` D"`Ȓ  8U> Tђ`"T  2@ 1bр0/@G  //7`  @='//7`'А@2  //7 @z @%//7 @z`  `<` 8  > `А`'  ʀ> #ܒ#܀@  `h!2`>`h!2``>@2`"`8`, `,`0  `,`4 `,`8 `,@k  ``@2f`"`(` ``  ``$ ``( `@L  ` ` @2G``<@2B` 8沔 5  0 '|`h@|@V7 L|L0 4| 4`   "` K   '|`@  "  `#܀@j ` 3"` '|`h@|@7D L|K J    !> #' ` '`#'ʖ`B`$  "`$#ܒ  `#'_ `* "  c` " 6  @  b'@ '` '` '`  '`6b = H o *@ g  ( @  є#\x @ nx`" `H 00R`@ `M @@ V `Ā 2`ѐ@u   $`đH 00q`` 2 `!x "`"`!x` "``Ȁ 2 `!t "`$`!t` "``̀ ! $`!`  "````"`"``"@$`H 0 '|`h@|@` `h 7 ` @2 '|6;`@| LJ `@Iݒ L`@ b  b`  "` 3| b3b > ~! 㿘 2    s `& $ $$  㿘 @2 8 @I L @    @I |@> ">'#`ƨ ` 2@ 2␀ ? >5!    > "8 `␀ @` '`'`  '` '` '`''Ȑ@w֔ ␀ "`  @䝒   // ''' ' @o'  `@'`'`'` '`'` ''Ē@w R␀`C@ J@h  4А@_   //``'` '`'`'@n' @wv &␀  #> 0c܀@ @#\#`cܒ@a> > $#\#`#ܒ @a  > ~!0㿐>`Y#` U@ Q` M K> ߐ#. ?򀢠 >5!Ѐ  0; 2  *  > "Ā`> "t`> "x`"  2 @e 0> ' '#n `@   @0> #ܒ x h 'X'T'H'L'P  > i!@? #@  (  (  8 8H /` * ! q " H 00 2  9``' 8# `  $"    ܐ"   "    & &  2  S 7     & J 7  @>  .` 6`  8> &`  (&` >6`D < 6`6` /  & ` 3 *``2`  2* 22  + 2`3 ?# 8#6`6`6` t> .` m.`,`", @ H  0 %#\Z$ 8$ hH 01Z1U㿘@㿘 `   h! @b 3- ``2 `.`>!` €  H /` * ! > cH 0` > > !HLGR    h!> . s> ". tH /`4 h* ! h! @^3NH 0ŀ  h!") (   8   $   (  H /` * ! @_DH 0`  8H /` * ! H 0` ER{  h!" (     $  ( d 9H /` * ! ] h! > $#X#X` $ ,`$ 8`$ 0$ 4$ 8H 0  ?>6 F8;  h!@/;4EC@2$  h!@`} Ӓ  h!@` ג   - -> b!` 00 㿘H o*@ a H 0㿐` @  > Ð! @   *#\ > !P. 㿘@x "   2  2&  7&  h  $ h |/ @L$ | 0 * @@ ``@2} @2`@2` ! * @݀@ "> #4"h > e  >@2a > !`> Ĵ! @ > "਴H Bh > !> # *`   Ґ  >  @/a6 1 < ǼH /f * '  @ `/C& ܐ0 &  2" && &H 0 㿐> !'L'P'T'X`'H/0 H / ` /㿐> !'H'L'P'T`Y'X@ 7 S 1ђ & h  &h |@&|`  ``*`*`@ * ` 222.` .` .`.` @ *  @ 1 r ``*`*`@ * ` 22`2.`.`.`.`.` `}B*  "@.0S. ** @ *`@ "* " @ "& `"@6` "& @6` `@A$*`6` <> Ā`!̐  H /f * ' `` @ ``.p&``  0 & ` 2" &@`&` &`H 0>   `؀ 2 2  2T" 2ؐ 㿘`    *0 > !> ޘ!<㿘`    *> ސ)!㿘> "(` '> @A $b(, @8 $,b(g   , ,   ?& 2 P @  & ,B @ > "$8   @    @%@ @ @ 㿘 l@ ` lw  l @ `;#@ i  (! l?#8@8N dL ?@ʒ&@ (BH /` * ! @;H 0 2)@$ @! <!$ $,! $ $@,!> "`>  $aĖ ;`  $ $<  (  '@ 㿘%>   * @  2!2@!@* 2p> "> b  ' d    * @ '!2 `" $ 2  $ 2 ! !@ 2  @!$@    2! 4␠А@L  /В  * @ $!2 `" $ 2  $ 2 ! !@ 2 !% "  2! > z!㿘` !x "< @ 4 !| "1 @ ) !p "& @  " !!t " @} " ! !@v 0 2  \!@o 0    㿐#> b` d+ ` + b* @  !2  $ 2  !@F 2 #\    2!㿐#> b \ `+ `  b * @  !2  $ 2  !$@ 2 #\  ]   2!X!> " > ߘ!06@Z @> "$ @",`   `` 2`*` ` @ " > "u )> '> %>   " `08f`` 㿘> "` * > "$ $ b,`@ ``"$@@       "$"$@b㿘 $  @[ @(㿘 $$   ̀@@K @㿘 $  @@ $ & $㿘 $$   ̀@@/  $ ;& $㿘!> "$ K-$"$ L* "$ K  E* "$   K>* "$`*`@ܙ"$`@ܔ*`"$`@܏*` 1> 3> ;5> "*@ !  !* @$%@`2b   ! !Ր * $ %`2    !$ !Đ * $ $`2 ("" Kb K&" &b K& 㿘H /` * ! > "'> `')> !> "$ K  Ǒ* "$$b`*` K "$$`*`  K"$%" `b@*`"$`@*`"$" `@ *`!  !m%> +b+ @ b > b$* *   b8 S!b+  &" !I * !$& "!@ " * > & "> ; $;apH 0㿘> "`f! !H *  b*  2 #> " !$)> '> +#> !$)> '> +" !2"!& b*  2  " " !2 "!ސ " *  2  "  2 "@9& ?$H 0㿘  K"@M"&""&"&!!&"&" " &"> cc: > >cА (q>` @l>`D Xg>`t pb㿘  "! @& ! ( @ X p`"`&""@"!2 "`"`&""@""2"   Ā`"`&""@":" 2 $ {]Q& $OMK! "!@ &!! "!x@&!!x "!|@&!x!| "!p@&!|!p "!t@&!p!t " @&!t `" ` ""`  ``""` K㿘> > "a@ .`2 @` `@*@     @?    > ؀  > ܀  > @   `  -`` ""`` "`"``"` "`  `` ""`` "`"``"` "㿈#> b0' `  `" *` ` !> + * $b0>  #\܍@b0*` . 㿐 ``  1>  '@c "P " "  `?2  2   2      㿘 `4  > V "p   ? &  㿘H o *@ a     >  `$;  ;`#`$H 0㿘H o *@ a     >  `$; * ;`#`$H 0㿘@@2  V ` @   > !h> \''t &    ?&@9 4@5 x@1  , 0`,`< /&   4,  )f   )a  )\ //y//x'| '   24 @ _ )D )?0?>4'Q  L  4,  )-  )', )"  //y/ @lO@lK (  24* @ " ). )004,a20#\&#`b2  A`"8`  8 ?"8 Ab!  `?"8 2  A`>"*` €ߐ A }  "   a ?0 > $  c > $ "  c @  2 a  a  " h  d 2  l 2   p 2   t 2  't  $   Ā` "`"  "@$ ` "  ?2 `2&@٫ | 2 x&#> 9ap  ap2#  ( @2 Ā` | @ي 2 Đ 0#\     ? Ā`"  "` "b  "$   < ap 4ap` -``> ##:`< ` |  0#d#\#`    $ $ " $ "" "b&#\#` "`   &` |t   `@C  ?Β |̒"M  π` |a$@a$ 2@ a@2;  "  a|`"3  ".  "  ax`"&  ! " $  Ā` "`"  "@$ $ b $ b"@'b&#\#`"> @2  Đ$` |@ض $ "@  Ā`"  "` "b  "  < $ > !p @ )!p`  "``> ##:`< ` |  0#`#\   Q  $ $ " $ "" "b "%   0 =&  7& 2?ꀥ` |t   `@| #& ?ꀢ ` |t   `@g #\#`&@ & > " > "ȁ㿘  ? & S  2     0 a  "  Ā` "`"  "@@  ̀`"  "`> "!|  "@ "  "  " ~ "> x> !ɒ > ah?"ah㿐> b8  !>  "b8> bؐ!#\ ؔ   ! % @      2& . . . &  & > ax ax& x "`А "`"xx& А@㿘 0 (@(`(`0(`1(`}(`a% 0f 0`0`2 8? ` (< `  > 0` < 0` @  `<(`0`B(`@(`4(`|(` `80`D(`` 8 `d (E `0`0`2 ,1> $ ` 0# `  4< ` 8  `  ` ` $ `  ( `$ >0`* <0`, @ # (`( (` `8 `< `@ `D `H `L `P `T0`\(`X(`4(`|0`Z(`` , `h 0 `l 4 `p 8 `t  ` ` $ ` ( `㿘  `"  "`> "!  "@  >  ` "`"  "@>  㿘 " @@  2@ p  w  > p b<  #>  "b<> b`#\    ` Y @ {  >aF 0 , , !, P, Q   "]4 "`4 "4 R , $ 4, T 8 "   | ' ' ' ' ' '' " ?$ ($ ( 8$ X < "   | ' ' ' ' ' '' "  ?$ ,$ , <$ \ , 0 @, `  ">  4 2 B4 b 4 4 D4 d4 R , $ 4, T 8 2  < 2   @ 2  D "&  2 | 2  |  2 |  " | ' ' ' ' ' '' " > $$ ( $ ,$ 0 $ 4$ X$ \$ `$ d$ ( $ , $ 0 $ 4 8$ X <$ \ @$ ` D$ d H 2  L 2   P 2  T "&  2 |  2  | 2 | $ " | ' ' ' ' ' '5' " > $$ 8$ < $ @$ $ D$ h$ l$ p$ t$ 8 $ < $ @ $$ D H$ h L$ l P$ p T$ t (, H X, x X ">  *4 J Z4 z ,4 L \4 |s" > !> $ > a` $ `""`$   $  "& $  @=㾨\> `  '`; `?7  ?& `? 8` `? 8 ` `?  `Ā 2 `a  $` 7` ( `2`? `a ࢀ@?a$|@ a$ ?`Đ0#\ଚ ఘ U 쀤ؐ?`Đm `> `a ࢀ@> a$|@a$ > `Đ0#\ଚ ఘ 1 Ȁ> `Ĕ!p !p@8`2>  > :; `Ę  0#\#`   | ?`Ę | `ؖ?& `  b਀ q`Ā #> !p @ 1!p>   +:; `Ĕ `Ě0#d#\#`| H#d#`#\ 2   p N਀`"Kb`@F &Cb `  8 %?`Ā  x  $` 7`Ę | `\ &?& ?  $)  2ਐ u& $  , ( !|!* b > Ӑ"> "  22 㿘> "@`` , 2 > b` ! "`  0!@@! 㿐> "@'H'L'P'T`'X  ,  H>  ` " 0H@ 㿐> "`""  "h2   "X(  ( : #O [" 2    < @ 8@0?2   > 0  /  * *` 2 /җ#"˒  "` ="0  "2   "(   (` &"(0  " "` "`2    > 0B  @K* 2> 0  *`*  2 / @K 2 0 * *`@ *  * 22 2 ` ,,,** , *`@  * 222,,,,#  ">  T 23 > "@`->  `"* ` ""`  ` 2 ` @~"  ` 2  `@Ŕ  "q"  䀤``2`  "" :` B3  ;` > 0 > Ģ! > "H Ȑ#< > Đ!̀@  ДH /f * ' `` @``W$`"`  "` H 00-& ` 2" $@`> #ਠ  ,@ $`$`"਒2( > !> # *` | 0 "$`)"$0 | H 0㿈   a 2 `/`"a0da%  > a( a 2  > ,`",& ``' 8# `  $"    ܐ"   "    & &    <     & < * @ *@@ $ > 4  4 , a($ a $ 4 ``  }  ,   w   4    l )2 /, 4  /@I,  2a%a 2 a%a 2a%a > a% > a, 2 a0 2 a4 2 a8 2  > ,`V",& 7??  ? ? 2* * ? ? ? ? 2 ** ``' 8# `  $" ' (  ܐ" '  " '  ؐ (& &  (Z        (& 2  > b` 7 "`& `,, , ,  > ߐ?ؑ* 2 2 , ,  Òa$,   @b  a @b ` ` )  , % (  )2 /,  @H/ *  *`@*  *  2 2 2 , ,,  , > &b`( / 3"`(> "``#`&a  `` `?쒂B>` `?쒂B;`a 2 `` `?ؒB>` " ?ؒB;   "   㿘> ?#0 ^㿘`    *> h"@0> "> "D>   'L`'P'T'X'# 'H  , 2   `*# b "`$"b  `  " ` 2 "  `"b ג В"` "`к@΂ @~   2``` 0$    ////     ////  " $"@ "  @ :C  8   4 @6   > ܐ"H@Ŕ   !"6  > #p`%aĀ`"aaȀ "a`T A  @Ϧ 2aaȒ@ϟ 2a`@ `a`2aĀ`2 `<"`f".b Ĕ  # & ` &`H /f * ' 7EH 0 "`9"b > ##X㿐a%   > a   > a% `@ > `` (  ` "   1H /f * ' > "y  > 4````$ 2` $`4`$@$`$`$` H 0`2  > `"Ѱ 70{7#֒ @4` ?$` $` ,$` $`  &  6 `0@`$> $`$`$@$` b`#```(# ; B;`(a    B/`<* @ *@@ $`> 4  "Ò a, , , 4 4 4 a($ a $$ ` a `*@*`*`*`*``> ߐ?ؑ* 2 2 *`*` *`a"`a"`a"` a"`$a,"`a0"` a4"`a8"` /4/ i& 㿘`    *> `"D`> "' 2 3> b`, "`,> > cP`( "`(`(` "`  20 3> b "b> cP "cP 3> "H` 3 l> "L` l2  > "P`2 N "  2 2Ԁ 3> `( "`( 3 l`   А` 'ĐТ@b /р  0 /А  0 /А  @_̔ 0 2 3> b2> > cP`(` "` .H /` * ! Ēt 2 $H 0 2 3> b2> > cP`(` "` `!`H 0o 2 3> b`4 "`4> > cP`0 "`0`(`$ "`$n @2 H 0K> b`\  Z"`\  2 ! H 08 2 3> b2> > cP`(` "`=  2 Ȁ l> #@&   ̀@2# > :< '  ܐ ' $` " _ȒҐ @  ̐ ' $d" _rȒŐ p `H p@ > ֐#h8> "> ' :a >`a`2`3> b2> > cP`(`  "`     2 `2`3> b  "b> > cP "cP`( "`( 7    `*`4 @,04 4 `9' " `2`3> b "b> > cP "cP`( "`( UaA  aD` aA   d`2`3> b )I " 'S`2`3> b "b> > cP "cP`( }"`( (aA aH aL  aP aT ВaH@J  aA   `2`3> b  ' ( 2 `2`3> b "b> > cP "cP`( "`( ؓ*` 2`2`** Ɩ ; ) " ݐ`2`3> b "b> > cP  "cP`( "`( aA  aD` aA   `2O`3> Pb )W  " '`2`3> b "b> > cP "cP`( "`( (iaA aH aL  aP aT ВaH@˙  aA   i`2`3> b> > cP`L "`L`(`< "`< 0 a l+  $!G  aF`2`3> b  "b> > cP "cP`( "`(|  t$ a *` `$ !:`2  7 `2`3` "` $6 ` " `$ (2`$   6 `$ >   6 > #| `''  @' H `302`3`l`20) 0&@&@s"@4`l`20 0@@ @M . > #㿐@  *> #\"T㿐@  *> #\"d㿐@  *> #\Ր"l㿐'L'P'T'X'H   3, 㿘> Ė!̑H /f * '  @> P `""H 0G' 7&  2" "> #"` "" *# > !> # *` t 0t H 0 㿘 `  @  @ 3㿐'L'P'T'X'H   2 㿘> Ė!̑H /f * '  @>  `""H 0ܐ' 7&  2" "> #"` "" ) > !> # *` tJ 0t# H 0 㿐'L'P'T'X'H   lg 㿘> Ė!̑H /f * '  @> ( `""H 0' 7&  2" "> #"` "" )^ > !> # *` s 0sɐ H 0 x> "' da> "Ā`]2` 2X2`a'R <@˒   //'r' H /* !   $ " 7> H 0(5>  $ @ H 0㜢$@ Ȑ  $! ڐ# p> "''\b@h Р  '//@^  //'ԑH /`* !  輖 2 /#+> )> ! 22%  $` 2  !@˒ 2 !$@Ē 2 @ "  c$ "Ȑ  $! n# 㿘 `  @   2㿐@`'1 `('  (%>  5 3 *  *  4@ǗȒ@ & > cP! "cP= $@  !㿐'D 'H2 > !> > `!D>  ̀ D 4%> H 6 ``B >` "D!`0B:`0* @*`@*` DH>   `B :D 㿐@`'1 `('  (%>   3 *  *  4@@ & > b! "b $@ u !㿘}㿐@`'1 `('  (%>  v 3 *  *  4@ؐ@ & > `(! "`(~ $@ 6 !㿘>㿈a2 > "H`3l> "L` l2`> "P`` 2`$L$ A a  ``̀@#> ':>````$` '`@Y```$ '`pY2`a " " (  " 7 ` * a 2  0`$@+``% a ``@2`a a  aa aa "p`a@  "j`   " 7  @  `4`*`@&N4` 4`  ' ( " 7 ?ؐ#@( z ?ؑ*  2 2 ,, w 쀢` "   쀢 `\'a 쀢 '쀥 "`$  L  2 I 7 ` 4``$@ &`$``@:6`@1-a  "  ( a  @ , a l2`   "@@  > (D`"D@ @ 㿘> `$;  $>`> "t`H> bx Dbx  N  L  22a 22 > ?22b`X "`Xa  " 0#  2`$"!`$ * `'?ؐ#@ ?ؑ* 2  2 **`$@ "   *ϐ> `$ @   $  a.  n a *` `$ Ő``a B a        S      @0  a2"`3?07?04`$& !`$a  2 `2 ` `$   ?D  a " (0 㿘H /` * !   )> '> #&@ Ȕ  " ? '"  E ",>  " >   >   >  ">   >   >  "  ! !> !!(!L!p` *| `8x & `  $ @6!*`2 6! `"`>! *` €> "$>  "@>  "\> "x> "> " @"& K   & &!d`&!h L6 * {2 &!`mw @ $  '''* ''   L 6 * {2 &!\mW @ $ @ * ''''   @K " > 7 @㿘!\ " !`@ !\}$ L&!\!` @ !`} L&!`@K   > 㿐`$` `a a `   "@` "a ?@" a> `"   4`$@21 є  aadah@y    " 00 ސ> b`  "`Ր ѐ> b`(  "`( ##`# ; B>` > """ : " 8@ B ; 8`$"`$``@8`$``@ @ˢ o `$! ``@8` ``@ @ˊ`$ ~&`$ `  2 @N+ `x0 0 Lz   i@M`P 7 o"`P@ 0`$ ,$" "@" ""@"a\"`4*  " "@! 0 $ >! $$($$` <$ $ ($ $`a$a l , ,@$@ " $`a%@ $``$ @` aa '  8* a` '`  $` $`a`$``* $`@ @Lbp> `  `b '`(`$`, L{͐@Mf> b`P  ?"`PH /` * ! @` ` 2 `{ L> b`  "`  #@@ b` "``   " o @²`0  {s L> b`$  "`$  {e L  -$@)ԐL Ԓ dh@  >   b0 >   0 b`  "`b`(  "`(@Lϐ$@  fР  > "`""H 00j2    25  "0% @ *! ( "@   " "@% $ "   2$  " "@%  $"  j "$  "@%   ˖ "@ > " `" H 00$@2؀> " `" H 0Đ( ِ`B ڐɔ ҘH 0␑H 0 @L" >  P㿀> ¢#@`<` `@ a `''$'('`< ɖ`$@a " @֐`@Ӑ$   > b 0 $ 0a  @?@#@ C H ( R$ H<b` . J"` b`# ; B>` `@# ; B;`@`$ !``@8`$``@ @ ! `$! ``@8  ``@ @`$ ~&`$   "    8 @ $  "   8" 沔    `b` %b۰ 7"$@   2 ` b 7 %b`i `$@2ad'`&ad` i`T@c 2`$ 7@   ,@  &ې*Z  2/ 〦 2 @K  hCb4`$'  " ' ' a%' `$ @ 4alaba iAa 6   @ 8* a &   ' ' a`' `* ' `$ 0 Lw[    0 (@Jb`P 7 4"`P@`aa$,  i   >! $`$`$`($` $``<@$ "@$ "$$a\$`* $`$ @@ @I\㿘   Lxϐ@Jh> b`P  f"`PH /` * ! @`ߪ ` 2  x L> b`  <"`  #  @< H 0@I4x L> b` "` x L@J! $ @! " o!ljH 0H 0 z@I` #dd#``2+   "@ : ( # " @ >   0 2>  ( # (  (#㿘`O``   "  *  @ 9  2   !    *1 H /f * ' > "   > 2`` 2`"""2H 02&  0  &  & ` $`  h>   b'"$> "> > L > H > > > "$"@ "\ "x "> "> "̔"  ` $  &!d& & &!h  L6 * u2 &!\ gȐ@ $   *'''@E b > d `㿘!\ @ !\wQ L&!\@F+   > h> "`'`q <"& &> cP 7 /"cP ,,4  44 @  @``>  ` 6!@ "9` @*  @$ @@`4 `&  @  ٲ@@@ `Ҡ  ?f  >  #f@@> & @ΰ Ȑ   (̀  > P` "P ('/ϐ А ``/ѐ " 7Ҁ` ѐ  `7``  `   7   ((  ؐ Ltɔ   > P` "Pz 7 ( i آ (  ΀_`+K@`<`0JI@  * 6;!> @2*  *  #P` \$#P6vB L?   `> #fB #P` E$#Pv+ L(  * & @ * v L> P` %"P    ( -v L " >  h㿐`$!`'D    ޖa "3 `$2/ D є  aadahy  >   " P>  DP 7D` "0 ԰ 70P  7D` " 0*`? > P$ D` "$0D> ` `""B>``#P 8""@ B ; 8`$ !``@8`$``@ @ę fD  0y`$!``@ ``@ @ā`$ ~&`$@G)  D v 7#P $0"  "" L"a\"` * " s  D Z 7@Fސ#P`P ;"`P@ 0  0D  )@ D>   VDa   'u$ L@FD `>$ $ D $ $ (`a$ <` & (a. & $& e& ,@E@> "'  (` $ , Lt@F> cP`P  "`PH /` * !   2  tՒ L> cP`  "`  #@ cP` "` @FG$@    @  0 @В  t L> cP`  "`.     p  tu L  .$@+` \  dh  >   cP0> y 7cP` 7 o"`cP`  7 i"`   > #P`"#PH 0Gd  2    Ò   ;4   *# ( "    `" "@$`&  "   2& `" "@$`&" @ @d   "@&  `"@$`H 0"H 0`"@Ei" > ͐ 㿀> ¢#@`<'D `@\ a  `'@`< ''D> #P ,`$ ,ad 2`$a  `$@ D   Z$ `$@  a  2DD? c   (P`H ="`H .P` 6"` `# D; B>``P`@# ; B;`@`$ !``@8`$``@ @` -DZ 0 `$!D``@  ``@  @H`$ ~&`$D  $  "   8" 沔 ٖ   `P 7`D!$P0"'D$@ D  U  2  D 7P $PD  ?2 , 4 `> $ D  `$@ad$ `&ad@D  DD 7 P `$""`""a\"`* "`$@  00 Lp   DȰ 7@DLP`P t"`P@N 0`$ @D 3D  0a  " 3 2 b  7D  4 b  7D  3* 0D/ Da $   rf L@C0*/D D `>$`$`D ($`$`(` <@$` $ ($ $`a$a bP, `$ @@ @B㿘   0 ( Lr.@Cǐ> cP`P  e"`PH /` * !   2  r L> cP`  ;"`  #``@<`H 0@Bw3q L> cP` "` `$ @ qݒ L@CvɒH p@H 0ڐ@C^> ""_  "/G/F'/E@U @ a"Hp @  6*@ ?( @ "@)?@)N @G@)J F@)F  `a@)iPTEH L &#<@)2 '@ ?@ '@ `  H @: '@  2@@) 2   ?x?pp't |'x'' @d  1 0?'` 4 'd 8?'h < 'l7b `2 `@!  @  6  `'pdh'tl'x'|  2 0@(ǔ p @  j*@ ?( @  >  0#> b'"ؒ` ` @(@(˒@("@( @@( @(b > ސ x#> b'Ҕ@ b > Ɛ ȁ㿀> b'H /`4 * !  > ®    `  L  L @ `` 2z `2 2t     A3 € " `<@`4! @ @ `v     @ '   ``<`?`2B     $  >$    @ `2- " `4!2     @  >" $ $     @ؚ 2    $ @50 @5G  2oH 0 >   㿐> > "'H'L'P'T'X` B `㨀m:  X`" ` `B a< > `  > T! " ` `B O< >  ` > (!8͔ @> `.` `$ 8` `B 4< 8>  f` >  !X(&> 0 2  `B '< && @H*  "  (` `B < (> `@  > !x`(> !00"@& @ 㿐> #>  ` B  : }0  X`"  `B :> `   > !W`(> T!0b0 "  `B :>  ` > !8(< > 9!0G0n  @`$@ $ 8   $@:> ~!   2  8` B I:8 > `  (> > ` > !> !003@ $ @& *  "(` B :( > `  ( > `  > !ג`(> Ԑ!00  @" & @ !㿈  L`L > ` > "\ 2"@ >  T A AH`B G:HI|  h $ h  |@$ |@2  > 0`B :0 l> $ lb ,> ` 6 (@> !2` > `` > @`B :@ l> $ lb  >  ` (> f"> c!0q0`` + ` * ` * `  `  `+`*` *   @ > B |"l<"x$"p '"` 4"`""`*"@ *`" *  *  & : '`*"@ *`" *  `*  ' : '"H ""> > <  @  耢@0쀢@,#@@ Ӓ @) 9 0"`  "l* @@ '쀢@0@0@㿘` ?  > . "  *㿘> "㿘# k  "M @N#?  $b\,b8>$bp$blbc@$bL$b`$bhu$bd!>ϒ!\cXp!\lcp >  $c$@`(> "0?a>Ґ#>>Ԓ`     %$`4`T$`$`,`X,`Y,`Z$`\$a$a@$a̐`<   㿘@  ~mS 㿘c#@a#X_#p"L > b|?"b|"T &"L> b|?"b|&"T@   T 6 T@c @H /f4 L* ' L   e! L"@` L"D"bD"D$ "D"@"  $  L  L"`Lm & LH 0㿘 L "@ 㿘bp " bx> :>bxbxB`B >bxbx 2`2`2`. . . .b|222. .. .̒㿘>  `!`L`"` `X "`@ "` T A A2 "@"H 2"@@ "@ 2 T``2`LP> b'H /`4 L* ! L   t & t"P  &"P > "|`"l"``  - "@*`" * *  ' : '<*@ "_* @@ '"d //ˀ///7ΑH /f * ' > "ߒ  > `4`` `$ 2` $`4`$@$`$`$` H 0`Ԙ 8``ऐ"$`$` 4`$`$`<* @ *@@ "ऒ 4r,4  p4,,  @4  L / 2 H$ $ 8 $Ȓ[ $ C $` $`@* 2 2 , , ` F$` p>   8& c& pX `B h`B  > ` i (> `d > "> !0 t"T c & t&"T"T 2&"X> b|  "b|&"X"T $ &"T"X  &"X> b|?"b|&"T"h H /f * ' > "   > `4`` `$ 2` $`4`$@$`$`$` H 0`2 ` t>  & th`B :h L`"4`$`  ($`$`@$`   `, p,,@ܒ  L /̐  0@ђ  [2    (,,,'Ȓ[' $- k $` ($`@* 2 2 , , ` E$` p>   L& c& p` `B <`  "4@t 8 7> h`B  > `  (> ` > "0ے> ؐ!0 t"T c & t&"T"T 2&"X> b|  "b|&"X"T $ &"T"X  &"X> b|?"b|&"TH 0`#@ Dk| > "H㿐H /`4 * !   `2   H L!'Ug]#  2H 0㿘H /`4 * !  %>  `2   L 0 @w ][#  2H 0㿘"'`(#<."Ṷ`/ "#8/`"+``* (@`  6 &(&&6 & 6 &(&&6& 6 &&( &6& &  TAA"@"H2  "@2`HH"`2 ߀ 㿘 > "`  LLɔ & |@$   "H   "H   㿘   ""@ 0@Ҕ  2   T A A2 "H    "@ 2  㿘2` "!@"@C 2A @ 2= ` 29 ` ^25 ` 21 ` "+ 2( ` 2$ ` 2  ` " "  T A A2"@"H 2 "@!@s  "@ 2 T 㿈  LY1 Y-   # 7@`!沐 "ؖ  " b@`   `X  2&  `<  ``h`&`h˒ 㿘"H  > "XҒ (0@AJr@  㿐 L 2  T T 6 T@ 0t "\  "d 2"L"h  "L  `@6 T 6 T 0X"H   "="`0O@u ޒ Ȓ 0E#@"`*"@ *`"l" *  *@ *  ' : ``'`#p"d#X " "h#XB>O"h #pB5F0*"@ *`" *  "l*  ' : '#@B 1㿘! ?c* "4 @  !,`2  "a$*  @%5  "$`"`"@7 `2$@㿘 L @  ` V`T@2`X 1 2`L  2  f@   7Β  g 0$` $@$`" L"@\"\@ @ L ""d"d 6 "h@l `tgʒ 0p"h `@  `g m0`2&`L$ L`L" \"\@& @2"d2 @$"@"@$"D"@ "`$"@"@"bD"@"@$@$"D ""d 2 T"h  T 4 T@&H /f * ' ` >Ԕ $!@PH 0  T ?4 T 㿘 L ""_ X 2"_"\ @?:: .!.!.!.!.! .!ɒ ^ .!.!.!.!.!.!!<!  Y`W< 㿘  ` @   "``2@"d&&"d"h;&"d&"h> !,8`  2< t 22"d!@ X L "d @"d  "h   T 6 T@   㿘`  L T 2"d@ "d  T 6 T Y > !,   @"< `X "єH ~&!԰ 8!@ X8 '_  ' 4 $ &!ܐ , ,   7㿘`  L` > ` > ` >  T 2"h@ "h _ T Z6 T> "``( `!  ` ` (`0 ` @ ""X " PT2`" `2߄ `  L`"` ` @& 1ڐ 2  L " 1"h 2  L@ ""h L `&"h T 6 T@   h> "'В @j"4< P   ///77ؐ@5̠ ,@S  P ' 7'/7ؒ'@4 2&"4@5` $ ` "`"<$`$ ` "`"`$`" " > "X> "'>  !2 @  !@ "R"H8!1! @ 0@  00!@ "m! !@ 0@נ 0     /0 T  6 TUI T`6 T    /0 T  6 TU2Oנ T 6 TΠ  `&#@$#X"#p"H 2  T T  6 T&"Pg T 6 T@Ւ `  T`t6 TpQ!b S 4 O     2"H`    ې#@@   А̀  4f  L "&"\ L`  @"b@b\ "Y b@`@&"\E@q ?Ԁ Ѐ`$ ؀`4A  4> &"lР?&"`ؒ"T  3   0- 4@ L``(@2 "H'"\'"l'"`'o!b 2"Tg S$ 4 @}@Ґ > J"㿘 L  "H  A  3㿘"H `&"H`2. [. [=㿘 X < L 7#>  L `[ "L`T 2 T#@ 6 T#X#pԒ  &"L( 2"@b|  $b|*"@ &"L b|?$b|"@ 2 L㿈 L`R  4L! b   `A /!$# $ @   @  2`S# $" $%#` a1 2 `""`"@c Ò㿈L)  ` @̀`@  2``@  2``, ㈀  2   4 a2 `"  "` "@c6 0㾀>  L b`'("`('`,$`0$#`4 $ '   S`2`"  "` "@c # 2 " > " h> "'  >  > #<#Pb& & &!h $@  @'Ȓ@1& b > Ґ"㿘@1   > 㿘` @4   0͐3>  L`  (@R 0`$" >Ր" ""$ ,#"  " $`$`($`$`` l<@$` `a$$ ($ $ , R @3 @4!> `(`@ 7 "`@㿐   ( $ Lbs@4 > `(`@  "`@H /` * !  N 2 bU L> `(`  "` `#  ; B<`> "  :  ( (@ B ; (`$ ``@8`$``@ b) L @<  `$!" ``@8  ``@ @&`$ ~$`$   #``@<`H 0@2za L(` "`t a L   @ $Β b 7 2(  V$(  /b   5?1$ @ *! ( P"@   " "@$$ B"   2$ " "@$ $"  Q  ?$ $@3* ۹ H 00H 0@3 㿈> ¢#@`< ` @ a `'`<'Ĕ > `(  $ a  "  0 ?# @$`0?`#@ Q 8 ( $ 8J(` . "`# ; B>`  0# ; B< 0`$ !``@8`$``@ @%   `$! ``@8  ``@ @ `$ ~&`$   "    8  $  "   8" 沔    `(`$(C 7"$@Ӑ@2  2`$̐1( "  0"@"" " L"^  @G 0` $ (a$, aP  >א# $`$`($`$`$` `@1<@ @2"(`@ 7 "`@㿘  (" L`t@2 > `(`@  "`@H /` * !  O 2 `V L> `(`  n"`  #``@<`H 0@0e`7 L> `(` "`O`- L @@1H 00G m  2  > `(` 7 -"` @`4  a   > `( l , *  l ,* ` . "`@1ܒH 00H 0@1q㿘@`(`(`.  @` `(`(`.  ``` (` (` .  `` ` (`(`. 3 ` > ?> ??` * `(` (@ @. @1 @( @@  ``@  ` ` `  ` ق```(`(`.  ```(`(`. 9 `> ?> ??`* `(`(@ @. @1 @ (@@  ``@`   ` ` `  `$t ` `, `(ӂ```(`(`.  ```(`(`. T `> ?> ??`* `(`( .1 @.   @ ``@`   ` `$ `(  `,% 1 (1 1 `  .  @ ``@` `< `0 `4 `8`  㿐ސ *  '* @ ?"@"` "`"`"`"`  "` " `􀠠> bЈ`@?`2  c@ 2`(`2`@@2, @2 @2  @2 2`* c` 2@ @ ` * *`@3 @3 @ - * @3 @ @ `> > "ВbЪ c-+`@  @ > + (,  @@ -(  !> > "Х,Ч,  `+,` > В@ -  `> bИ . .`.@@> @А. `!> -`"@'@@  '`'`y'` h>`'D) /`-` *  +`(( @ . @+@(`@/  @D/`@@`@`@` @'P@@@M'2`665 . .5 6'Ԑ #@45 '̪#c4@42`(2`# `@+ c. @  `.`( (@̪ D@@@ @ @ @@@5> 1 П0`(7> 5`г5` '0`* 3`0``> Вc3`'@1  #@3` # ` 7> ܆ 'Ї(5`. (@ *1 DDc ``. @ @D@+  @@ ''D['2`6`9> "Ї(@?5  #(@ %?@?@#@D7`(@ 5 #@ `4P(@1 @/` 1 1 4/@/`/`@#D5 @(@@ 2` @(@@@5`P5`5` /`/`/`/`@D2`@4(#@2`@@  (@@P@0`/ 0`0`/ / / @ D@` @@@3`/ 3`/ 3`/ / 㿀>`'D, /`+` *  ((@. (`@ @+ ) / /` D@@D@` 'P@@J'5 (22 #2 466. *`4 65 c4 5 # . @+c .`(@ @(@D@@@D@ `@ @@4 9> "Ѕ(;> 0`bз3`'3`1 *  c> 1  0`Є3`#'. 1  # ` 9>  "П4 (` . @(0`@*@4 D Dc @ @ @  @+'D  @` 'D`'7> 2Ї(?@4 @ (@5 @#@7`D%?(?@# (25 @#P4 @/@@4 4 /`/`/` 4@(D@0@ 2 #@(@@@3`@3`P3`/`/`/`/` D`5 4(#6@@ @ (@P1 / 1 1 / / / @ D@` @@@0`/ 0`/ 0`/ / 㿘l   &&  ?㿘 ]  u 2?& & ?㿘 { 㿘  H;j&. ㉘ `v  " : "" " 㿘  (0 3`+ +` `? @@ # > `` J@h &@ @b`@?` Jڔ㿀;> b'D'`2*@`*2*2222 ///////*2@ `? @" / @?> 'b D   . . 2 .  . @* Xb > "X< (. .`&5ک x@  @@0`(`@@:1@V5 - @  ۪@@5`-`@Ą @0os@ 1 ) @Ȅ =_㯂@@0`(`@̄@@*5 - @Є * @ @5`-`@Ԅ @?Q@1 ) @؄ `&؂@ @0`(`@܄@"=@㯨5 - @ ?ք㱪@@5`-`@ @"W5@㾈 1 ) @ "@@0`(`@@?f@ᓨ5 - @ )P㎄@@5`-`@ @m@!1 )  =@b@@0`(`@@ @0,@ 5 -   @Q@ @5`-`@@@:m㪈 1 )  5Ą@]@@0`(`@@ @S5 -  6(y@@@5`-`@@@9Ȉ1 )  xs@@@0`(`@@ @0ք5 -  =5C@ᇪ@ @5`-`@@@V 1 )  *x@@@0`(`@@ @?;5 -  @٪@@5`-`@@@#J1 ) ?B@@0`(`@@!} 5 - gX"@ @5`-`@@?yN 1 ) )/D@@0`(`@@5 - =҆`@@5`-`@@/p1 )  &߆Ƃ@@0`(`@@:I 5 - 5;̆@ @5`-`@@" 1 ) 6u49@@0`(`@@95 - 蟆@@5`-`@@1+e1 ) 1= H@D @@0`(`@0@ʿ㗄5 - 5*@㧄@@5`-`@5@?$91 ) 1Vք@Ä@@0`(`@0@#3 5 - 5?@}@@5`-`@5@!aф1 ) 1@O @@0`(`@0@?95 - 5(P@ @@5`-`@5@ᡄ1 ) 1=߄@₄@@0`(`@0@/N5 5 - 5 ⻄@@@5`-`@:ᴄ5@㑄1 ) @ % %%%H;j&. 0㉘ `va  " : "" " " 㿘 .3`+  `?@ @C ">   `@GC @r  @m @ @@@& G/@㿀;> b'D'`2*@`*2*2222 ///////*2@ `? @" /@> 'c D   . . 2 .  .   8`X8@8`8`8`8` 8`(8`08`88`@8`H8`Pb > Ґ#H<'D (. .`&D @0( 1 ) @ 0(5`-` @ 0(5- Ć0( 0`(` Ȅ@ 0(5- @̆0(1 ) Є@0(5`-` @Ԇ0( 5- ؄ 0( 0`(` ܆@0( 5- @0(1 ) @0(5`-` @0(5- 0(0`(` @ 0( 5- @0(1 )  )@3a6 . 5`-` @-@ 0(5-  -0(0`(`  (@@ 0( 5-  @-0( 1 )  )Є@0( 5`-` @-@0(5-  -0(0`(`  (@@0(5-  @-0( 1 )  )@0(5`-` @-@0( 5-  - 0( 0`(`  (@@ 0(5-  @-0( 1 )  8@ 0( 5`-` @3zc6 . 5- 50( 0`(` 1@ 0(5- 5@ 0(1 ) 5@0(5`-` 0@0( 5- 5 0( 0`(` 1@ 0(5- 5@ 0(1 ) 5@0(5`-` 0@0( 5- 5Є0(0`(` 1@0(5- 5@0( 1 ) 5@0(5`-` 0@0(5-  (@3# `܆0( 0`(`  -@0( 5-  @)0(1 )  -@@0(5`-` @-0(5-  (@ 0(0`(`  -@0( 5-  @) 0(1 )  -@@0( 5`-` @-0(5-  (@0(0`(`  -@0(5-  @) 0(1 )  -@@0(5`-` @-І0(5-  (@ #܄0( 0`(` 5@3*T aN0( 5- 1@ 0(1 ) 5@@0(5`-` 5@܄0( 5- 0@Ԇ0(0`(` 5@6 . 5- 1@0( 1 ) 5@@0( 5`-` 5@ 0(5- 0@ 0( 0`(` 5Ą@ 0( 5- 1@؆ 0(1 ) 5@@ 0( 5`-` 5@І0(5- 0@0(0`(` 5@6.5- 'D'''    1@3(c0(1 ) 5@@ 0( 5`-` 5@0( 5- 0@ 0( 0`(` 5@0( 5- 1@0(1 ) 5@@ 0(5`-` 5Ȅ@0(5- 0@0(0`(` 5@0(5- 1@0(1 ) 5@@ 0( 5`-` 5@0(5- 0@0(0`(` 5@ 0( 5- 1@0(1 )  -@@3ta$0( 5`-` @- 0( 5-  (@ 0(0`(`  -@0(5-  @) 0( 1 )  -@@0(5`-` @-0( 5-  (@0( 0`(`  -@ 0(5-  @)0(1 )  -@@ 0( 5`-` @-0(5-  (@Ȇ0(0`(`  -@0(5-  @)0( 1 )  -@@0( 5`-` 0@3\b0( 5- 50(0`(` 1@0(5- 5@ 0( 1 ) 5@0(5`-` 0@ 0(5- 50(0`(` 1@0(5- 5@ 0( 1 ) 5@ 0( 5`-` 0@0(5- 50(0`(` 1@3\ b0( 5- 5@ 0( 1 ) 5Ȇ@0(5`-` 0@ 0(5-  -ذ3]b6 . 0`(`  (@І@0(5-  @-0(1 )  )@0( 5`-` @-@Ą0(5-  - 0(0`(`  (@@6 . 5-  @- 0(1 )  )@ 0(5`-` @-@0( 5-  - 0( 0`(`  (@@ 0( 5-  @-܆0( 1 )  )԰@6 . 5`-` @-@ 0(5-  -0(0`(` @0(5- @0(1 ) @ 0( 5`-` @0( 5- 0( 0`(` @ 0(5- @0(1 ) @0(5`-` @0(5-  0( 0`(` @ 0(5- @0(1 ) @ 0(5`-` @Ć0( 5- 0( 0`(` @0( 5- D    D@D@&&&& &> +`> @ > +    /`7`!@  @@  > +7 / `` 1 @)    > +7`/`@ @6. @1 )   @ @ > +  5-  6.@  %> +7  / @ @5- @ @ 7`/`  7 / @  1 @ ) @ @7`/` @  @6 .  1 ) @  ' 5 -@ @6. @  $7  /   5-@  @(7` /`@ @7 /  @ ' ,1 @)   7`/`@  @06 .@ @@  41 )  '||5-   6.@  87  / @ @5- 'x@ '> +@ |<7` /`@@ 7 /     5 x't1 @) -  @ @ 7`/`  @4t6 .,  @ @1 ) @ @@  4`5-,`@ @ @ 6.  07  / (  @ @@5-@  47`/` , |z#@ @ @@@ @7 /   3`@1 x) +`@  @ @ @7`/`  06.(  @ @@t1 )  3 + 5- @ @@@ 6.  4 7 / ,   @ @@@@5-@  5`7`/`-`@  @ @@7 /   5@1 ) -  @ @@|7`/`  6`.`@ @'6.@ x  @@@ @1 )   6`5-.`@  @ @@6. t | 67 /  . @ @@5- x@ 0`7`/`(`@  @ @ @7 / ' @t  0`@(`@ 1 ) @' @  @7`/`  5 -  @'ؒ@ 6.  @1 )   5 5--   @ @@@6.  47 / ,  ؒ@  @@@ @5-@  0`7`/`(`@  @ @@7 /   0@1 ) (  @'А @ @7`/`   3`6.+`  @ @@ @1 )   05-'̒ ( В@ @ @6.  7 / @@ @@ 4`̐أ,`@  5-  @47` @/`,#`ܤ @  @7 /  @  @0@1  ) ( @ @ @ 7`/`  3 6 @.+ @   @1 )  @ 4 5-,  @6. Д  @   5` -`@ 7 /  '̔ 5-@   @5`7`/`-`@ 7 /  @ؒ@  @@ @@ 'Đ   ȗ5`1 ) -`   7`/`@@  @6`6..`@  Ē @1 )  @ @ؖ @@  5`5' --`  @ @ 6.  67 / .  5-'p @В@ @  @@4@  , 7`/` '@  7 /  ̬@   @5@1  @) - @   Ȓ@7`/` @ А @ @  5`6ē.-`@ @ ̒@ @ 1 )   5 5--   @ @ 6.  @@ 07 / (@  @  5- @@ 0 ( @p @7`/`@   @7 /  @@0 @ ( 1 )  '@  @ 7`/` ' @ @ @@@ 0`6ȑ.(`@ @   @1 )  @ 05 -(  @ @  Ą6.  07 / (  @  @ @@@@ @5-@  3`7`/`+`'2֚@  @Ē@ @7 /   3 @1 ) +   @@ @p7`/`   4 ,  6.@' @ @@1 )   35-+  @@ @6. ' p7 /  3+ @@'@@ @6`5-.`@ @  7`/` @@@7 /   6@1 ) .  @@@7`/`  36.+  @@ @ @'l1 )   55--  @ @@@@6.  5`7 / -`@  l@@ @5-@  7`/` 5  -  @@@47 / ,   @1 )  @@ @@@@7`/`  4`6.,`@ ' @@@1 )   4 5-,   @@@ 6.  37 l/ +  @@@@ 5-@  07`/`(  @@@ 07 /   ( @1 )  @@@@ @ 7`/`  3`6.+`@  @@ @1 )   3 5-+   @@ @6. > +p `> +`"@"`"`l "` "`"`"`"`"` "`$"`(27 */   > +` `,5- `< `0 `4 `8 @  @   @& && & & H;j&. 0㉘ `va  " : "" " " 㿘 + 3` .@ `?C @ ?>  @" `  8C  ? @ ? @  `  &8/@㿈> "` '  % *@,@   > c> c  `  aa>   b   ? @" *`2 .   ?b > s#(㿘  >  87  (@z @  > 㿘> (8   22 **@2*`, ` `@. .`.3 3 + + 3 +  @ @  @ "`Ȑ  ``( @(@1 ) 1 22 ) **@@2*0`0`@(`(`1 0` ` ,  3> ,`+c8@ `@/`@3 + 3 + @3 @+  @  @ @@  `?%@ @  @ $$$$$ $$$㿘7 *2@ `?"2 @" `(! `( 7  , B> @&& ( ?" bB > `@?  (6 .B> 㿘 6` *2@ 2`?`(`( *@ 8  ( 8"@ @g@` ?( @"@ @^@@X 8` @S 8 .`(` >``ِ6 @E h㿘  > #6 @ P@8   > @> H 'D P'@??'`?`? ?в`( D?0D?`8?` Ի0й(`@ `+` ` 3 6.7 '`(І '0  + Ї5`- `.*.' (0  ?3@@@ @ ?Ц -`,@4   @ /  @й,Ȗ?@  @   ,, - @@D   E ?6 > ,6.X@ @Ȕ?E   +`4,3@й2?Ȳ   *@ ع6`/`E@  @ @ @ B @@@E??E@????@`?C'   '( ?(@ ?ԡ+ *24`6. (0+,`4  34 ,` * ,`Ԡ 3, 2`2`4`4`, @ *  , 2`@@+*`2  2 2` Ժ@ -*  @ 3 @ иȺ@?  ,,@ @D4?@ D @ @ F ,*@> @) @XC@ B ?@6F,6Ȗ 4`?@   F3 ?ȵ,+`؆  *4`2,@@F?@@   @  @@@E??E??@ O&<@D@C@DB (@АBȺ@GDF08@FD@<8<<<<< <(<0㿘e @*2@ `@2 "  "`P 4 @,  @  B > @ @8  H2 @ D(@ H`B > H@& P`P  @dB > @ @ 8 2 H D#8 H`B > H` P4^ @. @  B > @ @8  H  D H`B > H㿘 @*2@ 2` P *@ p  P p"@ @͐ HP "@ @Đ@ ~  H P@ p . P H @> > 㿘  Ȑ4  @@ Ё㿘  > "3 @ P@   > @> H㿘@㿘  3 0@y Ё㿘&0@@33#3. $(``@7`7`#7`.`$(`33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`$@7`7`#7`.`$(`(33#3. $(`,@7`7`#7`.`$(`033#3. $(`4@7`7`#7`.`$(`833#3. $(`<@7`7`7`.`#((`D`@@&@&`㿘&0`D@33#3. $(`@`@7`7`#7`.`$(`<33#3. $(`8@7`7`#7`.`$(`433#3. $(`0@7`7`#7`.`$(`,33#3. $(`(@7`7`#7`.`$(`$33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`@7`7`7`.`#((@`@&@&`㿘> cX1H*`2`  *0 : *0@`( ` 2㿈.7 6ݐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' v'o', 2`*`& `**`2 &  6 ,  2  O'H', 2   * *`+`&@2&  / 2  נ㿘.;6㿘.6  V *`2 `  㿘.6   *`2 `  㿐 .``(`*`@*`*`@ `+ `+` @ @ ? 000000.@.`.`.`.`.`.`.` ֲ`㿐 .``(`*`@*`*`@ `+ `+` @ @ ?G 000000.@.`.`.`.`.`.`.` ֲ`㿐 :   @  . ( *(*`*@ + +` @ @ ?0.00000....... ʴ㿐 ;*(*`*@ + +` @ @ ?ђ?000000 ........ @ .( ɴ(+ (*`  **    ? 000000........@ .(㿘``) `((`@ #3+3> 3> /`㠷3 #> @@` > `/ +(`@`( @&@D@#@3+33c. 3 @. H#&3+33c. 3 @. L@ #3+33c. 3 @. P#3+33c. 3 @. T@#&3+33c. 3 @. X#3+33c. 3 @. \@#3+33c. 3 @. ` #&3+33c. 3 @. d@$#3+33c. 3 @. h(#3+3. 3@c3 . l@,# 3+33(c@3# (  ^p0#3+33c. 3 @. t@4#3+33c. 3 @. x8#&3+3. 3@c3 . |@<#3+33(c@3# ( 1 1 1 0`0`0`/ // / / / / / 㿘@`) `.``(((``@. `@`@ > > !> c#> | <'6.6c66c#@. #c@. x8'&6.666c@. @. t@4'6.6. 6c@6@. p0'.666(c6@#@( @l ,'&6.6#.`66c#@c. @ h('6.666c@(#.@ d@$'6.666c@(#.@ ` ' 6.666c@(#.@ \@'6.666c@(#.@ X'6.666c@(#.@ T@' 6.666c@(#.@ P'6.666c@(#.@ L@ '6.666c@(#.@ H' 6.666c@(#.@ D@'6.6(6c@6#.@ @'.666(c@6#(@ @0`*0`0`1 1 1 *******X   & 'Ȇ ''`   'Ā& (& @?(&? (& &ĸ  `'> > > 㠂'Ąd„ > ׅ(#. > г7`7`ȳ.`@2 (7 ('؅7 7 ۴. 2 @@'߇6(66@(2 @@ #@@@7`'7`̷.ӱ7` . .`@'''_'%> ߤ܅(. س7`7`.`@2 (7 ('ȅ7 7 ˴. 2 @@'χ6(66@(2 @@ #@@@7`'Є7`ӆ.۱7` . .`@'''''Ą V    0M  3> 000(c@> 6  #6 /`+6 #> +`# + 2`2 #2`,` 2**`, *@@ @ @@ @  @ @H `%> 0(. 0* *`67` 7` > c7 # 6++ ,`67 .  7 @+`#,  @@ @@ @  @ @ ` ` `    G 'A> ޱ. .`(($%> ձ. ˳.`χ((7> . ڶ޳.`( (> ϱ. г.`Շ((#@@``@`  @ ` ` ` Ā@` ```  @ ` ` ` Ă`8'Ĵ  '   Ą'ā㿘> #  !7Ē l,``&@  * $ ` $㿀  @ '@  ' @` @' @     ' $@'  @   @ @@@ @@  @ @ @` @  @ @    @  @@  @@ @ @` @@  @@@  ` @@   @   @`      @ @    @  @   @     @ @ @ `       @@`  @       @@ @ @`   @@@  ` @  @@` @` @ @     @ @      ' @ @@`@@`  @  @ @    @@        ` @  @   @ @ @    `   ` @ ` @  @ @ @ @ @@ ` @ `  @ ` .@@.`.`.`.`.`.`.`x    ' '    @  @ ' @@   @$ '   ' @ @  @@@@    @ @  @ @  @ @ @   @ @ @ @ @ @ @  @      @ @  ` @@ ` @ @     @ @   `@  @   @@@@  `  @@  ` @  ` @   @ @@ @` @      @@`  @ @ @@`  @` @ @ @     @ `@ @@ `   @     @ `'  @` @`@ '܄  @ @ ` @ @     `@   @@  @ @    @  `    @@ @@@  @ ܄ `      @@  `   @`.@@.`.`.`.`.`.`.`㿐 *   * +    *`  *  * ''@000000.`.`.`.`.`.`.`.@''㿘0`.@@7`?.@@0` ̄3.@@7`?.@@0`UUU.@0`@(`7`/``@> !#%'"$& @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`> !#%'"$&`x @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``/ 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`(`1 ) 0`UUU. @1 ?. @0` ̄3. @1 ?. @0`ð. @$$㿘0`(`7`/``@> !#%'"$&  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7   ?7 (`@7  7 @`?. 7`7` 7`@ `3> !#%'"$&`x  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``?/ 7 ? ?7 (`@7  7 @`?. 7`7` 7`@`?30`+(`$$>  * ``( >  ` `(  㿘> #H @z@     ` 㿘> #D`" א ? " ? *` @  *  @*   *`*@  * 0`#@ @ ,`) 33@ @ @4`(`@ @ 4`@@ 0`UUU@ @ ,`@1 ? @ @,`@ 0`@ @ ,`?@c`c@ *@  > <! 3 c 2> $'!% #Ȃ@  - `) (`1 0`) (`1 0` @ 1 1  < 1 1  1 1  `1 @ 0@ 8@0`0` `<*(" ?`? * + 0`0` 0#( `0` +`@  &*`  @@ @ ? @,`4 @ &@4 , ` &@  ` 㿘4㿐 + *`   *   **`  *  * 0c@ @*` 0)?#@ @*` 0' ̦3@ @*` 0%?@ @*` 0#UUaU@ @*` ?`?0@ @*` 0@ @*` 0@ @*` 0@ @*` 0@ @*` 000000.`.`.`.`.`.`.@.`㿐>  `?  H /f * ' >   => >  ` +  * `-  2* #` @ * `2 2 ? ,  *`*  `  8    ˑ+ ?, " ? , H 0  * @`€'     @ < "H 0㿘>  ` ; >  @ 3 H /4*`* '*` `* @`  ?"`` €` `  @v H 0㿘H /f * ' > `   %  l"/  > ဢ` " H 0p%   *@ @vZ*`   >    ` 2   ` 2 ` F    G.  . H 0C?, l.̔    H 03?!> *  *  *` * @v@ , @ *`* % "`0e l$ H 00*"H 00H 0?> @`> ' H(+`>  ( t   "  ( H 㿘>  `> * H() > @(   &@( H 㿘 H /f * ' >  >  `  . * @ .`@  . H 00 `"@ `    *`"`* ` @u7 ` ` `* `"H 0 㿘H /f * '  >    > +  @ *`  ">  & , ,> " "H 0 UZ0 >  ,""H 0  㿘H /f * ' >  & T T> " "H 0 > U. 0 >   T"" H 0  㿘 "G  P > A   >  >   `Ht "   "  * `    +  & @9 > ` * & `B : " & @$ 㿐 "b  ( 2 $\  U >  2N >   /* *  ` `?`#`# $`  `B ; ` ;  B`;` (?2&   $@Ґ  $4 "  $4 "04`24 $`Ŕ 2 #> #& @ 㿘 $H /f * '  $`" > !> `4& $n!< $`2`4>  pnxH 0㿐H /f * ' '>  !> > a p#\ 8  k > > !<a#\ 8  k  $ pl H 0' H 0 @s 8'> <l @s 8 $$ 4& $H 0㿘H /f'> * ''> #> )> `` $!ؖ  RO` `,$  T$`㿘 ` (€& 㿘 P@㿘> D- > @( > > H.(@ t  .`/@``.`." ,,h,t,,,/////,,///,////,5x5H5P5d5x  > "'0#e ( @   #g#i@ #f@ ␀@0#h@̰ `> #@*` €>  > !> !(> !L>  !p>  !> !> !> "  @r $Ȳ@r $ &*`'' @h  @ d &  L +.: ' : R2'#  * ''  @  &  L +: ̒'Ԕ: , >  H `? ̚  ::;`#\#l#h#p@#t 2`p  & / ", LԀ ', L#@ @@@ @ @h  > X_!㿘`?#  2    ",  @u !$ ! X@qݒ   p& t&  l&  \& h X& @q&` L "*e`"@  @&  @ А@ 2     $ 4 Դ  $ X` ` ʀ  %`% %  %  <%  @* % `    ?$ `$$ $ $$ (* $` X> $ $ $ ( $ <``    ,   z   `  $ $   $"`  $  `$ `" $`   Dd $ 0 >    $ > + ` *  `  " $ € $  $ H /f4 * '    %>   Oޘ  `H 0! x 2  2`` X`  ``    0  X@ + L㿘   x" `# Q  & 㿘Q  㿘    `> #*` €        X  L)  @pv X >  $   4 $4$P$  @ "@ `   " @ 2   L (" 6  @ d :  `Q .>   O $ " ,@ 2   @ :    ` % , "*X L,*Q L   -㿘  (`"`$ "@@ 2*4 L& ( > @     㿐0#d@1  L (Z &@&`&`  *  L0 2` 2 >  $""`(&, ?",`0?"`0`, O`0㿘X  2  " 2 "   񀢀  "@ "`  "  "`"  㿘`  L'  / 7`4`, @ & (\& $h& <l& & p& @t& & > Ғ0 㿘d  $ " <) L < ")z L)w L㿘 `> "oϒ6> > " oȒ ` `2 o"@@ :&@ %> `2 o`"Q&  㿘 `> "xo6> > "o ` `2 o"@ :&@ %> `2 o}ؐ"@&  `    @   &  `2 ??* ""?㿘`> "o< > #o65> `` @ & o',`  @6&@$ %>  @ &Po,`  "@   @ Ҵ& ` HHHIII`I`IPIPI`I`I`HHHLMM MM$MMMOOM0QDPPQ0MHQDMMMM<R R R R R R0R0R0RlRlR RRRRR RR0R0R0R TTTTTT,T,T,T,T,TTT,T,TXTTT,T,T,TX> ` b '   @n˒ + 2 !  ;Ι 2)  F  ޖ     `€21 "  $  @] [АӖ  €`@  6 `  * & ` €#Ô  €`    * & 2@Δ y"D  @ "' "'f@  O  `€&>  &  @, &  `€(X S `€&   @, & 2;' @ 4 7װ 2 Ͱ ɓ-`  @_ ]А  `€A     * & ` €$  `€    * & 2ǔz"e -`@`@ T@   `€&@  &  @, &  `€) ~ `€&   @, & 2e'@` ;4 08 b > RH#㾀> "'?` ;  @`` `C` "C?`1>"*` € `€`` ``€ `2 ``€ `€ 2  0``  `   > Qې#㿐` l $     J "   % l 2&`;   /Ô [  $ ( "@?" ?&?  + @` :"`" "`%s l 㿘 `~>  Ц`#> `Ԥ :` " `Ԕ  ,`2Ѐ``Ԁ20Ѐ``Ԑ $` * $``Ԓ l* #  ``Ԁ 2 $`$`Ԑ @PL 7@jΓ*`Ѐ  `Ԓ2,*% l$Б,@`6&  l#W  $@j @?`>"ԓ*` €>  > !> !(>  !L>  !p> !> !> "`  :`  " > "$>  "@>  "\> "x> "> "  l#  "` `   l# "` ` #> '> @  6*@ ` & : &`  €``* ` 2  `  :  @"`* 2`P @  j*@ ` & : &`  €``* ` 2  `  :  @"`* 2 @  \*@ ` & : &` Z> "> "  l" "` ` ` &  l: "{ "``  ` & : "` ` :,`  €``` *  2   € > #> #   l"F "`  "͐  @ " > #<"` @  @"` `Π 㿘>  Ԁ@  >  Ѐ`.`@O `L   `"`:>#(*` €  1 `@ -   @iT` # l  " `   @iE` # l  " @i; # l   "# l# l` 2  㿘 2 $f  Z   U>      >  Г*   K&        : `    1  2  * ?`$>#|*` €    & `4 W  &  &  & `4` c @3 #> ဢ $`> in#@h X >>>`'Hᄘ#''''''''''''''''''㿘홖 㿘푖 㿘  l! &@hs Ӑ  @?㿘@hb " l&㿘 㿘! } 㿘  l !&@h?! `` `a 6 @?㿘@h$!"} l&㿘k 㿘◔ 㿘!  l  H&@h H.%6 㿘@g`H"S l& 㿘S 㿘 㿘  l x &@gՒ 戔 㿘@g˒ "$ l&㿘诒㿘껒㿘  l Q (&@g ( 㿘 ,` " `@g! l!`` @g (! l&㿘є 㿘” 㿘  l !&@gx!ƞ.  @?㿘@gf!! l&㿘   @gX 㿀>    "`'`.   ?  @   *@ !Ø  @  .@   $@ b > M 㿘  l!&@g!*  $!@? s  @?㿘@g!![ l&㿘.2 㿘.M2 㿘.2 㿘.&2 㿘.K2 㿘.܆2 㿘@ 㿘@ " Ȧ@f 0XP "? 6">>cؐ#'''' '̔ : l,` % T "@ .` . l,` % T"@  $   PT''> #dC >  #h#\?   2e,`* h  d  T̀ ؀`2܀`K`I l  C&'& &`'ܰ  lݔ  2& # @ @@ l@ z&@ $~@ l@ n& ` @ 2@&  & ] l` @    㿘Ԑ l 㿘 ? l㿘    *@  (*@ @ @  '"@ @ ,@,@ @i   .. 㿘 (@&`(@`@ (`/`/@`  @. *@㿈a"@  o6.  ' "  "`"@"`"`  o6 ?#\  @ `     ' 7  6h  \ /'А Ԕ P    ؐ '̖ "  "`"@!?# {``  '̒` "` "Ԓ#Ҕ h`   '̒` "` ,, $ H /f * ' > "] "   > 2``$ 2`$"""2H 0 "  "Ԓ ŗ  -`H /f * ' ]˒ " '̐ > 2``" 2`""2""H 0̔  "  ,, 4 $ 1̰!̀ > f `H /f * ' ] "   > 2``$ 2`$"""2H 0 " "Ԓ 1  ǀ`   ` %` ג 0  <$$ @de <%> l $l  & && & & & & & 8& 4  '̒` @`@'$$`e 沖 R g'Ԓ  J `'>  ft! DЀ "'̀ 3@''''ȒД̘ؖ `Ȱ # N&@` ـ Ԁl@π >  f8!@ƀ` > f0!X& <      ' 7> !f``    ̀`'''@`$Ѐ ԁ㿘` ? h:  / `-H /f * ' > #\} "& $H 0 $ (  & 6 & 0& (& ,& <& 8  2    &  "㿘   "    `   9.@& 㿘 ͐   "  " " " " "㿘  h  2    "  &@.@ .` .` .` (X!  'P   > c! 2 6 " @bP@z`ƀ   P%`  g#%`P ޖ ]`@P @  0O@K80G50D%`a "P(PP%a@P "@ <`P` `> <> " 0`> B "; 0@b<`   @`a:` d > #x `K' G 1 `aN:` ګ 2" @U "  0" 0@$ 0@ "   0 $ 0ǐ Ð   `: @ ǖ` r   0@  @@ @ "  0"   0 $ 0@ڒ S'$@@8 `< b @ ` `/$. l h@@ l $& l @ږ "p  0 d $ 0 0 > b!  [ H l@ "@&- ,> ``B :` @$ "?  0"2  @ 0 $ 0@o  @$" @ 8    cݐ! `" H@3C<``>  cɐ!   4@0    X` `` !> b!` 2 <> #쀥 "<> b!耢 E ƀ  ?>4@" @b`@xږ`"`ƀ  $ @S  "` $ 3 =`` 6`  " `@ `B 2 ` /F   0h$ 0| "$ &$  $`7> ր@ H`B ; H`@a=  ` ? @`%8 !  :` @Ė B<Ɣ4` B 2`(`` B<   @ה   B 8  2 d ( d  d @ `@ 6  H [$ , }  H2;  d`@ `8@ $ `$ d$ `$ d l   ` & d h d@   d$ h $ l8  @ $ h $ lX!@ 0 0   0 $ 0@kM@jϒ` 0 ?$ 0` $ , "`0!  0`$ 0$ ,@o `-` -    `2`+ 㿘 X! @!h 2#> ǐ @W;  aĐ+ W "   K 㿘 X! @  > !Ĩ!*`   ƀ '>  4 Ɛ ƒ >   @V 27  ƀ `4 Ƙ  @V  Ɛ ? 4 Ɛ ?4 ?   ) 䀧  Ɛ ? 4 Ɛ ?4 ? ư 㿘> #x`*> > !<`   ` 0@2&  0@ & 0&  & "@"#? # ``  0D @ H /d * % ֗HH 0 h \ 0` ''@ $$-$ T : <2` H* @ $*`  0?Ѐ@<> @`B :@$@^|> XȒ`B ':X$@dm 0@"q T < H$''$`<  H> X`< T>  :2`*  8*` B88<@) `& h < T"@ *  $   @8 H @^@& l <& l`)`@ % \ > `|", a &a> " h> `cB ; h  <@@}`ڐ"8 0& 4(& 0> : 2* P*  ` d@ H$;P$@ 'ԑ< 0C @<  @'Ѐ`$'̐ ' 0@ & 0̖@!0 ̀   0`& 0@i(0 0 & 0@hՒ 0@*@& 0% 0 !H /d * % |H 0 0 Ȁ" 0$& 0" & d 0(& 0% & 4 Ɛ 5 & d& ``& @@g`XH /d * % H 0H> `> "'> O +> /> 1> 7> 5>  Ѐ +> /> 1> 7> 5>   T  2   > ^v"X (_bx   "> ^e"0aOǖ "> ^Z"- `7O "> ^L" "> ^D#'_̐@]|  / , $O > ^+#8c@]g ?'//!&!`@l "> ^#X'_【 b > C# 㻐> "'@ >  #@j > #_p&ab  > #_b@aiO :.` K.  * .  > CX  㿈  '` "` #a b$$ $  "@  o$ 4?#\b' | >`    %'   >  > 4a$`T"` '> "> ``K؀ ' '> ^ 0 H "  㿀> !`> !  '@a "@5 a#\b   ) Y'  'A쒒 '#' 耢  '@\V   &..> ^ X 㿈#ab   2@`ϐ '( ?#\b  Ԛ `  H` #   a $ '  v 0 H}㿐> a>   .d> "a|> > !    > ֒c(> > #\ `!8  S 㿐> #! +`    ` > `>  @a|*  >   X 2T Ā2 @]U 2   s 2Y& 2 > ! "  2> !  &!   0>>  T @[!8$`!0J$ `L2` @] 2 `< 2`@ $`<`@ $`@ $" $@$    $  $  Ȕ4 Đ!   & 㿘 > > !  c D >  E   <` `$`   ` @!  `ƒ 4`   㿘 > aȀ  ``D >   `" `< 2"  "@`<  %>  " T Đ]  T Ā @$! S ! "!  !  ؔ`Us$` 㿘> +> !(     0> +!L)> +-> 1> /> !(  $ pwp@` 2k   $   !(` @@ 2(    @2@   $$@2@  " $$ @   " $  !(   `$ $ :2p   > +"aL> +!(   $   !(!Ē * 2aL:09 j!(㿘 <  $ '> +%> '> +%> 2 "(  s p =( 25 `> +!(#> `&    _   a88  U  ``  ?& p $p2"> ( 2 (  1 <`@ 4$ " @  2  , `@  " "  @  2  0 > T    #쀢2c > !D$ 8> !T$ 8$ <  ?????????????> +   ِ!(> +aL  aL>#>  8h/ .!(> #p  2 "  $ """ """"" cp"$cp9L $ & !(   㾸> "L0 @8','DE'@  "    '@D@ @\p< w< - HL $T84#\#`  H(@M884#\#`  H(@M+ g  DL  HJ D  @@ "    '@D@ @\+< 2<8 L D  @@ "  @D@\  0'@D  @@ "   '@D@ @[< <L$ `#\#`  @aϘ "3L $T84#\#` @L(84#\#` @L(  8L  H"ǖ   @`u4 `  !$@E 2  `<   @  $ @E  2,@ `<   @ $  @@D 2,@H  > $TL 84#\#` @LH(84#\#` \@L;( w L  H4@` 88    8 `    $ 0@  "@` 85   ?# -8H /f * ' > "P "   > 2`` 2`"""2H 08"'8" 8 '48 4`" 4 '4$ > =! 㾸> " L  0  @ 8' ,'DE'@  "  ` '@D@ @Zʘ< `<@ - H L $ T84#\#`  H(@K`84#\#`  H(@K`   D L  H D  @@ "  ` '@D@ @Z< <   L $D  @@ "  @D@Z  ݖ'@ L$ `#\#`  @`? ,H L $ T84#\#` @K$(`84#\#` @K(` S   L 2 Hb  A $ T L 84#\#` @J(` L  D T84#\#` @Jޘ(`    L  H 8e      8  L  D T`    $ 0@  "@@  85 L  ?#@-8H /f * ' > "O` "   > 2`` 2`"""2H 08"'8" 8 '48 L 4DT#  L 4 T D'4@^b > <! H> "L0 @ 8 ', ?E  "    'ЖԒД @Y^̀  - HL $TȒ#\#`  H@J&`Ȓ#\#`  H@J` U  L  HL   А@ "    'ЖԒД @Ỳ ̐ & L H  А@ "  Ж@Yt  0'АH x  А@ "    'ЖԒД @X̀ w>    А@ "    'ЖԒД @Xǘ̀ [  /'L  А@ "    'ЖԒД @X̀ B @  А@ "    'ЖԒД @X̀ ('T  А@ "    'ЖԒД @X|̀  @  А@ "    'ЖԒД @Xb̀ 'X  А@ "    'ЖԒД @XJ̀ ް @"  А@ "    'ЖԒД @X0̀ İ       ?h  А@ "    'ЖԒД @X̀     А@ "    'ЖԒД @Ẁ 't 'xt  А@ "    'ЖԒД @Ẁؘ l    А@ "    'ЖԒД @Ẁ Q'| '麐|  А@ "    'ЖԒД @Ẁ 4 g  А@ "    'ЖԒД @Ẁ ' M'  А@ " $ 'АԒД @Wǹ ?# @@>  /'L @2'T @2'X   :?h @"'t'x @"L'|*`" *  * ''L `#\#` @] 1 L $TȠ#\#` @G`Ƞ#\#` @G` #  L ŀ H" #\ P    ؀@  ܀@ # 9hL $TȠ#\#` @G`   x#\Đ #`@G` Ԑ  L v H"̖ #\lh?l?2`< &  X`@0`<    @? P:  $TL  Ƞ#\#` @G@`  D x#\Đ #`@G/` k  L  H  #\@Z<X     8 `    $ 0@  "@`C 5  ?# C-ȑH /f * ' > "K "   > 2`` 2`"""2H 0"'"  'Ȑ` Ę D#` ĖD@[L'Ė> " > 8!ȁ > "L0 @ 8 ','F'  "  ` ' @U 2z@ /L H $T#\#`  Hx@F{ #\#`  Hx@Fn    L * H@   @ "  ` ' @Un 24 { L   @ "  @Uʔ  "'  @ "  `' @U= W@ 4 ? $ H )L  $T#\#` x@E #\#` x@E  - " LL  HÖ L  ``t'#\#`#h''#dh@Xt`  3t -L  $T#\#` @Ex   X#\#`@Ex  ސ ^L _ H"u Wp> K#x@QX @ X h%@ l%` X$` X޳ $TL #\#` @Ecx   `D`X2 X#\#`@ENx    L  H  @Y [    8 `    $ 0@  "@` 5   ?# -H /f * ' > "I͒ "   > 2`` 2`"""2H 0"'"  '  ` " ` '#@ W    8 `    $ 0@  "@` 5  ?# -H /f * ' > "It "   > 2`` 2`"""2H 0"'"  '`   #`  ' @X`@XZX    8 `    $ 0@  "@`C 5  ?# C-H /f * ' > "I "   > 2`` 2`"""2H 0"'"  '`  D#` D@X'> " > 6K!؁ X0'@> 8"'L ','L'P''' 'ȬD'  " $ ' @S  _ - HL $T#\#`P  H@C՘`#\#`P  H@CȘ`   L 쀦 H   @ " ( ' @Rɘ Đ ֔ L >   @ "  @S$  ːq'> ܰ ئ  7> 'H /f * ' > "H5 "   4   `6 $ $$ 4 H 0H /f * ' H "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  ܀$ ''@ $($"$ $ % %  L `   %=%%#`#\Ԓ %%%@X  1=L  $TP#\#` @B `P#\#` @B`   L  H"   @V `< ̀      آ L؀ "$TȀ $TL P#\#` @B`̀   \P#\#`@B` А L  Ho ` @V_쀦 d ` Ȧ$  $"@ @UW"    8 `    $ 0@  "@` 5   ?# -H /f * ' > "G "   > 2`` 2`"""2H 0"'"  ' `"  '""> " > 4C! x`0`'> "`L`@ `8'H''`,'L'P'$' E'  "   ' $  @Q  - H`L %`T#\#`H P H@AИ`#\#`H P H@AØ`   $`L H Hs $   @ "   ' $  @PØ nД `L $   @ "   $@Q  0S' 쀢`!$   @ "   ' $  @P :      @ "   ' $  @Pp  $   @ "  ' $  @PW r`L  '`<   @@4`L.`L H %`TH#\P#`  H@AH#\P#`  H@@`3 `L } H `L `#\#`H @U ,`L  %`TH#\P#` @@͘ `H#\P#` @@˜`  `L H H"s  @  <  쀢`     ! @9/L   @ @9&L(oL '  H`L %`T 򀢠 2'L'薅 :`E L L('"'' %`T`L H#\P#` @@P`  `P`dH#\P#`@@>`Pz P @'`L  H 쀢Z    8 `    $ 0@  "@`c 5>   ?# c-H /f * ' > "D’ "   > 2`` 2`"""2H 0"'"  '>   d" `d'$'UT    8 `    $ 0@  "@`G 5   ?# G-H /f * ' > "Dj "   > 2`` 2`"""2H 0"'"  ' `H" 'H'D    s>       8 `"   $ 0   @"   ?$  $ JH /f * ' > "D "   4  `6$ $$ 4 H 0H /f * ' > #C "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ &4 .  m "@ 5 2 > K!    8 `"   $ 0   @"   ?$   $   @##    $  ":""" ߒ   (L ?' " %`T`L H#\P#` @>`쀢  2 XH#\P#`@>`  `L  H"4 (@RQ- "`ת@R(%4   "@"@Q;% 쀢`$耥 >  >  $$> " > 0m" 0'> @8,'L"'P'L   '''`'" E  "   ' @M)  - HL $T#\#`P  H@=`#\#`P  H@=`    L  H   @ "   ' @L X L   @ "  @M?  0='%  @ "   ' @L %    '     @ "  ' @L ,   . `*`  "@ " " ` "`" " `" #"@"   2@6-LL   $TP#\#`  @= `P#\#`  @=` J  L 瀦 H"Ɩ #\  `#\#` @Q ,L  $TP#\#` @< `P#\#` @<֘`   L  H" #\N L' <         @5<L 6L  $TP#\#` @<`  xP#\#`@<` Ő L b HA  #\H@O8 3H .ے &`&@` "" "2     &`>`&`&`&`[> bbB:bk Lw " $TL P#\#` @<$`  `L``2 P#\#`@<` K L 耦 H怦o#\@O      8 `    $ 0@  "@` 5  ?# -H /f * ' > "@ "   > 2`` 2`"""2H 0"'"  '` `"  '    > ""  W     8 `    $ 0@  "@`C 5  ?# C-H /f * ' > "@* "   > 2`` 2`"""2H 0"'"  '`  D#` D@O'> " > -f" `'D'P&D'L'"`,`0`@`L'' `$`($`4 $`H: 0(@(b2*@ *@ b 2`* @ *`> ᖂ#tB*2@* ;@ < `L@G<@  @ " ' @I  / HL $T#\#`P  H@:ǘ #\#`P  H@: P P@'L H  @ " ' @I Tdǔ L   @ " @J  0; '$  @ " ' @I $      @ <$H  @ "' @Ig ?  <  ;`B<$P  #  "@ " " ` ""  "  # "@"  @@ 1D $T#\#`  @9#\#`  @9ܶ #\ ( @Mܐ  $4<$,H /` * ! `H    8 @8  $   "`$  $ $ `H "`$&`H`H$$, i p *  @@  d d@F  2   @ d  @d d@F֔  ""5 $"`$$`L `` `@ ``@F P 2@``@d` @d`d@F  "L0 $"`%$H 0.: 0(@(b2*@ *@ b 2`* @ *`B2**;@ CH /` * ! `H`@` 2`4``4 2` `"`$`$"`$`$` "@``"``"```"@H 0`,`L$`,#\`L  `#```8`d Ԗ@M̘ 'Ѐ Ԓ(L <      'Ԁ2 `HԒ ؔL@11 `H    ' ' ' `? `` `H"7'     2 2  + '  '  "" "2 2Ԕp> bbB:b Ԁ L-'ш>  ؤ$ $`T#\#` @87 #\#` x@8,܀#\(@KF$`T  `L``2 #\#` @8 ܀gА#\(@K'    8 `"   $ 0  @ "  3>   ?# +H /f * ' > "< "   2`4"""2H 0"'"  '>  `"  '`P H ␄  V     8 `"   $ 0  @ " C 3  ?# C+H /f * ' > "<< "   2`4"""2H 0"'"  '`  D#` D@K'`,`$`4> Cؐ"(H /`@* !@   <@`H$` `H` "`$&`H$`$(` ` `"`$`$"`$`$` "@H 0`؀H /` * !   <`H$ `H "`$&`H$$H 00ԑH 0H /`4`H* !`H` `4 "` ` ``$"`$`$` "`4P"@D"`2`4H 0 㿘> #d`> bH@: ``"``"```"@` `"`$`$"`$`$` "@` @4  "` @ ` @`> C+"X$ ,^`, , (@ `,@@ 2@"@`> `, (`H` &`,`2 ( H 2 (& H ( &`  (` "`$& (&`$`(   `"$$"`$$ " ( "  ( "`$& ("$`(2 㽈> " L  0  @  8' , ? ''' ''LE  &  ` ' $  @EM @ /$ L H % T#\#`  H@6#\#`  H@6`D ` $ L ,`HO $   @ & ` ' $  @E g   L $   @ &  $ @Ee  $0N ' $   @ & ` ' $  @D٘ 8@ 4 ? $ H`". L L % T#\#` @5#\#` @5`ː `"  L L `H֖  L `  'L'P#\#`#h('X#d@G$` ؔB'ϐ '`?@ L % T#\#` @5I  x#\ #`@58`t` L ]`H #\ؖ p@HG u ΐq 1$   @ & ` ' $  @D& @ " 8    '@C '@ $Z $   @ & ` ' $  @C \> @ $   @ & ` ' $  @C A` /'D$   @ & ` ' $  @Cʘ )@ @$   @ & ` ' $  @C @'L$   @ & ` ' $  @C @ @$   @ & ` ' $  @C @'P$   @ & ` ' $  @Cj @ @!$   @ & ` ' $  @CQ @`      ?`$   @ & ` ' $  @C2 @  $   @ & ` ' $  @C w@'l`'pl$   @ & ` ' $  @B [@  ? $   @ & ` ' $  @B @@'t`$'xߐt! $   @ & ` ' $  @BØ " є 8  'D @'@   @ &  ' $  @B > ؑ2 a` <@'@ '@@ /` 'D`` 8 ` 8   :?` '8 @``!̽0<8Lז 8> \9#܀`8Qlk 8" `0` @  '@@ < "7̇0\> 9m#< LK< L % T#\#` @2#\#` @2`+`=  L 29`H8> L'<8| PH0> \9.# L % TԐ?# @'P('L'Tƚ'X > \9#P@@c8<' 8<鯒 L` % T#\#`  #\#`   \> 8#<鎒L<680> \8#<8<˹<vL`Pd?`  @*  `y?`M `˖`@>  @X h% l%X$  {` ` l@?  2  p'˘`% T L #\#` @2  `D`T`x#\ #`@1`6` L `Hp`e    8 `    $ 0@  "@`# 5>   ?# #-H /f * ' > "6 "   > 2`` 2`"""2H 0"'"  '>    $" `$'#@``#@”  @Eg#\ؘp@DҖ     8 `    $ 0@  "@` 5  ?# -H /f * ' > "6 "   > 2`` 2`"""2H 0"'"  '  ` #   \'    8 `    $ 0@  "@`C 5  ?# C-H /f * ' > "5 "   > 2`` 2`"""2H 0"'"  '`  D#` D@E\'% "L=L " <70> \7#<罒L8@* 8 8 > " > "֐"p 㽘> "L0 @ 8 ',?(' E'T  &  ` '(,( @?$ $@ /,L H $T #\#`  H@0g #\#`  H@0Z` ` ,L ~`H ,  (@ & ` '(,( @?Z$ @$ h L ,  (@ &  ,(@?  ,0' '(,  (@ & ` '(,( @?+$ $@ 4 ? $ H`".LL $T #\#` @/ #\#` @/` `" LL `H( L `  0('T'X#`#h'`#\#d@B , ` 啖`;,L $T #\#` @/ #\#` x@/`ϐ`L `H#\ x@B  Ж ̖   (@ & ` '(, @>$ l$@> a* @?   H8d> 5# cH`,` `( &  ` '(,( @>W$ =$> @ ,  (@ & ` '(,( @><$ "$` /'L,  (@ & ` '(,( @>$$  $@`@,  (@ & ` '(,( @> $ $@'T,  (@ & ` '(,( @=$ $@`@,  (@ & ` '(,( @=ۘ$ $@'X,  (@ & ` '(,( @=Ę$ $@`@!,  (@ & ` '(,( @=$ $@`      ?h,  (@ & ` '(,( @=$ r$@  ,  (@ & ` '(,( @=r$ X$@'t`'xpt,  (@ & ` '(,( @=V$ <$@  ?,  (@ & ` '(,( @=;$ !$@'|`'9|? &,  (@ & `'(,( @=$ $7' `?@c *   *` '@ 8  'HP8D@jT K@> d4.#D@ Ti 88d> 4#D侒TD/@TD@V X"8"@?# @'X'T'\z'`> d3#܀`2@X@@ D @D䎒@`x@9W @ X h%@ l%` X$` HWƲx  N `$TL  #\#` @-X #\#` @-K```L p`Hn`e     8 `    $ 0@  "@`#  5>   ?# #- H /f * ' > "1Ӓ "   > 2`` 2`"""2H 0 "' "   ' >    $" `$'#@``#@  H @@#\@? % "T=T " D78> d3#D㽒T@@* @ @ > " > ֐" > "L 0@ 8 ',''F'p  "   ' @; 2z /L H $T#\#`  Hx@,f #\#`  Hx@,Y    L  H   @ "   ' @;Y 24 f L   @ "  @;  "'  @ "  ' @;( Bǖ 4 ? $ H )L  $T#\#` x@+ #\#` x@+ܚ   " LL  H L `t  ''#\#`#h'#dh@>t`  ᐖ ,tx < 2 @? | @    @q | x≒|0ľt  W'pt $TL #\#` @+bx   x#\#`@+Tx   L  H  p#\@>a > " > d" 㼘> "L0 @ 8 ', '<'8''' '''p'LF'  "   '8<8 @:$4 24 /<L H $T0,#\#`  H @*0,#\#`  H @*ޚ   <L  H <  8@ "   '8<8 @9ޘ4 2c4  L <  8@ "  8<@::  "<I'8<  8@ "   '8<8 @94 224 4 ? $ H ".LL $T0,#\#`  @*o0,#\#`  @*b  " LL  H1 L`` `8 'L'P#`#h#\'X#d(@<<`  x'á ' FL $T0,#\#` @*    0#\, #`@*   G L  Hۖ x0#\@= #\  @@=0 Ȗ [Ė G8<  8@ "   '8<8 @84 w4 - HL $T0,#\#`  H @)0,#\#`  H @)   <L T H| <  8@ "   '8<8 @84 24 ߺ L <  8@ "  8<@9   0'8<  8@ "  '8<8 @8}4  4 $%` HL  `'`,8#h'#\#` '#d@;<`  ' › '  <"L<’!> u <` <    ` `  23 2 `  `2X  X`X@  B   B  < d `@6> "? 2 <L8hǒ@5  "<<߶L'<%?" !> /# ބ' z@'0\.#܀ $TL  0,#\#` @(~    0#\, #`@(m    L  H x0@;z#\ #\@@;r0*  " " " L> .#L 0\> .#<)L<> " > N" H> " L  0  @  8 ' ,''''''Fp  "   ' @7䀢 2 / L H $ T#\#`  H@'ښ#\#`  H@'͚     L 瀦 H   @ "   ' @6͘䀢 2 ڔ  L   @ "  @7)  " L' L G  @ "   ' @6䀢 2z / L H $ T#\#`  H@'`#\#`  H@'S    L m Hn   @ "   ' @6S䀢 24 `  L   @ "  @6  "'  @ "  ' @6"䀢 <# 4 ? $ H ( L  $ T#\#` @& #\#` @&֚   L  H  L̐ `#\#` Ȗ@;Ś 8 L  $ T#\#` @&`  X`2 x#\#`@&Ѐ א  L  H@:i  #\  <`2 L P` L `Đ  'L'P#\#`#h'X#d(@8Ā`` ='ʐ 'Ā )`8`< `X X@ 2  <L=L8@ 8s 8 ``Ȓ'Ā X'Ȁ $ T L `#\#` @& `  X`2 x#\#`@%Ѐ 4 ` L  H`@9Ę#\X@8 > " > " p> "L 0@ 8 ', ?'''TF  "  ` ' @4ɘ 2q@ /L H $T#\#`  H@%`#\#`  H@%`   L W H   @ "  ` ' @4 2+ ې L   @ "  @4ߔ  "'  @ "  ` ' @4R 2@ 4 ? $ H ".LL $T#\#` @%`#\#` @%` C " LL ۀ H L ` 0'T'X#\#`#h'`#d@7/䀢` ڹF '䀦 `HD  @ "  ` ' @3٘ > @   @ "  ` ' @3 e` /'L  @ "  ` ' @3 L@ @  @ "  ` ' @3 2@'T  @ "  ` ' @3r @ @  @ "  ` ' @3X @'X  @ "  ` ' @3@ @ @"  @ "  ` ' @3& ΰ@`      ?h  @ "  ` ' @3 @    @ "  ` ' @2 @'t`'xt  @ "  ` ' @2Θ v@    @ "  ` ' @2 [@'|`'İ|  @ "  ` ' @2 >@$ }L H Ր    ?''$'' ' ''(  ',@0ږ 2-@  @ "  ` ' @2Z }uT`'L-@@ "D8d> )#D!T@@ @W @ ?`@Tۘ {83`*X?# @`'X'T'\'`  > @.Ē @@Xh%l% @ X $  @Ö@> M8> d)3#܀` 䀢 جx':䀦 $TL #\#` @"`  2 X`x#\ #`@"耤` |ِ L r Hpn e    8 `    $ 0@  "@`# 5>   ?# #-H /f * ' > "'# "   > 2`` 2`"""2H 0"'"  '>    $" `$'#@``#@e  H@6 #\x@5E+ T " 8> d(r#䀢 "DD T@@y @B @ `o`# > " >  " 㽘> "L0 @ 8 ', ?(' E  &  ` '(,( @0$ a$@ /,L H $T #\#`  H@! #\#`  H@!`{ ` ,L ̀`H ,  (@ & ` '(,( @0$ $ ײ L ,  (@ &  ,(@1  ,0 '(,  (@ & ` '(,( @0u$ $@ 4 ? $ H`".LL $T #\#` @!8 #\#` @!+`{g `" LL S`Hl L( `   'T'X#\#`#h'`#d0@3U, `  ߖl ' `?HL $T #\#` @    x #\ #`@ ՘`{`L `H#\ x@3    - ή ;,  (@ & ` '(,( @/Ø$ ;$> @ ,  (@ & ` '(,( @/$  $` /'L,  (@ & ` '(,( @/$ $@ @,  (@ & ` '(,( @/w$ $@'T,  (@ & ` '(,( @/`$ $@ @,  (@ & ` '(,( @/G$ $@'X,  (@ & ` '(,( @/0$ $@ @!,  (@ & ` '(,( @/$ $@`      ?h,  (@ & ` '(,( @.$ p$@  ,  (@ & ` '(,( @.ޘ$ V$@'t`'xܐt,  (@ & ` '(,( @.˜$ :$@  <@,  (@ & ` '(,( @.$ $@'|`!'|@  (@ & `'(,( @.$ $y ` /'L@  'HDWTDĐ0# D@T  @@+ @ X h%@ l%` X$` i x `$TL   #\#` @     2 X `x #\ #`@`y1` L `H p`2e#\     8 `    $ 0@  "@`#  5>   ?# #- H /f * ' > "#{ "   > 2`` 2`"""2H 0 "' "   ' >    $" `$'#@``#@Խ   @2b#\x@1 ǖ      8 `    $ 0@  "@`  5  ?# - H /f * ' > "# "   > 2`` 2`"""2H 0 "' "   ' `   #`  X'     8 `    $ 0@  "@`C  5  ?# C- H /f * ' > "" "   > 2`` 2`"""2H 0 "' "   ' `  D#` D@2X' "D9DÒT@@0 @ @ &> " > ܐ"Ё > "L 0@ 8 ','''pF't  "   ' @, 2z /L H $T#\#`  Hx@k #\#`  Hx@^  w  L B HC   @ "   ' @,^ 24 k L   @ "  @,  "'  @ "  ' @,- wG 4 ? $ H )L  $T#\#` x@ #\#` x@  w " LL ŀ HƖ L `t  ''#\#`#h'#d@/ t`` Hҕ" 't :L  $T#\#` @x `  x#\#`@x  v̐ L u Hs#\H @/t k g  <   2 @  2  [@Ȑ 0 t +'pt $TL `#\#` @6x `  x#\#`@(x  vd `L  H ` p#\H@/5 > " > 8" ` 0 '> " L @  8 ' ,'L'''E'  "   ' @*  - H L & T #\#`  H@ǚ #\#`  H@ u   L s H   @ "   ' @* Uǔ  L   @ "  @+  0:'"  @ "   ' @* "      @ "  ' @*g u:  ' L  > < #@# #4Ԁ@4' L `#\#` @0  / L & T #\#` @ #\#` @ u4  L  H"7  HL'؀   @ @hL L L & T #\e#`  X #\#`j   % ' ( '' ' ?0'<'$'(','8'@'D`' Ȓ 'L`Ȗn`0 "  HbL 'ب ѱL =8 쀢 " L  L  & T#\#` @]  X#\#`@O t  L  H" H@.  "ࠤ& T  X``#\#` @!t]`ؐ H@-    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '   "  '   T    8 `    $ 0@  "@` 5   ?# -H /f * ' > "S "   > 2`` 2`"""2H 0"'"  '   `"   ' >  >   ߌ ߉  '䀥@' @к'Ѐ@ '`$@ "`䀧@   '܀ & T L #\#` @&  X @@#\#`@ sN  L ̀ Hʀ^ؐ H@,ޖ    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '   "  '   `   `89> ` ``$`0 `  " `  ?&@9>  ^@ ` &@&` H /f * ' > "6 "   > 6```` 2`&`&@&`6`H 0H /f * ' > # "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` >  &c ^@ ` &@&` H /f * ' > "ђ "   > 6```` 2`&`&@&`6`H 0H /f * ' > # "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` & ^@ ` &@&` H /f * ' > "p "   > 6```` 2`&`&@&`6`H 0H /f * ' > #M "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` @& ^@ ` &@&` H /f * ' > " "   > 6```` 2`&`&@&`6`H 0H /f * ' > # "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` &`r`>  ؀ \@ ` &@&` H /f * ' > " "   6` ``6 &`&@&`6`H 0H /f * ' > # "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` $ɔ$@``.? ^@ ` &@&` H /f * ' > "1 "   > 6```` 2`&`&@&`6`H 0H /f * ' > # "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` d& ^@ ` &@&` H /f * ' > "͒ "   > 6```` 2`&`&@&`6`H 0H /f * ' > # "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` @&`Ъ@ ?''䀧@ @  ` ?ܬ" @'ܒ`'Ԁ' ^@ ` &@&` H /f * ' > "C "   > 6```` 2`&`&@&`6`H 0H /f * ' > #  "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $``  & ]@ ` &@&` H /f * ' > " "   > 6```` 2`&`&@&`6`H 0H /f * ' > # "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $``  >  & &@  `&&`  ` &@&`   >  > ߐ" `0'> "L@ 8','L?(''E'  "   '(,( @#$ w$ - HL %T #\#`  H@l` #\#`  H@_` n  ,L I HV ,  (@ "   '(,( @#_$ 2$l L ,  (@ "  (,@#  0'(,  (@ "  '(,( @#/$ nJ $  L   !'ش @  >< %@% %4؀4'L `#\#` @( /'L %T #\#` @Ș` #\#` @` m  L  H"  0ɇL   @  @ .L LL %T #\_#` #\e#` ʾԒ  ' 'Ⱥ '''' ?' '''$`' ْ 'LȊ`804L ʆL` "  " : "e b L  %T#\#` @) `#\#` X@` mZ  L  H" 0@& 젤t#\#`%T h @`m30@&͖      8 `    $ 0@  "@`  5>   ?# - H /f * ' > " "   > 2`` 2`"""2H 0 "' "   ' >  > " ' # #พ##طش  @''̬ @ `  ̸ '̀  '` "   h''Ѐ %TL #\#` @I `#\#`@>` lz L ) H6 0@&       8 `    $ 0@  "@`  5   ?# - H /f * ' > "Ò "   > 2`` 2`"""2H 0 "' "   '  " ' ## `   `8` ``$`0 `  " `  ?&@  >  5> `  X  " '` @i X h"l"  X $  dL `t'ܐ В  ' 'Ԁ '@%4> `  ''0''(@ \', @` $@&` H /f * ' >  "   6``` 7`&`&@&`6`H 0H /f * '  "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` %`` $  [ @` $@&` H /f * ' > b "   6``` 7`&`&@&`6`H 0H /f * '  "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` %`` $  [ @` $@&` H /f * ' > bF "   6``` 7`&`&@&`6`H 0H /f * ' & "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` %`` $  [ @` $@&` H /f * ' > b "   6``` 7`&`&@&`6`H 0H /f * ' ǒ "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` %`` $ q >  ؀ [ @` $@&` H /f * ' > b "   6``` 5`&`&@&`6`H 0H /f * ' c "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` %`` $@Ŧ$܀ $> ,? >  ؤ ( [ @` $@&` H /f * ' > b  "   6``` 5`&`&@&`6`H 0H /f * '  "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` %`` $@-$  '̬ ? ' 45Q ^ @` $@&` H /f * ' > " "   > 6```` 2`&`&@&`6`H 0H /f * ' > #i "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` %`` > $  ] @` $@&` H /f * ' > ") "   > 6```` 2`&`&@&`6`H 0H /f * ' > # "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` %``  >  $> `$ @   `$&` ` $@&` , ) >  > &# P> "`L``0 `@`8'`,'E'  "  ` 'ؖܒؔ @Ԁ v@ - H`L $`TВ#\#`  H@ В#\#`  H@  g  `L  H1   ؐ@ "  ` 'ؖܒؔ @Ԁ 1Ԑ ù `L   ؐ@ "  ؖ@  0'  ؐ@ " $ 'ؐܒؔ @}Ԁ g`L `#\#` @"R 5H`L $`TР#\#` @ 7Р#\#` @ * gf  `L  H" #\ H@ 9  w  > $`T`L Р#\#` @ Р#\#` @  g " #\`L  Hf #\@Ѐ [     8 `    $ 0@  "@` 5>   ?# -БH /f * ' > "_ "   > 2`` 2`"""2H 0"'"  '>  ̒`" ␐ '#@ #` > # > " L  0  @ 8' ,'E'  "  ` ' @d `@ - H L $ T#\#`  H@ ,#\#`  H@  f[   L v H[   @ "  ` ' @  ,  L |  @ "  @z  f!)' L| `#\#` x@ ٘ 3x L $ T#\#` @ #\#` @  e  L  H"  @ `X `x px $ T L #\#` @ y  X  4#\#` @ d e  L  H@0      8   4`    $ 0@  "@@  5  ?#@-H /f * ' > " "   > 2`` 2`"""2H 0"'"  '`  4 "`  4 +'`: ` @G &@&``: `@= &`&` ``  ;`@3; &`&`&``&` &``&`(&`$`&`0 &`, &@`&`` &``&` `&` > #( 㾸> " L  0  @ 8' ,'DE'@  "  ` '@D@ @< `<@ - H L & T84#\#`  H(@ v`84#\#`  H(@ i` d  D L v H D  @@ "  ` '@D@ @i< < v  L $D  @@ "  @D@Ĕ  dk͖'@ L$ `#\#`  @# 3H L & T84#\#` @ (`84#\#` @ (` d7 8 L  H"  H@ɘ4   Ô 84#\#`& T  @ Ҙ(`d4@88    8 `    $ 0@  "@`/ 85   ?# /-8H /f * ' > "_ "   > 2`` 2`"""2H 08"'8" 8 '48 4 0" 4``0'4R @ @"?  #`,#` #`#`#` #`(#@#`#`#`#`#`$b > #8 㾨> " L  0  @ 8' ,'DE'@  "  ` '@D@ @S< `<@ - H L $ T84#\#`  H(@ `84#\#`  H(@ ` cJ  D L v H, D  @@ "  ` '@D@ @< <   L $D  @@ "  @D@i  c'@ L$ `#\#`  @Ș 3  L $ T84#\#` @(`84#\#` @(` bܐ 8 L  H"  H@n4          H  ڔH  O $ T L 84#\#` @Y(`84#\#` p@L(` b  L  H8@4 c 8    8 `    $ 0@  "@` 85>   ?# -8H /f * ' > " Β "   > 2`` 2`"""2H 08"'8" 8 '48>  > 4`" 4 '4"""` "" "b > #H 㿀 L! ,  & T#\#` @ `#\#` @耤` a  L 2 H 㿀 T ,  L & T L  #\#` @ `#\#` @}耤` a  L 2 H 0`2 < X @`"  @ <    2 @&  @  @1  `   @" 㿘`$P P TkX P R $\  2H /f * ' > " Ւ "   > 2``$ 2`$"""2H 0 "  " ss  nH /f * ' "  "  >  4 ``"  2`"$ $$ 4 H 0  $  ** 2 " k` ;H /f * ' " t "   > 2``$ 2`$"""2H 0 " " s   "`\ M 90k H /` * !  &8`$ #> > !Ē 6*cx `"8 2 ``<@ o 2 8`> ǐ  48H 00H 0> !Ĩ*` 4z A"44T  ऀ@ ! }a !ऀ@ *  pa" > # `"1 H /f * ' > " ƒ "   > 4 ``$  2`$$ $$ 4 H 0  "@ ?$ crb  R `20ࠑH /f * ' > "  "  >  4 ``$  2`$$ $$ 4 H 0  " $  r0 !a* *v4 "> x@ @!İ 4@4x* $l$$$x$t$p$$$$| $ ?4H 0@0㿘 %> @) #> ?  cx   8  > #`" `2@`$"`, @"`$@`2` 㿘 P & PqT j㿘$ "_| D P 2 ? @&$_r : &$\ R    " V` @? ` k !>  c $  @  &$> c ޔ ? # 2 `> #&"@  T "# P@ O   $`@E 0C P `@*> " 沔 _ aPB "''?''''''آȐ @'Ȑ   l #  # $ 2   , h@  #b@ `B >b@ # @ 耢    " > cИ  A  w *@@ ! ' >  > `  + b ' @'Ȑ  le #"'Ȁ "'Ȁ?"'Ȁ L耢H>   c̘ "  > !'''آĀ !Ā Ȓ 'Ȑl5Ā`^L #   # $ @ #耦 "Ȁ  >  @  " " '̀ J H?G ^#  & >  `H  @  4S " @5 + 2. ,    А"@'''̤آ'Ȑ kҚ # $ 倦 #"'" '̀ ]&@Y 㿀>  "@   @3  @+  ? #\ P 22 8 $ "]  '쀣`' '  @t䀢 ] $>   bPB]=bP $> #`> 1> !#x` 2@` 2@> $` $`耢`Z$`> a * * " `4* " `4 *`  dl|?* l|`:`@ `  :`* l|`:`@  `$  $$ $ `4* *` $ `4* *`@ $ h$ l$ `$ "`8"@$ ᤒ`  ?"@$4`$< @@@ D $$`$ ?$`$$`$ #x`4* `*` l `8: #@  `# `4* `*| :`#@@ " $`2]` ` @bHB\=bH  $2  $   >   p $  0'D>  X" 'a> \'H`''L'X '*#ԠH D$ <L  $ $ $ 4` ` @`' $+'Ԑ '̦@   ̐Ԗ@"Ƙ !̐#\#`Ԙ@"? "> \dH> W    *  '̒#\H#p#d#h#`#lА@ LԀ` + T 2<$ ```"`8```$"  `?ܐ" 4 `?"  `` ?`$`$`  \d `" `` ` $`` ?` "@$ /> L$ *`'->   eh$ ($ ,$ 8> x ` $ $$ $> $ "8`B :8H /` * ! $$ "@"P =T  (@0H 0 \ @ 沔  \O`P\`@Ȑ   $ @ !$ $` $ $H 0 ?$ 8  H /` * ! `"  "`"  "H 0  $` $ $?$ 2   $ >  <`@c   ''   "    ' @ 2> #̀@ %> `2 -$>  Ā 2 2  PȐ["@ [  [[ > $   #\ؘ@!    ?@ " 6   @8 0.'  @ " $ ' @  q  @ " $' @ Z0]G"& #"FZ @.`)> '>  #  @ > #``F2D" X""@ " ZnZl > c> X"""@Z] > u  ZU +ZR > j> " > 7 㿈\H /f * ' > " "  > 4 `` $ 2` $ 4 $$ $ $ H 0> #  &H /f * ' > # "$ $H 0 $(  $ 4 $ 0$ ($ ,$ <$ 8> #`@ $` $  > `X & &I > > #&   > `.& & ?R$ >   & & J& &`L @ `@ *  L t> `@2`<     @Ӓ ꀦ^> l?'p '&&&     8`   $ 0   "  0`   ?$ 4)` H /f * ' " "   > 2`` 2`"""2H 0$ `$` `  $`  & &&& &J KHab LX\ & &`  `8` ``$`0 `  " 0` `  ?$@ 4)` H /f * ' "z "   > 2`` 2`"""2H 0$@ `$` `  $`   & &\ Y& V&T&`  `8` ``$`0 `  " 0` `  ?$@ 4)` H /f * ' "# "   > 2`` 2`"""2H 0$@ `$` `  $` @g&&`'@%@` "> (`B :( 㿐H /` * ! > # > "   $ 2 <@ " 8 $ $ $ ; $ 8h2"d 4> #x*` d *l |@ : :*l |@ :` > #*   8 `4 $`$ $  ,@$  (>  <`@  $` $ $ , (@& T@`B <@ $s$ $ ` dm$ , dj$ ,P`f?$ 8`|`"@``" 4    &X(2   $ 2 @6K 沔 X\  "B  `    @     `@  *?( #"'\ ""4`8! $`"` ,  $ $ d$ , d$ ,:  $!$P`B  @ ;ȠCH`"@8 `8@2HH 0>  `"`$" @"  ` (,*@!(  㿘 `  `@`<*  !)  @@!@'> `͔  & Ж] !2> !Ġ *`@@2`@@& 㿘@@*@>    & *&蹐㿘  *`@! '>   < "  $` a2> !Ģ *`@2  $ 㿘@*@> ڐ! & *&v㿘> `  "`Z >    "LH /f * ' > " "   4```4$`$@$`4`H 0 (+$` H /f * ' > # "$`$H 0`$ (` $`4`$`0$`($`,$`<$`8$` 2 `> `  "` X# V &P`0`@`,''   & ' ( ' (@ Ϙ > $`X 0   &    ' @  $`T$`L> #Ѐ@  I> #@  J  K`2 $`L`$`D `8 L`L ` L2 `D> aؑ* @$`D!`L> cĐ ? $`L   ?@ & 6 @ ̒ 03'  @ &   ' @ A `@ P $`$`$` f  * @ &   '@   6`4*"4 *: `4`@/`!2 '  ?@ & &'@ ] 0> `   x ?  ``&`&` 'T H   Ж`!?''''Ԁ 'ܔ@   @ &  ' @  }ༀ  > !`  @ & ` ' @ } Z  > o!(`a  &a`L`@$`L` &` > Z!Hv`  @ &  ' @ H %ༀ  > 5!`Q`  @ &  ' @ % T@0P' @ '` *   L``5> `2``< ``    @U` 뀦` > #`h@  `l@ ``pĀ@ `&`h` $`D$`T @1``L  $`L  $`D$`T  $`0$`@㿘 " d> ax|l h`0`V H'`$ 沐`p&`0沒 "'̖А'Ԕؘ a̖ #Ѐ 2` ##`0%   "`8" $&`&`8 "&`  2&` @L :`0 5&`0 2&`0沨"ؤԢР̐ '̒' aaЀ`Ԁ " `( "&`$" &`("   `#2`0Ѐ ِ  `$ `0 @㿐 0 " > !$ 0 < G 8 $ 0    *   `?& &      *   `?& &   8* ?$ 8$ < 0  0 ?$ 0 <@!@ G 0 8   $ $ $ <@$ 89   /  @ "@ S $  < "@&  < ""@&  < 0 #  $ <@Ւ 8$ "$ 8$ < 0 ?$ 0 ,  ,@@ 2@"@ 0 "d < (` ,"`$ $ ,$ ,X$ (㿐& 0 "6 7 $`'0 7` & $"`& (R`   @'$@   Р ($ <$ ,$ 0  $ @e &&a RbJ 㿘 0 #>  ؀" 0>   ? `" D `& D6" 0 2 0> Ԑ & 0`"ԁ㿘> `t>  4 > "c> #"#"`㿈 <  > { > , В  ≘ >  X c2  >  c*  q'> > # X @2f   D 2a  2  8 @ *  "X   2ѐ  ` ,  "` "@$$ "@$   > $!2 bX `B + t#> pc`B :p 4  @ c  $c, %> > #  " #>  ,  aЖ       ,  `"  "`   "@`"  "`"  " " QL   @"V H /f * '  > R `ؒ`*@ ?2@  `  Z\   `")  8 ` <"< `8`<" 8> $4# ( "4,$0 $ ?# @2 " 0 > @"' H 0  , $$ "@" ,  X$  8  `  ,  $ 沐 @,  8 Qz $  F4  Xc2  # * ` $  X 2  * "`  Xc2`@# @ *`"  X2  * $  ,  , ♐ 㿘 < e X> c2  >  c*  X>  x> > `"@#>  X @2J   D 2E  2  8 @   "<    aА ,     X  , `,  D*  `"  L 2  * ` T $ 沒 P $ `,    ,  , 20 2 X㿘> #"> #` "`  "@`"`$`"@  4 2> "#㿘H /f * ' > " "   > 6 ``  2`& && 6 H 0(& H /f * ' > #e "& $H 0 $ (  & 6 & 0& (& ,& <& 8 & &㿐 'D'L ?'`hpH /f * ' > "2 "  > 4``$ 2` $4$$$$ H 0`( & ۑH /f * ' > # "$$H 0$( $4$0$($,$<$8  " ?@$ $$ `  ` `8` `$`0 " - %@ 4) H /f * '  "   > 4 ``  2`$ $$ 4 H 0$$  > aH  $ ` !> !L  (aNb $!L'%!H!> -> ('b!> -> a@ `&!H %!H!Ha&$@ `$@Т`$@`$@``  $@``L$@L> "@* $@`􀦠$`$@t   8 ` $0   " 9   ?$0 $. H /f * ' " "   > 4 ``  2`$ $$ 4 H 0 ($> А"$  $ $@@`$@D``? $@D`?$@`$@ `,  $@`>    8`" $0  @   ?2MH /f * '  "   4   `5 $ $$ 4 H 0(&$H /f * ' > # "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8 `" $0  @"   ?$ 8 ǒ &$ @t &$ $ ,? $   8` $0   " 0   ?$ 4) H /f * '  "   > 4 ``  2`$ $$ 4 H 0$$   $ `\ $@\$`>    8`" $0  @   ?2MH /f * ' ’ "   4   `5 $ $$ 4 H 0(&$H /f * ' > # "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8 `" $0  @"   ?$ 8 Ԓ &$ t\ & $,? $ $`$@ d$%`l%`"㿘   @$P%` $] @`2`W @@`*0"L H "@` }`9`` < B#$@>`&`$`@@`8@``?&`&@"@@`""`&4`&&6 @&㿘  > "`? %@ >       8`"   $ 0   @"   ?$f H /f * ' > " "   4  `5$ $$ 4 H 0`"&$ H /f * ' > #g "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ %      8 `"   $ 0   @"   ?$          M  $  <`  B#$> & _&"`"I"``$Y    ` 8``   $ 0   "@ 3   ?$@* $( H /f * ' > "Ӓ "   > 4 ``  2`$ $$ 4 H 0$ % ` @*@` $ &  &' 㿘 & &@&@'@] Z H> R"8H /f * ' > "{ "   > 4 ``  2`$ $$ 4 H 0$ $"$  '@ʒ&@  " H    ' @"$ $ @ 40$ & &@   "   H &" "@㿘      8 ` $0   $  ?$ ?@"@ ` $   d &$ w>  ؑH /f * ' > "ݒ "   4``5`$$$4H 0(&H /f * ' > # "$$H 0$ ( $4$0$($,$<$8  0  $ $  "@ `?$      ?"@ &$ &  &@ 㿐> a> ?a >  >  > !> "3> %> '> )> +> -> /> 1> #> $ # #c&a$$%#%`%%&#$` d@ !>  $ $ @  !> +> ֒c(#\> >   bH#Ԓ @ > #"#"`!P>skc@!PO㿘> !<>  L"? 6"`"`"  㿈 DX@!  b"  T Z쀢 ` @?`(#`' `D> ` 'ḕ*,` `H@  * @$'@> a* @`> ؑ5 a` <@``4'`8*`" *  * ''􀦠2<" <$$<> !8$8<? > !X$8  > c$ $8N$q$&$$(( /& & L`& 4& 8X`h-& `"& `  & ` & ``     @ > & (``       > P`8& `<& ,`@& 0`L& <`P> X& @.& H`& ` & `& ` > `& (` : 2* @* > P`(& `,& ,`0*`" *  * & 0& 0& H`< & <& @`@ > X& D  2 $@ >  2 ƀ  8 2   $@( >  <@pK> <> #$u hƀ$!"&,&0ƀ" &4&8 㿘 ` $> 㜒 `" X!`@" < 2`ƀ 2       > >  `B E:`(`B : ` 2`( $`@ `( 2 `ƀ  8 `2  ` $@( `<  <``@o`<` h`ƀ$!"`&`,`&`0`ƀ" `&`4`&`8 㿈\> `$ $q#$ @  @@" $ "{ H "K  /2 m `@$  ,@ @`,@ ?'@"& & 2P  $@$ #\$ h0 #`@f 2= `< Ɛ 3 ? `$$ # !$ d$  2   @@`  pi  $@d$   z#܁    +" ' (0! , " "   ( #2" 㿘\`@Q@    8`   $ 0   " 1   ?$ 4* H /f * ' > "q "   > 2`` 2`"""2H 0$  $  > ` $ #@`    8`   $ 0   " 1   ?$ 4* H /f * ' > "" "   > 2`` 2`"""2H 0$  $  > ` $ #@ ` #@$#`4`#@8#`<`#@@#`$@'@@㿘`Q    8`   $ 0   " 1   ?$ 4* H /f * ' > " "   > 2`` 2`"""2H 0$  $  > ` $ "T`    8`   $ 0   "W 1   ?$ W4* H /f * ' > "f "   > 2`` 2`"""2H 0$  $  > ` X$ "@`X&'㿘`&` & `& L 0> @*t &`? /&` &`$&`P&`T& `N&$`L 3`  &(&,`&4&0`&8`,&<`0&@`4&D`8&H`<&L`@E&P@> aP* @&@`2> > !` *`! ` &`$&`(&@ ?`L&`P*2 @ & `&$`&(`,&,`0?"&0@#&0`4&4`8?"&8@#&8`<&<`@?"&@@~#&@㿐> #\&` 2 a F`0 2X `   O` ` 2`c R`` h`+0"11  d ` &`&R 66     "R   6   $$` ǒ      @  H( ``X2 `p `d00 0`2`XH  42  (::"4 4  2 ($(( :(4 (2 4,(4(:4  "4: :(㿘 a4" T8. d6`.` ? @Ba 2aa  a2 a( 㿘 a4" T8. d6`.` ? @Ba  2a(a$  a(2 a,( 㿘`T`d82`*  *` @!4?`B`2!`'!4?!?!4 ?!2!!@(!?!!4?!! 8?!㿘 a4F`T8`d* 2`*` a@? B42aa@-a)a#428aa@4 a28aa(8aaa `@g4 8a28a(8a8a8a㿘`T`d8* 2`*`  @!4?`B`2! `&!4>! 4 >! 2!(!$ (!(>! !(4 >!(!,>!(㿘 a4F`T8`d* 2`*` a(@? B42a a,@-a )a$#428a a$@4 a 28a(a,(8a(a a( `@g4 8a(28a (8a 8a(8a  L`T D> ȇ(R   P?# @ >   ( **" **  㿘@\ P &@  &` &` 6` V 6 V` `   " V V` `㿘`>  X !`@" < 2!!!!`ƀ     㿘@;  @27@> ϐ"x!   8 ̀@8" Ā 2  2 &  & &  @& &K  h Q & @2< #>  @2 &  &@2" @> a@o  Ē!bқ  ?2  ~ 2 j @  ` "`  "@`"`& "@  32ݒ  #" 㾘5 i> ` "@ '> #>  Ȓ`$  b F  `@ K N!6` t G D'''''z? <@ " X a 1 @ @' $ `@ 7`>  c   `'b    0" 0`, a`00@ 0" 0`, ဦ Q`0݀ ` | @ À   `0 "@@ *  L    @2  <      a  逤  > ! `@ 6 `0 $`@ | 3F `0   3~@ ` `"  "`   "@` "`$`  "  @   $ ݔ PT $` 4 $ $ l> $ lpx#$ pt x  $ h < "$  `   $ ` $ 沐 $ Ḕ`< Ae $ $` $ ` "@$` @ *  L` $ @ *  L "` @ * " L@ *  L@$ Ḑǒ``L @"`L@ " `"` $`@Ӕ ? 㿘(` R`   >  0`"T@@j T@ @!!V "T@@Y0 20` H /f * ' > "̒ "   > 2``$ 2`$"""2H 0 "@ ?" cRi ` `23`xR 2/`xH /f * ' > "ꕒ "   > 2``$ 2`$"""2H 0 " "  R3 `x4`z`  ?4`x4`4`  2!@n!$  $ $> $ "@"$ $   $ $ H /` * ! >x!$`$` $ 0`H 0 㿀'H'   H /`  a Q?'a* ! 2a  4!&@!$$> $"@"> a( "a(a  'a`, 2@#ǐ 2  #>  Ԁ`!> #> !$`$$!$!b ̘ !$ $!$  Ԁ "2 >  Ԁ`>  Ȁ``0 ` 2@`D  $`0$`D$ `2  Ԑ ?%  `"`0 S  @  ?`4$`0 `9 <wѐ: 0(@(b2*@ *@ b 2`* @ *`B2**@ ;C  `H`"@8 2 `8    $ `0  䀢 " 'H 0`   `U`4䀢 "B> x \`< "`"`8 # ?$8`&&\&d`P 2 hI 2 HB |  `  ?$ "`D "T > "X`P``8F C䀥`2`L `D > #t`  >  D *` ` 0B>0 햒  < ">0   D*`  `C :" , +>   @!@  > "> Y"$  :$  ``"  8 `  $"   ?ܐ" 4  ?"     " " >/  "    "   $   "@澒 `0   < <= ` @W <`"Z ,H /f * ' > <R *` ?2 <`  FÒ  < `, 8 ` <"<`< 8 <"`8> $限#( "4,$0Z$? <c 2`<" 0> <|"H 0 ,  =S @ s ?2!, @WH /`* !u >  `@Δ =)`,=&`<䀢   ': 0(@(b2*@ *@ b 2`* @ *`B*28*@ CH /` * ! `H` @ 2 `  H 0`l`H /` * ! 5䀢 "X $@$ Pa?'a`""`> " "@H 0 4> a(&? "a(@Ӑ 㿘 0  ? & 0 0 $ 0&    NW"   `RH /f * '  > R `ؒ`*@ ?2@  `  E   `")>  8 ` <"< `8`<" 8> $s# ( "4,$0 4$ ?# @2 " 0>  Y"H 0<5 <3 $  ! ` "`   "@` "`&  " <  3`2 H /`4 H* ! H  "$$$ $$ "@   2 & HH 0㿘 D? & D 0 `"  "`> "  "@ 2㿘>  " > "$ #> +> /> )> -> `Ȁ ` 0 ` "`$ "@ 2 2 0i`$`$  `$ $͇`" %`Ԑ ?%Ԕ  2!% @! А`"` "` `Ȁ "`" $  Р`$`" !  2%@!" "" " "@$ 㿘> +!h*@ !h*` @ "@   "@ 2`L  "`D $`D$ `8` ` 2$ `$  `\ "*"@ *`" ``*   "@ *  $ ah`  ?"@$ah㿘>  `?      +  2  >  *" x a` "x %a`, '> @@'> ࠀ eࠀ c`> !<%> ! $@ؖ M ࠀ`R ! Nࠀ`"``"`" ``"@`0 :?!`\H o *@ e  p    0 2 a 0 $ 0   0 @$ 0c \`t "`tH 0 2`\ࠀ`2` acx?%a"&cx㿘> Xcې 㿘>    > , `2  ,  ),  8 " ",#>!> c  "? c  >  , @        , 0, 6",㿘\@ %#> > !Ē@&*  bʐ `< F@"> *@&  8!&!& & &  & &  2 2 ;> 5> Đ * b` `<@ `  *@& P "   *@&' ̐ `$ * @ & *@&˫ 㿀`4`> # C@*  耧`> `2``> #`h@ 6@; ``"`& `@"@'@ '` "@&     "`t & &" '@`l@  `p䀢 '`l'`p`l '`p'' '' x @'\ '   "  ` ' $܀ ܢ9>~@> `'@ '`@, a,n> !  ܀ 6   & ܐ | 3N `"  "`  "@`"`& "@&`'&h&&lx&p&t & & "@& `@L C*  耢` &`@C C*  "` `@; C* " `@5 C*  &    " @  '  8''@p L "'W     5 @2> @͖> `B :   D | '`R Ę` ?     `8 ` ``$`0 `  " $uS `  ?$@$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "ⵒ "   > 2`` 2`"""2H 0 > c#"'" '? @" '`R`#  "` Rb ^ [70`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > "H "  >  2`` 2`"""2H 0"'"  '   #  '` #\#` ۚఒ "  . #'  @ "  ' Vܖ 9  ؖ ޔ䖒 -؀  7耥   @  " 3 0  4''  4ܖ 7: 0b&@ࠀ 8 8&`"&`     @ (0  &`      @  0 ( &`     @ aC 3` +  &`c &`$  &`&`&`  &`&`&`&`H@ `Tܔ Z`ؔ ZPaԔ X `D`@  6vBp> "!B:!  D沖`R ` ?'`  ` `8  ``$`0 `  " u``  ?$@l`4j`     8  `    $ 0@  "@ =?  ?#4?1H /f * ' > " "   > 2`` 2`"""2H 0 > 蜐#"'" '? " `@'R#@` #?` R* S Ē 6)0#\#` i䰒 t .'  @ "` '  $@   ܒn薒 䀦 M  @ "/$0 ' 0Ę 5߰ 08@a >$  $$@a >$ $$@c <$: $$ $5> > b# '@)!(?> cߖ? > ؐ#>  c@y!> @"> #Y> a&& a  """ qz`" > 箐#@> `> s` #> > 硐#b  '4d> `(  2%> >  `0@.@Ӓ\qC\ "`<\?"@\$b<% @Ȓ >  8>  `t p$b<%  >   8>  q" > P @@"@@抒 X    j'''''' 4  @$  @ݖ >  '㿘H /` * ! ?` ` ` +@ @  @ &H 0` 0 `, +%> #> @aĒ  @ & d@a d@6aa@& d@֒* " d*@@͐* "@*`& d` " ``0  d& h d& h`"` @ ` " `  > & "&   @   4&  @ 4& ` " `$  > & "&   @   4&  @ 4& `@" ``(  <# & $` "  &  4& ` " ``4  $& `@" ``8  $& `@" ``@  $& `@" ``H`?#@$`J6!`@" !`L`?#@$`N6!!! 86!`@ `P`?#@$`R6!`@" !`T`?#@$`V6!!! 86! P " ( T 2 %> #>  !> 狐c !  4  &  &$ &( d&, h&0 &4 &8 &@!&H!&L!&P!&T0> "' /  2o   H$ ? ` K X * V'> a, 6 @ "a,  @@@!` C @ b '!Pr8 @3  2- Y 2$ Z$@仐0ܒ Y 2$@䮐@TM  2 '@  > ! 㿘`@@@ 2_  &!@䄒!&a$``$`o> a> @*$`    $`h$`$`$`$`$`$`$`d`$`$`$`    < $`L4a4a4a4a` ` ``@ ` Z` ZaP X$``  `$`X$`T:  &`P   2㿘!6` @$`%> #>  a0   ` r_ *@$d @$2p `$ T  㿐!`L`  `&@㿘`& ` " X2`| 2 d p  p d 2q0 d 2 X -㿘`(7   $ -002"&* ""&$ !> ""  b  "" > !,      - -xxxxxx㿀 Ò #\#` 谒  .1p`X`  b@  `<    `i `c> "  B:  HቖR ` ?'`  ` `8  ``$`0 `  " u`  ?$@l4j     8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "Œ "   > 2`` 2`"""2H 0 > s!X"'" '? @" 'R`#  " R S Ēm 10    8 `    $ 0@  "@` 5`   ?# -H /f * ' > "W "   > 2`` 2`"""2H 0"'"  '`  "` `  ' <@  2 @2  #2 @2 #` `#\#` ٚ䰒 I .'  @ " ' V 0p 0.   ܒ۔薒 䀦   @ "  ' 1  2 0F0@O0 `<  ``> !hd    ! "  $!@ "@  " ! "  $! @ "@ ƀ      ": @W$ `< 2   <    (#$    " Ā@"$ `< 2   <       @Wq$ $  㿘   < #  ƀ   X!@     @M  Ɣ 4    d $  ƀ  ? 4 Ɓ x X!  ` "3  * > # `B :   D n 'R Ę` ?     `8 ` ``$`0 `  " $tS `  ?$@$kS 4iS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "٧ "   > 2`` 2`"""2H 0 > U!X"'" '? " 'R"@` #?Rb  Q "[ .0w`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > "; "  >  2`` 2`"""2H 0"'"  '   #  '   #\#` Κ䰒  .   ' .p 0.m㿘   H?` - ? ?2`X ,?2 `X 4?2`X ?" `X @`|  ? $?"D 4`<?`!>!ԓ*` €h  4?? ,?? ? ?? ? ??S ?5< `X @`K  $     ;   ! `B :"  D  < ݟ'R Ę` ?     `8 ` ``$`0 `  " $uS `  ?$@$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "ؒ "   > 2`` 2`"""2H 0 > ߆!X"'" '? " @'R #?Rb ⁒ [-0u`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > "k "  >  2`` 2`"""2H 0"'"  '   #  ' '`?Y    8 `    $ 0@  "@` 5>   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '>  1> `"  ' `V    8 `    $ 0@  "@` 5>   ?# -H /f * ' > "ֹ "   > 2`` 2`"""2H 0"'"  '>   `" ฐ ' ` ?Y    8 `    $ 0@  "@` 5>   ?# -H /f * ' > "` "   > 2`` 2`"""2H 0"'"  '>   " `' ` U     8 `    $ 0@  "@` 5   ?# -H /f * ' > "  "   > 2`` 2`"""2H 0"'"  ' `"  ' `?Y    8 `    $ 0@  "@` 5>   ?# -H /f * ' > "ղ "   > 2`` 2`"""2H 0"'"  '>   " `' `U     8 `    $ 0@  "@` 5   ?# -H /f * ' > "[ "   > 2`` 2`"""2H 0"'"  ' `"  ' ` ?`$?"]     8 `    $ 0@  "@`  5>   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '>   # ` ' `  `$T    8 `    $ 0@  "@` 5   ?# -H /f * ' > "Ԧ "   > 2`` 2`"""2H 0"'"  ' `"  ' `,> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > "K "   > 2`` 2`"""2H 0"'"  '  ` "  ' `, `0     8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '  `"  'U     8 `    $ 0@  "@` 5   ?# -H /f * ' > "ӝ "   > 2`` 2`"""2H 0"'"  ' `"  ' `4> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > "C "   > 2`` 2`"""2H 0"'"  '  ` "  ' `4 `8     8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '  `"  'U     8 `    $ 0@  "@` 5   ?# -H /f * ' > "ҕ "   > 2`` 2`"""2H 0"'"  ' `"  '     8 `    $ 0@  "@` 5   ?# -H /f * ' > "B "   > 2`` 2`"""2H 0"'"  ' `"  '      8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' ` " ` '>  <`> > !@ *`!  $` ?2$ >  $ `?2$ >  $ `$$ `,$ `0?"$ @[#$ `4$ `8?"$ @R#$ #\#` P䰒 "c .Q  @ " ' ̘ G>    @ "  ' ۳ .'  @ " ' ۞    ܒ&薒    'ؒؖ & 0& X  ! *@    %  " &@X @`"<? ߰ < ۰ 'pSU x 2&@ @`O " &@*@%    @ 2&@@eM&@e|&@2@    @  Upp8"    $` @ > " B: `  (%  n @ f UA@e&@e0&@> "   B`B ; ;   ? $ H Ԗ'R Ę` ?     `8 ` ``$`0 `  " $uS `  ?$@$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "  "   > 2`` 2`"""2H 0 > ׻!X"'" '? @" 'R`#@` " RIa ڶ Z`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > "ϡ "  >  2`` 2`"""2H 0"'"  '   #  ' $ ? ?      8  `    $ 0@  "@ s   ?#j 4h      8  `    $ 0@  "@ >?  ?#5?2H /f * ' > " "   > 2`` 2`"""2H 0 > Ȑ!X"'"  '? @# '#@` " X Œ $Xr#\#`   ǖ| .b ,''t  @ "` ' x |x@   tژ |t$|8!   @ "` ' x |x@``@|# H` ?@ "   'ǘx |x p  }R`Ā2 X`@ 2X|#̰ 0'ynp W|pG 'l  @ "` ' ؎x |x@   l |l'h  @ "` ' lx p|x@  h d| h 'dd Y|d&@#n| ( %  ] @%  R`Ā^`@| WbG'`  @ "` ' x !|x@   `٥ |`'\  @ "` ' x |x@   \ك |\ 'XXx |X  @% Xxp `}Ҕ y| *@s% pG 'T  @ "` ' ׫x |x@   T3 |T'P  @ "` ' ׉x |x@ P  | P 'LL v|L  }n |"a}0 *@r% Xxp p|"m0ȀG 'H  @ "` ' 7x ;|x@   Hؿ /|H'D  @ "` ' x |x@  D؝  |D '@@ؒ |" 3@ 2   @%   "  (%  @"&@ p 2 &@pd"PX&@!|@` @` `` `\"` P<`" `@~     X`@ ?  "&@ (% &@㿘 `< 2    p" 㿘 `< 2    p pX> !`B :"  D a 'R Ę` ?     `8 ` ``$`0 `  " $uS `  ?$@$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "˚ "   > 2`` 2`"""2H 0 > H!X"'" '? " @'R#@` #? R|b` C "[` ֐0`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > "- "  >  2`` 2`"""2H 0"'"  '   #  '|u `#\#` 䰒 " R . "'  @ "` ' ; 5@   ܒÔ薒 )䀦 )  @ "` '  @ / H0 p얒  # 0 pX  `` = B "   0  H0 0 >  > `B : , P Ԗ'R`Ę  ` ?`  ` `8 "``$`0` ` @" $sS `  ?$@$jS 4hS      8  `    $ 0@  "@ ;?  ?#2?/H /f * ' > "  "   2``5`"""2H 0 > Ѽ!X"'" '? @" 'R`#@` #? R{Jb Է [J0?`  `8`"``$`0` ` @"  4 `  ?$@ ,H /f * ' > "ɠ "   2``5`"""2H 0"'"  '   #  'z     8 `    $ 0@  "@`  3  ?# +H /f * ' > "K "   2``5`"""2H 0"'"  ' ` "   '`#@` #`#`` #@`#`#@#\#`!` ՚䰒 "| .9'  @ "` ' P m@   ܒٔ薒 b܀ X  @ "` ' / L ` 'ؒԸؖ A  @ "` '  -@$  j  % 2      > pX !'P P "`` =B'L    L>  5> > `B :ࠀ  ? 4 X ͹'R`Ę   ?`  ` 8 "$0  @" $rS   ?$$iS 4gS      8  `    $ 0@  "@ :?  ?#1?.H /f * '  "   2``5`"""2H 0 > Ϣ!X"'" '? @" 'R`$ #?Ry0b ҝ [0L  8`"$0  @"  3   ?$ +H /f * ' dž "   2``5`"""2H 0"'"  '   #  'x ]    8 `    $ 0@  "@` 2   ?# *H /f * ' 0 "   2``5`"""2H 0"'"  ' " `' $` $  $L @$ W$    8 `    $ 0@  "@` 2   ?# *H /f * ' Ւ "   2``5`"""2H 0"'"  '  " ` `'$ $ $ $ؔ 2#\#`! ` _䰒 " .   @ "   ' ٘  >    @ "  '      @ `?'  @ "  ' Т   ܖ +薒 ܀  b   @ "  ' |  6@% " "@;` `` b >`&`` `2 " #2 Аw_ %@·  P "wN   'ؒŐؖ e؀ `\"`E%d> L "&`hX ! ` "L wZ$ ->  > " ؖB: ` `0`T  < 'R Ę` ?     `8 ` ``$`0 `  " $uS `  ?$@$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "2 "   > 2`` 2`"""2H 0 (> !X"'" '? @" 'R`#  " Rvn` ے "Y0`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > "ǒ "  >  2`` 2`"""2H 0"'"  '   #  'v   ?  ?      8  `    $ 0@  "@ t  ?#k4i     8  `    $ 0@  "@ >?  ?#5?2H /f * ' > "? "   > 2`` 2`"""2H 0 > !X"'"  '? " @'#  " u|  | v    8 `    $ 0@  "@` 5>   ?# -H /f * ' > "В "   > 2`` 2`"""2H 0"'"  '>  t`" * `'#?Z    8 `    $ 0@  "@` 5>   ?# -H /f * ' > "u "   > 2`` 2`"""2H 0"'"  '>  1> `"  '#W#     8 `    $ 0@  "@` 5>   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '>   `" ฐ '#    8 `    $ 0@  "@` 5   ?# -H /f * ' > "ǒ "   > 2`` 2`"""2H 0"'"  ' `"  ' #    8 `    $ 0@  "@` 5   ?# -H /f * ' > "s "   > 2`` 2`"""2H 0"'"  ' `"  ' #    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  ' #,> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > "Ē "   > 2`` 2`"""2H 0"'"  '  ` "  '#, #0#     8 `    $ 0@  "@` 5   ?# -H /f * ' > "k "   > 2`` 2`"""2H 0"'"  '  `"  'U#    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  '#4> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '  ` "  '#4 #8#     8 `    $ 0@  "@` 5   ?# -H /f * ' > "c "   > 2`` 2`"""2H 0"'"  '  `"  'U#    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  '#?     8 `    $ 0@  "@` 5?  ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '?  " N`'#L 2  y#     8 `    $ 0@  "@` 5   ?# -H /f * ' > "\ "   > 2`` 2`"""2H 0"'"  ' ` "  `'> ! > ؐ!*`  >  $$ $ $ ,$ 0?"$ @ؒ#$ 4$ 8?"$ @ϒ#$  #\#` ͚䰒  .   @ "  ' F  D!  @ "  ' *   @ = Hۀ    ?@ "  @ ' XiƔ  /  @ "  '  "   @ "S  TC T 0~'耦 ؖ 'ؒV薒 s؀ "S  @,  d  @ "   ' Ȗ G>     @ "  ' | -   @ `?'  @ "  ' ]   В薒 l  Ѐc䀦  "R @A&@> i#`Ɛ 2`" Ru㿐    2 Rh  f h` `X  `' b  ` ``9>  ;> (" B:  ` `(`L  < '`R Ę ?     8 ` $0   " $uS   ?$$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "# "   > 2`` 2`"""2H 0 (> ѐ!X"'" '? @" '`R`#  "` Rn_`  ̒ "Y 0  8` $0   " 5   ?$ -H /f * ' > " "  >  2`` 2`"""2H 0"'"  '   #  '`n    ?  ?      8  `    $ 0@  "@ t   ?#k 4i      8  `    $ 0@  "@ >?  ?#5?2H /f * ' > "0 "   > 2`` 2`"""2H 0 > ސ!X"'"  '? @" ' #  "  mm   ڒ m z    8 `    $ 0@  "@` 5  ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  h' #    8 `    $ 0@  "@` 5>   ?# -H /f * ' > "k "   > 2`` 2`"""2H 0"'"  '> `  "` , `'`H> .#> .!l# l "l8##?Z    8 `    $ 0@  "@` 5>   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '>  #> `"  '#W#     8 `    $ 0@  "@` 5>   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '>   `" ฐ '#    8 `    $ 0@  "@` 5   ?# -H /f * ' > "U "   > 2`` 2`"""2H 0"'"  ' `"  '`#    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  '`#    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  '`#,> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > "R "   > 2`` 2`"""2H 0"'"  '  ` "  '#, #0#     8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '  `"  'U#    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  '#4> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > "J "   > 2`` 2`"""2H 0"'"  '  ` "  '#4 #8!#     8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '  `"  '#    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  'y#    8 `    $ 0@  "@` 5   ?# -H /f * ' > "I "   > 2`` 2`"""2H 0"'"  ' ` "  '`> > ! !*`  >  $$ $ $ ,$ 0?"$ @Œ#$ 4$ 8?"$ @#$ #\#`   䰒  .   @ "  ' 3  `D!  @ "  '    @  * Hۀ    ?@ "  @ ' `Xa  /  @ "  ' Ԙ `"   @ "S  T0 T 0~'耤` ؖ 'ؒC薒 s؀`" J    @$   d  @ "   '  G>     @ "  ' i - `  @ `?'  @ "  ' J   ВҔ薒  Y  Ѐ P䀦   #4 Jp    l 2   @9`" ?c``Ɛ 2``" ` ^Œ JE0   `<  `5 `D  $  f 2 (:+   \    @/ "     2 @#} > #ܐI$I`" ^u  ^p 㿘   @ pX> ! `B  :਋"$H  'R ` ?     `8 ` ``$`0 `  " u`  ?$@l4j     8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "ƒ "   > 2`` 2`"""2H 0 > t!X"'" '? @" 'R`#@` " RfaS Ēn Y0`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > "Z "  >  2`` 2`"""2H 0"'"  '   #  'e   ? ?      8  `    $ 0@  "@ t  ?#kh     8  `    $ 0@  "@ >?  ?#5?2H /f * ' > "Ӓ "   > 2`` 2`"""2H 0 > !X"'"  '? # @'#@` "e  ~  {#\#` P䰒 " 6l . d  @ " ` ' ʘ G> @    @ "` '  - ` @ `?'  @ "` '  @  ܒ薒   ܀`Ɛ 2`" 㿐   X`X @     "&  X@ D "  D (   `2  < @! 2  \ G  #\#```@A [ `" <[  < @  < 7s7q@Gd G- G(GYGW " 㿐` ` #\`#`@`pX> !@``B :   ?  H@ 'R ` ?     `8 ` ``$`0 `  " u`  ?$@l4j     8  `    $ 0@  "@ =?  ?#4?1H /f * ' > " "   > 2`` 2`"""2H 0 > ̐!X"'" '? @" 'R`#@` " RcZbS Ē Z0y`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > " "  >  2`` 2`"""2H 0"'"  ' `  "`   'b  ?      8  `    $ 0@  "@ t  ?#kh     8  `    $ 0@  "@ >?  ?#5?2H /f * ' > ". "   > 2`` 2`"""2H 0 > ܐ!X"'"  '? # @'#@` "bl  ْ R   ?      8  `    $ 0@  "@ vS`  ?#mS`4kS`     8  `    $ 0@  "@ >?  ?#5?2H /f * ' > " "   > 2`` 2`"""2H 0 > D!X"'"  '? @" 'R`#@` " Raa``> Z`0    8 `    $ 0@  "@` 5   ?# -H /f * ' > "* "  >  2`` 2`"""2H 0"'"  ' `  "`   'aq `wp ?` ?      8  `    $ 0@  "@ t  ?#kh     8  `    $ 0@  "@ >?  ?#5?2H /f * ' > " "   > 2`` 2`"""2H 0 > P!X"'"  '? # @'#@` "`  M `\#\#` 䰒 "6 .  @ " ` '  > @    @ "` ' ~   ` @ `?'  @ "` ' _ l@   ܒ薒 `܀   @ " ` ' 9 F@@   @ "` '   -` ` @ `?'  @ "` '  @  ؒ薒   ؀` Ɛ 2`Ɛ 2`" `" p     XX  `> #܀Cf Bܐb `  `` X> a`B :`" D ' R Ę` ?     `8 ` ``$`0 `  " $uS `  ?$@$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > " "   > 2`` 2`"""2H 0 > !X"'" '? @" ' R`#  "  R_#a  Z0`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > "| "  >  2`` 2`"""2H 0"'"  ' `  "`   ' ^ R   ?      8  `    $ 0@  "@ vS`  ?#mS`4kS`     8  `    $ 0@  "@ >?  ?#5?2H /f * ' > " "   > 2`` 2`"""2H 0 (> !X"'"  '? @" 'R`#  " R^0a`` "Z`0    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "  >  2`` 2`"""2H 0"'"  ' `  "`   '] ` Ր: ?  ?      8  `    $ 0@  "@ t`  ?#k`4i`     8  `    $ 0@  "@ >?  ?#5?2H /f * ' > " "   > 2`` 2`"""2H 0 > !X"'"  '? @" '`#  "` ]=` ` =`#\#```  |䰒 "6` .'  @ "  '  n` ܒ}薒   i`  @ "   ' Θ G>     @ "  '  -   @ `?'  @ "  '    ؒ薒   `؀`> #``Ɛ 2` "  " "T5 T0 ?} " h> X" в `B   ; @   ` `L`(`  < ?`'R Ę ?     8 ` $0   " $uS   ?$$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "x "   > 2`` 2`"""2H 0 (> &!X"'" '? @" 'R`#@` " R[`  ! "Y 0G  8` $0   " 5   ?$ -H /f * ' > "  "  >  2`` 2`"""2H 0"'"  '   #  '[U   X  ?      8  `    $ 0@  "@ t   ?#k 4i      8  `    $ 0@  "@ >?  ?#5?2H /f * ' > " "   > 2`` 2`"""2H 0 > 7!X"'"  '? @" ' #@` "  Z  ` 3 [``?Z    8 `    $ 0@  "@` 5>   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '>  1> `"  '#@`W#`    8 `    $ 0@  "@` 5>   ?# -H /f * ' > "’ "   > 2`` 2`"""2H 0"'"  '>   `" ฐ '#@    8 `    $ 0@  "@` 5   ?# -H /f * ' > "l "   > 2`` 2`"""2H 0"'"  ' `"  ' #@    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  ' #@    8 `    $ 0@  "@` 5   ?# -H /f * ' > "Ē "   > 2`` 2`"""2H 0"'"  ' `"  ' #@`,> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > "i "   > 2`` 2`"""2H 0"'"  '  ` "  '#@`,`#@`0#`    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '  `"  'U#@    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  '#@`4> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > "a "   > 2`` 2`"""2H 0"'"  '  ` "  '#@`4`#@`8#`    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '  `"  'U#@    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  '#@ ? ?      8  `    $ 0@  "@ s  ?#j4h     8  `    $ 0@  "@ >?  ?#5?2H /f * ' > "/ "   > 2`` 2`"""2H 0 > ݐ!X"'"  '? @# '#@` "Vm  `ڒ `mq    8 `    $ 0@  "@` 5>   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '>  > ` "  '` @&& & & `,& `0?"& @F#& `4& `8?"& @=#& #\#`   ;䰒 "` .`   @ "` '  @`D`!  @ "` '  @  @  Hŀ   ?@ "  @ 'w XO6  `/  @ "` ' W `"@@   @ "S  T T 0h'耤`  'ؐؒƔ薒 ]  @ " ` '  G> @    @ "` '  -` ` @ `?'  @ "` '  @  Ԓk薒   Ԁ`䀦" 8 > #``Ɛ 2`" L 8 " h> X"    Ȳ  `B 'К ; Ȫ`$`H`  < `'R  ?     8 ` $0   " u  ?$l4j     8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "Ғ "   > 2`` 2`"""2H 0 > !X"'" '? @" 'R`#@` " RTaS Ēz Y0  8` $0   " 5   ?$ -H /f * ' > "f "  >  2`` 2`"""2H 0"'"  '   #  'S ڰ ? ?      8  `    $ 0@  "@ s   ?#j 4h      8  `    $ 0@  "@ >?  ?#5?2H /f * ' > "ߒ "   > 2`` 2`"""2H 0 > !X"'"  '? @# '#@` " S  ` `D`?Y    8 `    $ 0@  "@` 5>   ?# -H /f * ' > "n "   > 2`` 2`"""2H 0"'"  '>  1> `"  '#@`V#`   8 `    $ 0@  "@` 5>   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '>   `" ฐ '#@    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  ' #@    8 `    $ 0@  "@` 5   ?# -H /f * ' > "m "   > 2`` 2`"""2H 0"'"  ' `"  ' #@    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  ' #@`,> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '  ` "  '#@`,`#@`0#`    8 `    $ 0@  "@` 5   ?# -H /f * ' > "e "   > 2`` 2`"""2H 0"'"  '  `"  'U#@    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  '#@`4> # [    8 `    $ 0@  "@`  5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '  ` "  '#@`4`#@`8#`    8 `    $ 0@  "@` 5   ?# -H /f * ' > "] "   > 2`` 2`"""2H 0"'"  '  `"  '#@    8 `    $ 0@  "@` 5   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  ' `"  'o#@    8 `    $ 0@  "@` 5>   ?# -H /f * ' > " "   > 2`` 2`"""2H 0"'"  '>  > ` "  '` @$$ $ $ `,$ `0?"$ @;#$ `4$ `8?"$ @2#$ #\#`   0䰒 6  . `  @ "` '  @ `D`!  @ "` '  @  @  H   ?@ "  @ 'j XH)  `/  @ "` ' J `"@@   @ "S  T T 0j'耦`  'ؐؒ薒 _؀`d  @ " ` '   G> @    @ "` '  - ` @ `?'  @ "` ' Ԙ @  Ԓ\薒   Ԁ`Ɛ 2`"  ` " 0    @ а  <`2  " 0  "EW " > #0ѐp  X   b00 > #? > " 薂B:  ` `$`H d'R Ę` ?     `8 ` ``$`0 `  " $uS `  ?$@$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > " "   > 2`` 2`"""2H 0 (> K!X"'" '? @" 'R`#  " RL`  F "Y 0`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > "2 "  >  2`` 2`"""2H 0"'"  '   #  'Lz    ?  ?      8  `    $ 0@  "@ t   ?#k 4i      8  `    $ 0@  "@ >?  ?#5?2H /f * ' > " "   > 2`` 2`"""2H 0 > X!X"'"  '? @" ' #  "  K   T | #\#`   &䰒 "6m  .e  @ "   '  G>     @ "  '  -   @ `?'  @ "  ' f   ܒ薒 u   ܀l > #`Ɛ 2`" "`C  `C .. "     '`X!`< `'d   ` 2`` 2`JƖ 2` Ā@2 `>  `B : `!'\` " ư  \@’  .Y0  "@ "" @b ! $Y h'X > c'h'$ 'l'X't$'?x'p'@ p@d #@2@*@%@   p@xd #@" ` q ,       @ &``  `h` ?2* `2 @ Ւ  '`` `  d > Z`   `"  ZW  " "@@""@`"=``2 d > `\ 2  > (`B :(  " "`X>  '`  Ъ  ` "'L'P'' '> b`B :  D  ̐  'R`Ę  ` ?`  ` `8 "``$`0` ` @" $sS `  ?$@$jS 4hS      8  `    $ 0@  "@ ;?  ?#2?/H /f * ' > "A "   2 `5 """2H 0 > !X"'" '? @" 'R`#@` #? RIc 찒 \0`  `8`"``$`0` ` @"  4 `  ?$@ ,H /f * ' > "Ւ "   2 `5 """2H 0"'"  ' `  "`   'I h    8 `    $ 0@  "@` 3   ?# +H /f * ' > "} "   2 `5 """2H 0"'"  '  " `'#@`#@  ` 2 #@`Y#@ #@ `S#@    8 `    $ 0@  "@` 3   ?# +H /f * ' > " "   2 `5 """2H 0"'"  '  " `'#@`В#@`#\#` L ܰ " .?'  @ "` ' #ؖ ^@   Ԓ SԀ   @ "` ' ؖ =@' `' 0>  @ "`' ؖ !@  @ "@ `  ' Ϙؖ  ` `   @ "` ' ؖ @`?   "`" (``  5`@@ "@@" "`"@ &``8 3+ @@2 %-`5`-` ` @&` "@`? "`ٔ @$@+@@"@@""`"@&`    "    Ò 0'  @ " ` '   @ "` ' (ؖ c؀ "%@'%`@'%"```@ .   @ "` ' ؖ 5@`?܀ > "`"@ 5`@@ "@@" "`"@ &`    P  ? P "@ H0  0` > !X'| 'x` ` |"'L'P''' 't 'p> "`B :p  \R``  ?'   `8 "``$`0` ` @" u`  ?$@l4j     8  `    $ 0@  "@ =?  ?#4?1H /f * ' > "ܒ "   > 2`2"""2H 0 > !X"'" '? @" 'R`#@` #? RF S Ē     8 `    $ 0@  "@` 7   ?# /H /f * ' > "q "  2>   > `2"""2H 0"'"  '  " `'#@`#@  ` 2 #@`#@ #@ `#@`x`#@x#``#\#`L  < .'  @ "` ' e @        @ " `  ' D @`' @' `  @ "@ `  ' * ` ` І@ t "`" (`'t 6@@ "@@" "`"@ &``8 `:+ @@2 '"`t`'t.6.'t`@&` "@?"@@% %C @$@,@@"@@""`"@&`   "    - 0k'  @ " `  '  V` @'"`@'"``@ `` @"S  T T 05'  @ "` ' m  @L  @ "` ' V  @``@`    "    ' : W Ā2X @t 2X& '=   ] '? '' (> ؒa*@  2 .|@"  % F`@%@  3|`x`,  @ "` ' ט   @ ` "    8 0v''    @ "` '  [@ `g   @ "` '  ?@`? `2> t""@  6@@ "@@" "`"@ &``$      ? P "wsn Hi  ` > <!&㿐` ' Q} ^ $%$ `< 2> !2  `4> M   $ @W $  `*`:  z,  @    @  "` &? ^yR hX> !`B ": `$`H ܖ 'R Ę` ?     `8 ` ``$`0 `  " $uS `  ?$@$lS 4jS      8  `    $ 0@  "@ =?  ?#4?1H /f * ' > " "   > 2`` 2`"""2H 0 > Ð!X"'" '? " @'R#@` #? RBQ`  Y0`  `8` ``$`0 `  " 5 `  ?$@ -H /f * ' > " "  >  2`` 2`"""2H 0"'"  '   #  'A e ? ?      8  `    $ 0@  "@ t  ?#kh     8  `    $ 0@  "@ >?  ?#5?2H /f * ' > "# "   > 2`` 2`"""2H 0 > ѐ!X"'"  '? # @'#@` "Aa  Β aπ`#\#` 䰒 "`` .  !  @ "` '  @``@ + H` ` ?@ "   ' z@`"%U`R`Ā @ '܀`@4 `P `R Ā`@ ܀`@ O# "`ܐ@ 2 Ā2 X`@ 2X# :ܰ 0P -'  @ "` '  "@  ؖ %薒 ؀ @ 䤰 0 'ԐԒ薒 䘰 `䀧`@  #0'@pX!  > "!( B:!( DWR ` ?'`  ` `8  ``$`0 `  " u`  ?$@l4j     8  `    $ 0@  "@ =?  ?#4?1H /f * ' > " "   > 2`` 2`"""2H 0 > A!X"'" '? " @'R$ #?R? S Ē; ΐ0    8 `    $ 0@  "@`  5  ?# -H /f * ' > "% "   > 2`` 2`"""2H 0"'"  '  #  '$$ $ #\#`!  䰒 z .  @ "$  ' 5 R>    @ "  '  9'  @ "  '  $   ܒ薒 䀦 &  @ " '   0А@  > !1㿘  "  `X P AU2` $ 㿘  0`  > ! 0  > # 0 4ِ 5㿘    @ 8`'`X?!?''L'P*  !@  '  `X!@X V H /d4`p* %`p A > @  0 22 Y 0- $ 0"@  T:  `3`+ +` ;B  2 ` ( `   ` d"@ @ :`C 8 @      H 0 HP&@!1 x`X 7,  0?c $ 0 4&H /d * %  `t`'`t 0$ d$ 0 0? @ $ `$ 0H 0͓,H /d4`p* %`p Y @ >  0 * L 2K2H 0  $ 0`rF H 0 P `a> !Ī *`' 0 > "  0 2  0  0$ 0H 0>0 H 0L `3H /d * % > (&iH 0 ?P a > !Ī *`'`p  _ƀ  ?2ư 㿐   #\  | 㿘 >  "8@< <`2> A/> "` 㿘 @ 㿘>  0#  0 2 \> d"h? 0a & 0H /d * %   2  \" \`0 "`0 \`t "`tH 03@`  j` T:  `4`,  ,`  d0@ :`C O  0 Oאm o 2%   $ , $ 0& 0 \ ,7 0@* & 0` `0O` 0& d ?& 0& `H /d * %  +H 0 `!1@` \`X`  0@ & 0=ɐ2  ؐ `0 "`0 w0   X @`  <        ;  2   $  E㿘  Ɛa'2>  <> *` €㿘  Ɛb'2>  h> *` €0 ` Ɛ c &> ؐd4 `D` > `X @`> ؤא ƀ!" ' ' ƀ""  ' '  ;> #> *` €㿘  Ɛa&2>  <> *` €㿘  Ɛb&2>  h> *` €0 ` Ɛ c 0a" &  ƀ"" &  Ɛ$4 `D` > `X @`> ؤs ƀ!" ' ' ƀ""  ' '  ;8> #> *` €㿘?_5㿘'@`  0  >%@ @   `> " ; > "؀? > "2  Ā Q   ">  `  ̡, < = (@ d$ ? ԓ>  @`Ֆ " $A6 2  `@  ``h"`h@b>#,@u `  ``  B; `  $`'@@`   > > c#( > #@X 㿐\'􀥠 % `0 e@> @ 2  ?  @  > `0#h`> #2`> # " ````̡,`< =1`(@ d$ `  `.` ( .`  t > `0#`z >  `h/"`h ?l ': @`! `@@    `֒ >` B;  $`dT,@" >  8u`$6 `2'`<`0<`(@ `̀@)>> `X ڔ`!$``<`(<@v d`̀@`0>  `ɔ`Ԑ $`>  `> p >` h ."h>#,@p $B`@X @@ @ 6  `T&?  @   `ו>`   >` B;  $`d,"T0""0H@i%` 2" > > `c#( g> #@)  '@_ > #`'   $   `@`  P#> `, @Td0@ ߓ: 2 ސa&``. d 8'?> , `P " ǐ(,   T+@> , `T " !PT@:T@:25 Ȥ @N 2,  @N 2# `*` ( * ?0?  ; 0   H@` *` * ? `@` *` *  2 > Q! '@ ?0ؘ π@ H'@3>!@F . X ` `Td0@ : 2`> !`Td:  > ! X @@ "+% (<0#\`<@#`0@* %<#\`  #`@+%8 @  (> c| #@@> | ` %`   @ > c|   0  X @@  ``Td0@: `d,@ "T``Td0@ : 2> > !#`> "8 @դ @69 ( 2 㿘& Ȁ <@ 2@,:@: @<@ L @   *@ @ ?*@  > L@D  X  @ z0  ` ` `  `> ">  "8  `2h 2  '  "#  `  `h : " h" d   > "Pp  `  ࠒ :  `" X  ` l`   P`  ` `l  "`l * "l`P "`P 2   ` * "P `    l`   P` 2 Pl? 0 "l?  ` "P > > c"p Ŗ> " 㿘 `,`@\`@X`@T  @`">`M `,@`* `,` cP*  @ 6 `& `&  ` `cP@ 6 `& `&  `  @ < @: , ``8@ & : , `49$dd9 ` `09@% &@א @8  @͐8 " `,cP*  6& &cL @?  6cP6& &cL @% 6 cP*  6   cP @`8 㿘 `\@ .? 2J`8`t @  @``N .?   @`@B@>` `,@l`@5cP*   6$`  8 cP @ 6``, `X (& * ``*  " `@0 $b88`8 80`D8.``|*"@ *`@ @*`?@8!`8㿘  "`,. @@6&@  , `,@   ݲ``,@"   㿐 .`P@T'` : 0? 8? 4ɰ  77Ò.@   d?`,  @HbU  > #Ԁ  > C  > 0#$ @T>6!8@"U    :`c `   ?":@ ؘ 璀 8" # 4@"U   ` :`c `   ?":@ "T T> # *`@ ?#@ #*`@  #@ T>/ @"U.`   ` :`c ` `  ? "(*@* $ $ $̚`P?$̒@` ?"`  , X @@ @%|/㿐 .`P  2 02  66.@   d?`, G @ HbU  " #Ԁ   > 0x> #$ 02 T@08>   4. `   `@ `@ "`@ I  L@@8 .`# 4@"U  ,` :`c `   ?" +@*8`@8  $"@ $ $̗+`P@ $̔  " ,   0W@   0L@.` 4!,`@"U  ,` :`c `   ?" +*@`*@ $ "$ $̀P"$̒@` ""` , ? $@*`   6X @@ @$}0㿘'H`  `H@Đ (8 @@bU ``@ > 2`X ӸP ϰ|5Ӑ@@bU| -TT  @"U"X-  5* 5@@q55@@5@@5@^@,`U` @`@ ,`U`$`@,` @,`U 4 U `@,`U`$`,`U c @d5c%`@*. L -`#\ T 5R* T? ?> "> "2T-`#\58* @T"U`@Q 2(`L?2Xe` `:@ $ > "q> "8@i 6$(w ,`@bU >`@J?@$Ē$ P* "4|@|4Ր@@4|4ː@@4@4P@* @"U@-  XP4 * @?4bU -`TT  ?",4 ``X@ H@"㿐` .`T 6` ° 4z4u.@   d?`, ј @ HbU  " h#Ԁ  h.$      `@ @  @ T.``$z"  t" @"8  @"`:  l:`*  & *@   p *`    @   A @& @"U)>  # `@ 2`# @$ 3`*@ @".> #@ @3> ʔ"8cp@@0X 㿐 .`P  2  33.@   d?`,  @ HbU " #Ԁ > $ 0#$ @~  :`b \  ?&:@ X.` 0` `:" ``` @"U@: \ @ǒ  @"U@ " \ @ 2   0> #> #@"U@"  \ *  .`  *> #{> #$ 0 X @@  3@!8 @"U@: \  ?  &+@* <?$ Ȗ P$Ȕ?"  ,  $ P`$ "2ɐ㿐 08 @> @ 2  8T@>  $  > 0  > | 8@l$@ >   P>   c  p  > Ԙ h 0 22-@   d?`, ۘ  0@HbU`  > cԀ >  0#$`@Y0 u`@`bU >@c``@@  2 ` >  x>  @"U@"``cؒ@@  @<`-` $`ĐP $`"2|@|2@@2|2@ @2 @2P@* `@"U@,  @`XP1@ * @ 4`bU ,`T8?.@  `@"U@:c@``@    " %  : :@ `4?@ ^T > >-`@"U> @,``:`c@``@ ` `: *`#@: " ` x > k "``c@@ ` ` ?#@  *@ + ʚ``$$`$̀ P@$̔ "  `@"U@:c@``@  8 " %  : :@ @  `@`"U@= c``@@ k b`$8 " $`$8̐P#@$` #@<#` ``$`P$`"1 |@|1@@1|1@ @ 1 @1P@* `@"U@,  @`XP0@ * @ 4`bU ,T@`T@@ @ "@ ,㿘 X`@ @ @' 㿐 ,0@*>   @ 00,   d?`,  50i@HbU   > #Ԁ > ' [ #$ @g @bU 6` \ `:   > !іLҀ`2 > <!8 @"U@6`b \  +@* * 0@*$ 0 , $ <P`$Ȕ     " ?$ P$ ?" ,[ 㿐 0  @> @ " $> !` > !@*> ! @ؒ0 @ђ* 0  d?, _  0U@HbU  " #Ԁ " F @ސ0  @"U@# ``@ >@ .T >@ ! @"U@,   ; # ` ` ` ?#@; 2` ``@ > z!<`?㿘 @    `, &  ` : ``@:bU "@``@@ 8> #*  ?"? *@ @ *`@"U@ c``@ 8c*  ?"? *@ @e 2 > !  > "&.  &`,:.@"U> > `     `:`c@``@   8 "& &  : : @ @*`@ @ @ + `@ * 8Ӏ > "(^ > ͐"@ 㿘$l h>`.`# (.> . # (.@.$p@8(& .` . @ ` @  '? 8(! .> @ ?@ !$ 4/  ".  ". "$ (T  ? .`.`&(  P'T\'X@ <0 @ ?'> "2%6 ܰ P @5   40 *@   :` 8 20   8 20 @8 0L`8@   @ @0 @ N `J (\#`#\0T `X @@ . > (#\#`#`   @0 :P@ <  @  `("@   % X`   ,(   P@Α:    0? . C <D@L @  @ Ґ?ߘ " 0 (Д#`T#\ `X @@ _<#\#`#`@<O P@o:   2 0 (0DL  (TB Ȁ  %X`d*@ " TH@/<" @`X @@ <#\#`#`@    (" `% @?  4 > "'*` X J' ; 0T , 'Ģ0 Kd'. <"T@H"@`X @@ #` : #\  0@ l  *  X" '`%  a`* [.` 2 0  0T .`$@*  0 d'. <"TH@~`# @`X @@ $ 0*` *  @w* * *` & `&'X.`_.`* ?0 }H*@ Py0T% c$@0  d. '"TX`H@<" @%`X @@ <* #\#`#` @* X*`& o k f X 0?& V0 9 'd. " T%J EA@  @0ٲ`0@ `""@?* * 0 "> X"@*X H`& ?  < T@N  h""h `% 㿈 `X @`   ?%  @    ?%    0@-"``8"`5`I"`T"`Q `"`  d"`$  $   ``  "` @ ::   `` "` "`D  "'   `  "`  ::(  ` "` "`@ H`B = H  "   ` : :`0  ` "`H F ? % e\aT 2  e, 4   `r2` v2 ` @*`@`* *`` @@`x``?* `d, `0 "`X-06 @@ @0`x  `   R   >  `x R  > ~K# `x@R  H*  '  `X @`@( 'T   < `2ذ   `   @   @2< < DX D   :`82D 82D@ D &h "" > }ސ#@ p(     :  @|  `    :@Lސ 2v@+& (& ,& 4& 0X @@ 94 > > @6<  > # T' "' S  `  h  @M/?@L> # T  c  `&   T   `     4e0IGe08 e4    T#\`D  T  " :  ` : @@%T T  `&    ۰@e<2 `P  ` : @    T#\`D  T  2X @@ & 4% e8`L e@`0 B 88   2 @ ( !> #T&  " :   ` :  40`0`P *  : `   `8 2`0 `  `8 2`0`@8 `0`L`e8e@   @@ @ @<`T$H@{ӐT{T`0: T`0 : D`P@fB?'`t$ '`t($'`0U:` 'Le\!   p&  < (& < X  ?  6  `  X" ,` І 8"      ` . (" . p ;4  ` &    e\U!@  p% < `p% < :  (% < `(% <  ` :    >  > T  ̐?'`t"@ '`t ( ܶ "@'  `  ,` X   X$",`  ԡ,`#`d. @zP 2P`  `,`  Д   ;`0L Ƕ ]  `  . (   . (" .  t"E  `.  p   ; 40`0`P *  ` :  `8 2 `0 `  `8  2`0`@8 `0`L` e8e@   @@ @ < 4 &   ` -(   -@ t } 4,`0`P*@   :`8`L2`0 8 `L2`08`L`0 e8`e@ :  @ @   ` :  41`0`P *  ` :    2!`0     2`0@8 `0 `L` e8e@   @@ @  # > zÐ#pd:  `h"k"`h  `T:  <     0> @  :`,`X@: @ `,`@ ㈐@  @ "`z`ߖ > .@   :`( :`  @ .p@ 㘐@  @ "zh .  ` :   `  ` ; B;` `& ?@I 㿐  ''P'X    t&_?P@x 0:  Ҙ `0" > #`, ",`0`<@ `8$`0$$`T> z #%" PȐXu"?"`H0 1ڔ 0#t, "@@y.*` X @`@ א 2'pt?&?&@,  d. ?? 2'0#?@ P @yג,  d. ?^ 2'36  X`0 $`0UX"㿐 `P @}m 4.`0 *@   :`   2`0      2`0 @8 `0 `L`e8e@   @ @ '?ۘ  0 e< H @ & '㿘 8> /  +-.`> > ऀ  '; ) @@2  8&/@/ 8 /`/  8܀ 㿐> #> *" *  < *  T:`   ="7 t 0@22 t \ -  # 2' t`   2! t < " t T@4 t: @$ t> #  <>  T;  #zG?> x ( t Ȁ㿘 8>> 0#  > @ `?>@ *  @ *  *@  `?>@ *` @ `?x @㿘 8 >  > 0 > .@>@ *` @ *` * * .@ >@+ * .@xW P㿘 8 >  > 0 >  .@>@ * @ * * @ .@ >@+  .@x, `㿘 8 ">  > 0 > @`?>@*` @*` *   `?>@>   w p::;; ;8;P;h;t;;;;;;;;;;<㿐> #> `!> $ L  > > b4#> Db  > yb#  F> > #HcP  b@  "x1R  b0$> " "@  #a "@a"`!  Ԕ Y @+ HN @    l ^ `@ @ @@U aL Ҁ#  ` @`@@   Ӏ  @`@* $`@@  Ӏ `@@2 L Ҁ 2 Ӑ@ $`@ Ӏ  `@@ L Ҁ  *@$`@ `@@0@c D`@@@< ` ! N ! L р 2 `@@> > #x Ұ #`x Ӏ   @@  , .  ,@v$#L   D# `0 @&(&&$&&, < " >  `@ ; "`@`@ !!`B  !F u`@@@#`  `  2 k g ( ` Y Z`" @u@ ~ Y Z`@@u$ ` Ys`@@u$ @W 4aP l` `H`&@`@@"& L Ҁ,  Ӑ  , #L/Ԓ  `@@   ?, Ӑ@  㿐`D @`)T `` M ``   "@> v#`` @xj"#`@xc`* "`` @x@xW`x``?* `d`0, o` "@0 x@x  H* @  t  `  R % 싰 vx@ '  `O     R  > u#`h ?> " (< @u?ܰ F HaT%\  0@@eg# h(8 0l `#P##P#T##T +  h h#@4`0"`0 %(@$%DH@  4@sA@ ##P 8 0 4!k$@  d@*@ ?ǘܰ /ܒHה 8 Ӏ @,%$ > ,  #T%$" , ''''M" 㿀 'L'?c  > "  L`L   L @   L?  L`h g " (> # '쀢?A FaT  /@쀢" 0  "0l '@r,찒 KU H%\a ?<`2 @2  0%g h@> ?Ȧ> c, 2   , L ѐ ?`, Ӑ `, @@> > #`u %L#u  %L? `   ,)!X@s!X h ," %`%\F!T@2 %` `H h` h#@0 "0'` ,  4?@r@ %$` ,*  +  $$#P 8 0 4 1$@  d@*@ 鍘찒 H' 8%$ Ԁ `/>  ,  $#T%$" , &&h "  " &l &l@%( &D&@ %`%@%` t %`$ d%`( 8%`," 6"@}"``" , $#L +  ,@r$#L!"`Ԓ" @rڐ%0=aPL 0 4 :    @x_ %0B? 8 <%0`%4 `<%0`F Ӏ @ ~ " #P-  #L , , @@   ?, Ӑ@˒ % #P, > t  O" 쀢 ` `  Lt` `,ؒ ,Ւ &㿘  *   @ &  %L?&  &%P%, 4&$ 0 *` * ?:   t:`>%0<  @w %0 B >%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿘6`@` `@ @B <L Ҁ 2` Ӑ` `, @;   "#L*, #L,_ `  ?"`  L Ҁ`   `?`#P,E ,B ,? @*@$@$㿘`@ a  ` % , `@DĔ  ,   ` O 㿘!F aTe\ "`4> r\ @&``0&``(&` `8}``̠ &``(`< :`: @w  @q d$ &``j`,?&``Ȓ H@ &` `Tݔ Z `ٔ Z!PaՔ l `D`@q   㿘 <  ` @ p `` ` `` 2&@`  㿀 L`Ѐ   L`Ҁ " '>  Ps`> q `'''`'> a*@ `` @ X 2䀢 2'耦` @@ 2  ``  2 c @EnL`Ѐ`@  2㿐a @8ג & > #0 ; > & iʐ"`@pВ > x    T$  > " c$ $$ $@8$ "W ː0@sْ༠@sҒ*  @tf@sx`?* d , 0 >  & i{!$@tHx H* @ ېX @@ " @#R>  `R $> > #,4@V/ " _& `   l * "l P`2<\  ` * "P `    l`   P` 2 Pl?  X "l? ` "P X`@2\ $\F!T@ ,  `"`p"t &㿘!`  `,`@  F@F  2@ "`  lP"` 㿘 ` `4?@n| *cP`8`0`4%``d@*@  ! H`@`8V 2`8&`8 6 `T`d@t@"  `h  ,`> c$` `hHeL?H"Pe, 4P8 H"@"P`:0潐0 2㿐> .p 2  !> ֠#("p> > #\"``   g > > #\!`   g  @ '@F 㿘`f ?``>"*` €> I" > C"> =#> 7#|> 1"> +"P> .!\> + > (#h> %#x> "#t> !L> !P> #`> !H> #> #<>  Fn >  F -㿀 `    ` > >  o``<)`X D   @ D 2  2   h :  >    2 > >  oZ` ( > >  oR` e0   2  e4@( 0  '@s'  ' *@  :`     2`0    2`0 @8 `L`0 `P`L e8`e@   @ @`0 e<  &@*<@<  @s=      > a    > Y  T> " `"$ $  ?#`#\ E ; 4*' * ` :  8`L2'   8 `L2' @8`L' e8`e@   @ @ @ '?#\#`2  ?  1%$`@$6`H&`H?h *'      ` @ b 4`P`8`P "  %x' '` > >  n1`` 2< E  > G> G> B> `   `  =`  `  d`  ,` X` $  `p  @l`f @"`0`2 `> > !mݒ`! mڒ`` ' ``@  %0B  2<%4@B < ``@` D  2    ;7 +   `  ? `` `׮ ` P@q ` %< 0 @`"* $ #\ <`   ` B   `8 - ` `8 $`8  0@ D : `@ D:  `   @Ⱀ '@⊐` `@  P` *  : `    2 0     2 0@8  0   L`%8%@ @@ @ "@&H= H@l8`" 0  > "` ` $  쇒  h &  " ` $``2.``(` "`  " `  `@ 32@` 䀢`    @@``' @ b %`=`` ` `   㿘 < 2   "   @@" @    `?H /d * % p  =# 0 $ 0  p _>  a+ 0S  0  > lC!0"  P &G  p  0`     0$ 0)୐ 0$ 0H 0 ✐0 SH /d * % p  "  *> H  H 0@ ϐ +H /d4p* %p   l< > !XH 0   औ  `?@ 㿘  @3 ``> eq!> "`em$  㿘/SSTDSSSSSSTT TT$T0PXPdPPpP|PPPPPPPPP|dd{P8888,@hD|`hhhh0Tlѐ8ҤϠ@8888(tttttԄ?" " " " "㿘 `&`2@   IH ` &@H 0  > #쀦``4 & @H 0  㿘 > > # `4 > j"H &&J?& 㿘  " > j"> 6 aT aT&"aT& > > #l`&" l"& > a,"l "a,㿀> #H /d> * %> "L> cd  > b@Ζ >  V`""`"@"LH 0  0> |+  €> % > ""> #L> #|> #> !`>  H> #>   >   > !> "d> "0d5 0> "`jb H /d`* %`$"L"LH 0 > "ܰ >  ""> b\  ?"b\> `   @#> $!I| > `   @#`> $`!In ->   `@#ݐ> $!I] `  @#q`> $`!IP ݐ"@'"'А"@''耢  "?H /d4$"L* %$"Ld > b@Ð `W"L`""`"@"LH 0  0> D+  €> % > ""> #L> #|> #> !`>  H> #>   >   > !> "d> "0cc 0> "`i H /d`* %`$"L"LH 0 ,   @> b`T 2R? > \> ?b`b` "\I 㿘 H /> * %> > aT""L `     !`@0Q    2 2  bLH 0 _ ?*@4 `"  "` "@> l > T `""l@ "l!,?bL#!,H 0   "  "    2  " @0"" @ C0" @0 " @0` > "*` > "> > "hȒb㿘`p  > h#H /d4> * %> ""L p$`p`""` "@`p "`p" &`p " "" ""  p2bLH 0 㿘> "\` '> #> "`"``$"` c0 F "`\ $"`?$\&@!#  $`@ &@` 1  `$\ `G㿐     2? "  㿘> #d`> c@@  >  X>  >  ጐ !X* @@ &   @  2  2  $2  2  '  @H F > A'>  !bL > H /d4$bL* %$bL ` @g  H$ 4  < $ $ ($ D  @"?H /d4$bL* %$bL@ $ @ "`&@$ !' 㿘> #d`> cP@ˁ > b> > `*  @  @2  2 &b > ]&> "d@    %>  @   %> ٨ %> '> /L H /d4"L* %"L#d> `$#d _"  ??4 $ $ 4 < 0$ $ $ ,$ 8$ @$ <$ D D$ H$ L L$ PH /d4$L* %$L@ $ @ "`$@$ & 㿘> b,> > `* @  @2 2 & %> &8ƒ > !_) $ $ $ @ $@" $@$ ސ8& 㿐>*> L>,>9>>9 ̘#c| D"`"`"`"` > "!> "aT> #> ǒ @i0aܕ, @ 8 > ""@d >  N8W > "aX> >  !b@s a>  O8H > "`> >  "b0d >  P, 89 @> "`> > #8b( U > >7!0cI !> ֠#(> > #\ c` H  ] > > #\"cp X  ]w > > #\!c   ]m > > #\#Lc   ]c > > #\#|c H  ]Y > > #\#c   ]O > > #\!`c 4  ]E > > #\ HcВ   ]; > > #\#c p  ]1 > > #\ c   ]' > >  `#\   ] > > !`#\   ] > > "d`    ] #\> > #\"0`(   \ 㿀Ӏ K ܲ0G@e* , @; ,@   d, a䰒 ,` H` $ '  '  ' @'P  "  " " $" t,@&O  㿐H /!> * %!> $"L`    bLH p@> e 8?" ,  @ @M2  "`$ $"`("" ("LH 0 㿐 F > eY `H /d3> * %3> &bL@"  "` "`"" bLH 0 㿘> #d`> `@  p  >   4 2 > "LH 0 > #L]G  6 6 & & & & & H /d4> * %> ""L  @6  p & p"  p$ p& 㿈\> `#|] @d" H  4 $ (4 < $ $ $$ ,$ D$ @@l$ @   > d H /d4> * %> ""L   $ <` 2` $ 8 4  $ 8 `" "```"`$ 0 0"`4"$ 4`" "`@`"> ^L!`2 > dx   4 `p`$`p" $`p`p$ 2 ( ";> "LH 0 > dV  `  <@  $ L<@  쀢    2 `p "@`p"`$`p"  L `" $ 4$2$ 8$   $  "@ #  "L @? "LH 0 04  4 8 2 > "LH 0 > cߐ!($ $ "" "L @  "LH 0 㿘> #d`> aP@Ǧ `$ @> `,(@ > ` > 2$` > "LH 0 >  !h`$ `c`$&`$,&`,@`2`@$ 2D`@&`@&@D ? *@2 `"`"D" > cu!  2 `D`"`D" `D&`D"@˔ 㿘`,  8T@>  $> > cP!Ȓ [ H 2 `  ? r? * 2   "  X"  "" "p  ?'X' 'p P'\  ` 'd 'h*@  ~ p>  H\㿘>  [E!`@bK 4  6 6 & & &  `0& 㿐`\H /d4> * %> ""L `   <@   " p<@  p   p   2  p "@ p"`$ p"  2 > b!  7  p`' p" $ p' bLH 0 @0㿘 H /d> * %> "L   2  p`" p"  p& p"LH 0 @㿐 P  > bd" )> H /d4%"L* %%"L p` ` 2@`"L` `  4`  p`$@ p" & p p$` "LH 0   `  > b("@H /d* %%"L 2 &0 6  &0`"`  "@ &(("`,"&,`" "` "@> [!  &$  *    !  2  @" > "LH 0 > aĐ"` &   & @"   &   "`$ &`  `2   H*` "   ; `H* ;"LH 0 `d`$   N`H /d * % > `` $@`" "`$`H 0  +>  Y#  4`4` `  `2$` 4` $`$` T P@2`  \  T  `  `  T <$` H <  H0㿐 > a8">  Yl#@`r p  5 5   `  p % , %  `%  `X%  `    = =   `    h U" h  Y: % (  0 `3>      `   (    (" *  t"  `*  p ;       `   X    X" *  "  `*  Є 8  `   :  `   : ` @c `@c `*  `` @c@c`x``?* `d, `0 > @ސ"  ` `x@c  H*    0 `x@c~  H*   !H /d4&bL* %&bL  ` " bLH p@> `N"   5 `< % <"`"`< <% @S@ D D`2bLH 0 z H /d4&bL* %&bL@) $ p  p'q@C(0 "0bLH 0 H /d4&bL* %&bL@Ӓ    K @ bL   ` 5 bLH 0 @-㿘* p`> *` € !"  > "LH 0 > _"!` 4  @ `  P >   TP@ > "LH 0 > _# H H 6 < ?*@4 `"  "` "@  4  `p $`p"  "`p  p$  )> *`,   @ `, * D@ D # (`"` " `"` 2 U  (  2 `<`"`<" &`<`<" (2  (", `< >   2 2 >  ?*@4 `"  "` "@@  "LH 0 > _#H?*@4 `""`"@ `""` "@H /d4 * %  $ " % $H 0 2 p@Œ- p> "LH 0  ` *`> " > "> ^#p> "LH 0  ` *`> " > "> ^# p 2 㿘> #d`> c@| ` 2 ` `0`"`4`4"`4`4`0"@` ``"`& `` "@` `2`@?*@6` @`"``"``@"@`@   2 `@`<`< "`<`@ <"`@`<"<`<`@`<" c `D)? *@2 `"`"`D> ^9#   2 `<`< "`< <"``<"`<`< <"@ H /d * % > `` &@`" "`&`H 0 㿘> #d`> `@  ?  *@ 4  #>  D@ D  ,    ,`@ ")  @% `"  "`  "@H /d * % `` $`" $`$ H 0 H /d * % `` &`" $`& H 0 㿐 >  U̐  6 & 6 &   &   X& H /d5> * %5> &L  ؖ @( "  bLH 0 @0  6 `@ & @"`"`@ @& LH 0 㿘> #d`> ` @,  `2M  8 2I  < 2E  @ 2A  D 2=  L 29   ` 3 6  $` ("`( ( $"& ,  @ ?*@6 `"  "` "@  O& @   > "LH 0 > \ 8    2H  82D  <2@  @2<  D28  L24  20  " * "     H(> ฒ฀"  " H > d  dP 'a  '    'p'h  a '\ ` -> 'd: , "`p?'X t: @aQ ?@B<  0 : ' ` 0,`,`P d, @x 2 0ռ',` ,`9` 4/ 0 P`\*   ` :   2 0     2 0@8  0  L`%8%@ @ @ P}<  'đ,` (@> ] ``>  @]H /d * %  &" %& H 0 㿈'L ' '  #>  tH /d4$bL* %$bL N ['`pXbL  >  2>  a2 ?> "LH 0 > [ *@2 `""`"@H /d * % > `` "`" "`"H 0  p` bL> "LH 0 > [p БH 0  bLH p@ ? 0 " J `  H'  H 0 t? 3:` l, : ,@L  d@_~L>`F= 2' 0ԁ@'@&@֦(0 "0㿘> #d`> `@  2   (`" , ,"`, , ("@  @ ?*@6 `"  "` "@ `"  "`  "@ `2  0   2 `<`"`<" `<&`<"H /d * % > `` &`" "`& H 0 㿐'H` P'T@^ < >  RҐ @Yؒ  4T $\4  $ 4`2@` `@  `> "0R  55 `  4 H /d4> * %> ""L!>  04 !R   4 !4$ R  4 4 $ $H /d4> * %> ""L> a a$a"`$a$   4 `p`$`p" '`p`p$"LH 0 rH /d4H* %H'"L  o ` $a ?# @4 H /d * % > `` $`" "`$ H 0 Ha $ a "`$a$    4 `< $ <"`"`< <$ H     2  p "@ p"` p& p" $>` @YА*   ,` $  @YƐ*   , " @Y*  " , @Y*  ,@$T ` 2 @ w\  4 `< $ <"`"`< <$\  "L2@` (@H 0 8 @v`?  "LH 0 i  h&HH /d * % > `` %`" "`%H 0 "LH 0 @   z 2> Y! P` > >  > "LH 0 > X!0` (2` %   @5 D %D" D"D%"LH 0  㿐H /d4> * %> ""L  P 8  <:`    X&&  @Xߑ<*  - ,`"  "`  "@@Xϒ *   ,` &  @XŐ*   , " @X*  " , @X*  ,@&   2 >` & @X<@X 2   D  2 &  LH 0 㿐> #d`> aX@<  ?*@6 `"  "` "@ ` "`  " 2  `  G"`  !`  " 7 `0 P> > !=#  4  *@6  @2 `""`"@`""`"@H /d4* % " " # "H 0 ` `0  > "LH 0 > WԐ!hH /d * %   & " # & H 0 㿐@@ `( " `( "`"`( ("> bLH 0 0"" (`"  (` ""(`(" > `"LH 0 @ 㿐> Wl!> b!> 2  !: $! @ !> `$! O"d@V  6  @6 6  X& & 'H /d4> * %> ""L` ` P8  <:`       2 `p "@`p"``p$`p" >`& @W: *   ,2 2  D2 1 2 > "LH 0 > V!@> "LH 0 > !V ?' c 2 "  `q6 㿐` > e< ` @ N @U   4 4 $ $ @   2  $  " $ ?# @4 $  "`   `  <` `4 D $ D "`D&D$    4 `8 $ 8"`"`80 8 @V*  ,` $  @V*  , "`@V} * " ,@Vw *  ,$    4 `< $ <"`"`< <$ > "LH 0 㿐`  H /d!> * %!> $"L ~   `   R @    R @  > "LH 0 > V!  ` R"""LH 0 㿐 >  c   > @;"0 H /d4> * %> ""L   . 2  bLH p@> U" @X  ` `?2`   $ `    R @    R @  > "LH 0 > U"H  ` R" "bLH 0 8> a?"aH /d * % > `` &`" "`& H 0 0 ` `?2`   $ `    R @     R @ > UJ"p  ` R" "bLH 0    @ > @" $> a?"aH /d * % > `` &`" "`& H 0 0@H /d4$bL* %$bL 6   &  U bL  bLH 0 0   6 `@ &`@" "`@ @& bLH 0 yP !X  '`  ' '''䒒 > @"H /d * % > `` &`" "`& H 0 㿘 0@> T"H /d4> * %> ""L p  ` > Г*` €@ F%\aT 2@ג !" > TX# DbL ( 0? # 0 *@ 4 `"  "` "@H /d * % > `` $`" "`$ H 0 bLH 0  H /d4E$bL* %>$bLH 0  < S  $ H /d4$bL* %$bL ?c  4   H < `H < H> "LH 0  ` *`> " > "> Sא#0 2\ bLH 0 㿘 ""> UP#`046  *` ,)`?#> > `H@ @@ > "LH 0 Sc "#@  #@   2  2`H`ґ*`㿘  "  > "LH 0 > S{#Ƞ" 6  x@V `H*  0@  > "LH 0 > Sb#"LH 0  O  7 & H /d4> * %> ""L  @R 0` D > 0  > `(`X` `4 bL H p@> S# ( `*  `  bLH 0 `> *`  P> ` `S`    * `  bLH 0 `> +``> `  `RB ` * ` bLH p@> ` RҐ ?# @ 4` ` `2` D `\` 4X` S`$`(*" `, H  0 D :@W``, @ ; B >`` `X*> >  < 2 "bLH 0 R!"   > > @ * 2 "@"LH 0 Rsa("@`0:` ,` 0`< @W5B `  2` ``(*   *`"k: >`` `X`?* "@` `2`㿐'?*@4` @`"``"``@"@`` >!*` €@ @  `  4` `$@" '$``"%> " "`"`"`2`"8 2 0`"44"`440"@@ʐ `2 `$ 0 4  (`" , ,"`, , ("@@` 2 ` 2 $`"(("`(($"@",`2 H /d4* % $@" $$`H 0 ^ p@Ē Y p` `@{4` R p` `@4` K p` !" H> Q!P` # <`   S` ?# @``4` $` %> @`Qex `   4` `$@" '$` 0 > aP "aP p`` *`> " > "> Q>! p`2 ` ` #  p` 4` @`"``"``@"` @ 4`  p $@ p" & p$``2` 㿘> #d`> a@  * 8 " <> Q!``D 0   2 ,  `     `DI 2 㿘> #d`> b@  \ 0 " $> Pɐ"8 ` ` "`  "&  "`">& @"  `H  *  "  ; `H* ; `"  "`  "@ H /d * % > `` &`" "`& H 0 㿐 > #d` > bh@R  b2?> Pb"! @ 6 \F!T@ x @S` `H* @ @SY `H* @ `  !  ؒ O& `0 > c` "c`ː&    D  6 > > >   > P"- ` *  ?(@  $ "  b#\@ h"P?* X@ `"   > @> #h(O@"@ `# 2 $ 8? $* `p;`   @ "  #` "#\ bhO  :?* `А   @ "  > #\ @> #h(O : : ?# @`3   "  0`0 2 0> aH "aH 0?  4?> O#@2` 2 0  4@? 0  < 2 0` 4@? 0 <`?? > 0  D " <W  <G  ?*@2 `""`"@%>!0* €`) > OJ#h @u " < @; < ` ` 2 L  </  <` *`> " > "> O&# <2 ` - > O#*  " 2  D 㿘> #d`> c@    ` 6 "    ` "`  "D& D "`D"D&    6 `8`&`8" `8&`8& 㿘> #d`> `@  " > NĐ  * 02  2  ` 2 `"  `"` " D"  D "` D# D" `"  "`  "@H /d * % > `` &`" "`& H 0 㿘> #d`> `@@[  b2?> Nk X! ( @6  `"` " "m  (2  (   D  D   *` , ,`?#>   N9`H   "    ` 3  ` "`  " D#  D "`& D D# `2 `ϑ*``"  `0 > c "cĢ* (2'  `"  "`  "@H /d * % > `` &`" "`& H 0  㿐  ` R & H /d!> * %!> $"L   %  "LH 0 0  `" & "LH 0 㿐H /d4> * %> ""L    2 "LH 0   `  R  > 0 R  > M}  `   R`"  >  R`"  > "LH 0 > M_ ? c 2  `  2` `p "@`p"``p&`p" @] D ") @%#  2 `""`" @ 2  <`" <"`" <`<" @2 ` 2"L `,"LH 0 0@ "LH p@   `, > @K! `> L!(㿘> #d`> aX@ɐ  L/ D@4, 2   @( # ` "`& P  "$ $  "" 2  L @2 L  D L 2  ` "`& P  "@$  H $  H"& H L 2 㿈`>  #H /d4> * %> ""L ٖ  LH 0  `@ > `<  > `D > `L > "LH 0 > LR!p0`8L > "LH 0 > ` !> "*` > "L2    `$` ` ` > "LH 0 > L!` ` (" `@!LH 0   `   `    ` (   44`0  `P@P!D  `      2`0      2`08 `0 `L`e8e@ @ @ 0 J !H /d4&L* %&L   827LH 0  㿘̒ > Kl!БH /d4> * %> ""L p ? 0 7  0 $ 0 0`2  p> "LH 0 > KF"    0 ?$ 0 ȐbLH 0 H /d4$bL* %$bL p  @-bLH 0 㿐` h 2 X @@   0    @@H /d4> * %> ""L@  LH 0  p@ @  2 pLH 0 | `p    ` >!L*` € 2 8'@ LH 0   0-1H /d4%L* %0 2 0'@n LH 0   0 H /d4%L* %0 `"` 2!` `0'@B  LH 0 h H /d4%L* %%L`2`  @  {LH 0 0 , @  @ L`a '@ XLH 0    0H /d4B%L* %0$ '@ْ 4LH 0   0ptH /d4%L* %%L> "LH 0  ` *`> " > "> I"( 2  @``L'H 0 AH /d4* % %Lت  H 0 H /d4%L* %%L@ p LH 0 . H 0 $H 0 Ē   `F    ``  㿐> #d`> bP@.  %> LH 0 H /d4$L* %$L ጖ " * DH 0 `0*  H o4H$L*@ e0@H /d4$L* %$L  2  8'@Ӓ 2L`" L, LH 0 `k0 H o4$L*@ e$L1H /d4$L* %$L  2  8'@ 2L`" gL`d     㿈> #> #d` > bh@r a -> 䀊 1LH 0    ->  H /d4%L* %%L2   H p@> HQ" GLH 0 ``  `   `  @9 H /d4%L* %%L2 "  H p@> H " e  > "LH 0 > G"` 2$L`,@ђ LH p@  `, _H /d4%L* %%L2LLH 0 `@J2`@J+`* `` @J@J`x``?* `d`0, 7 -찒 H /d4%L* %%L2  H p@> G"耤2 H /d*  > < %> ""L㿘> " * * @EX" > 2: @ > > #d@ >  aL  "aL㿘> #> b1> b@E7 > a,$` > "LH 0  ې  ؐ > a\` v"a\H /d4> * %> i""LO  c  `0> > #h> `` t> ##h#`"p> >  > `` x> # #`"p" > > "LH 0 > F#` #> H /d4$bL* %$bL> > a0  ` "> "P`& *H bL>  (0! $ !$bL` $!H 0  㿘> #p!> !`"% !  > "P`& > *!0㿐H />  a> @#@0R* %> a>    >""L> > Ta*  X  T T *( !LH   Ζ  ; > @#X@d 0 2(a  TLH 0 㿐H /4> * %> ">   "bL>  > X *   : @ ` **  X' "LH 0 0v> @a#p0r> !! @@"  2x @@ ?M H "?E@ ? <"LH 0 ` À@    > @#0  "> @ #@’ `H /d4%"L* %%"L@ `@"LH 0 㿘 H /d4> * %> ""L p W ` 6>!|*` € 2 D`F D >`@;  "7`7 `.  ,@ " `( ``2  > "LH 0  ` *`> " > "> E0# 2  > "LH 0  㿘> #d`> c@ ' #> %> 2  0@$ 0bL  #+ $bL "  0 퀦` 0   0  $ 0㿘`> ֑H /d4> * %> ""L> #d`> `@  t `#> %>  L t`& LbL  " $bL t 2 L` > "LH 0 㿘 0(2 \> D `X 4@ > D @㿘>  xF1㿐> #> `> `  > > b4%>  > F!0U> > !(a0Q M . _ $> 0> c8> 4 " 8" " $ $ $`4$ $ f  "!  .0$> " "@  #a "@a"`! `Ԕ Y썐 ֒ H @_+ 㿘\F!T@2& 0@@4! eg8$ >:4> > "0C##0> .at?c ?*`@   > > "b4#at"4a t @`@@> a N`Ҁ ` @  O iN`Ҁ ``@@2\.`_ #8  w| W!> .!t?c |?# *`# <@ | \ "!t> C!@ . $!t  $|" |$  $  4$ $ $Σ %|a x`Ԕ!뫒x"`Ԓ" @Bא@`9 Z` Y뜖xx Z`" @BȐ@aP* t ?b$ 㿘!   `?B`#$`@#` 2 $%   2   ^     ,((" ? *@, &   > "\> X !] `?2` 㿘Ɛ ``D@B  H@ !PaƔ t -㿘㿘  <`> C!  㿐>   # D `D 2`> B!` ' ` T 0* @   H <0  H C!` > C!D > ` "?> BO!$`! 㿘  ``" > B="    㿘  . Ͱ $ 㿘 > `"0   C 㿘> B"X㿘 "   ` "      @  `X ! > ` > A"`'@ P@DX@?"Ȁ "Đ@  b'  ` ( .`(  ;  .`p @F `&`ذ `` @Б.`.`?  ,    .`(  :  .`p  (p@B@ "@  :`B@ 2 @`  `` '@&    `  `X*  @00 * @`Ԣ _  $ & P  `0"2 > AM"`0( , $`0$`TI> c,`U", `H*Ķ `, )`($@#@ė.` ?, @ @` '@$@ @ .``H ?, @ "@Đ? 'Ā  ```"((, &?& 㿘 X!'`&   ` ?` > "@Ԓ_   &@`S$ @E >`   2 ( % "& "&&& "  @@   @@ @? &&:& @E` `" `2$   > # @y 2' 㿐 &'> #<   ` : `8Ұ?2  `  `8ɰ?2 `@8ð?  X`D43 ?> #<   ` : `2>  `  `2> `@> > ` $ @? ` @  "?  `    `>     `>  ! > > > #pc? ` 2   @@  ,4: `&` : -`  aB * 2`   - 4> -`  -`H:`  a > ` !>   r`  2  : 4%?@  2 ?` @a&!H     !H@>V  { @>M$` r ` $``Ҡ  /> 7@`,  "@    ?`* "@   l ` $` $`$` $` `* &`  ?,   B"@ $a8$a,$a0$a4& X `Pa` y "       2y` H  "" $ i` 2  @s`; *  *` ?"``     ; *  *` ? `; ` $`*` * "   @h  <    ` 8`   ` 8 c` $a@>   a@$aD"@"  $a<t` , ` "` 6`%> `, @`" 8w@ &``? `  9  6& 1` ` "@I&?㿘 F> ! !< !@`"!D!D"aD> " !D!@"@*(  !H '>   @  %> ,` `8.@ @     * *    !H  &  "@$㿐 2@ ? 4!> Ґ А (@$88@< 2 D> > > #pc@> !Z"DD@"@@`$@@"aD> @"`@"@$D  280 ?4  $8 ?X!@P'?@F0`= * @ *` ?4      :*  *` ?  2$0 " w   ` <  ` ,>  `  `  ,> ` ,> = P@ " \ =`     2n? H `` !""@$ `? ]?,`@>J &` @?2'@(?0F'@0 2 `42 ` $0 `   ?@$4 '0& 20 ? 2H$0  @  = *` * ?e?ܐ  㿐 `"?` `ǐ? ?`:  C , ` C, @" 2`g? > ` `:` > > > #pc<ϔ" , <`    D? `6@ " `  ? "@  !'"#@  @   ?"@  '!@&" @ > < W?0T@"&㿘 )?  2 4?  ?`(?     ?  @ "? . 㿘 [   * &  > > > #pc<3"e* @,  : @&`09`@ :*  *` :    :*  *` : *  @ * ?2   $   " ` @z 㿘 )  2 `0* & `> > > #pc;ϔ"`@@Ґ` @L㿘 )a  2 x20* 6> & `> > > #pc(;"`@u : *` * "Y㿘 +3   * @ `> > > #pcp;w"&a >` @`60  $  *!,"$!,)㿘 N   * @ a> > > #pc;G"&c  :`  : 6 !,  $!,0% ?$!,    >   `;0a &  > *@ ;$!耢B*$ ֐㿘>  `m i |0]:  > :"  +> @ ` "$@:b8 2  @  @  `? " @ !$@""> :Ґ"X @* "> :ʐ" & : C8 C *> , @2  " :" C,  ?> :"c㿘'D! D*@  `` D * @   ``? @= 㿘`&a >` @>  @ > > > #pc:c#}   ` C C&>@*  @ C C &+  @ *` @ ?  C @ ` C2`@ ? #@@ 4#@ ?"#@ 㿘  @ > > > #pc0:#~  @  > *  *` ?2 > #P: 㿘 >`* `*?"@    2   `  >`* `*` ?` >`*` `* 3 ` ?>`+``*2 ?+`*"  `?&  ?>` +``*+`   > > > #pcx9#Ł a" ~    @? 㿘> ( > >  ` @ V >  5> 7> 9> >     2!8p〖#9_#? $!8! 8?!@`!D"aD& !D!@"@$!<  ,` ,`    $ $   6 '> ,  3@&, ْ  ֐Ґ ` "@@ % 㿐> ֐#(#\!> > c   #@0&$#@3˒">  >  " "`> !`> "` > *"c<㿘>  `" > > > > #pc8$80#@㿘> a>    ,> > "`("$>  ,>   ((  222㿘> #'> %> , @(*` " @ @2 2  `į ,0 2  㿘    ; T> `,>  @ (* @` `2 @`@2@ T #  `2` ,@ `(*   & " " &    2   "" 㿘 >  aȰ  ``D >  Ǔ e  ` 2  [ "W  R $ `XD  $" ( 4> `X @`29 @I 2 ?@ה  @   @?  `   :p  `  2  $ `X`@ " Β       `   ┒     ` ْ 㿘> !Ȁ`"   D >  @  X   " ĥ /@ 0 p  ` '@`'`*  ''$`'&   ` ? <@    ` <@  `ʒ @   X @`@?     ''䀥2 X X`  ?@P E  `   `/       `    '   ``쀢   0  H @а   `   ! >$ 2!$    ` 8 ` 82$  `  ` 8 2$ ` $   '$  8    찒 S> c` ' "` ' `    aB 2` * @ *   `쀢 "    `:   찒 # `쀍!2 H?' H@   > #`@! ` > @ ! "" @$ J`") * `2   ?"2 ' `2䀥 ' 䀢@2  "'  "  `2  `@7,  2 $  }$ '   $      z  '$ 2P` "L`  G`b `  `   aB * 2` @ *  $ $ x $  $ x% $ x$ x &,  ~ $ $ |`ܐ(` $`В `@$`Q?`@E 2 > c` "`     ` ? @   `8 / `  `8 &`@8  0    ?   :`> @  `    ?   :`  $ K  >$ c ^`޶  a$ x"@$ x  2X& 谒  `    b / b)`耢 #` 2p&  `  p@  & @ Ѱ 0&'0؀ + (`P }   2Xv  谒 o耢&`($`g В ߚ`@]$`1В ߎ`@$`X `  Аn` C`*@?$`܀ 0 -А]  "`n0.*@ $`   2X& 谒 ܀`  В H`@$`&`@ 㿘 > `X   6 H`> 4} Ё㿘  ""  @ >  ? @ $> 5      > 5  @    J@ `@ &J@J   㿘`(2 > 4= &`.``ܔ  X`D$ .  ` 2` .㿈 `x ` `" X> 4!! @@  ` #\:`  " "`  X @@ I"`:  :` ``"`: :```  $` ``   @G"6 Xa`P``H n@` " X`#`cH`@ X @@ <"`<6 `"`H2 "`<&`H` : #\  ``   ?ޚ 2:` (X $އ X`@`2`   ```    ` : `  2!` `  2`@8  ``x :  8 ``x : 8```:      X @@ ׀ ְqҰ "   ? `x 6"@4   $%   ? `"` `$ & @ @ # X @@  `x܄`x  : 6> 2ΐ!066> 2ɐ!H4`   `$ @ [W` ` "   X @@ `" : #\`ݢ`` >$``| : `  ` ; `` 8`/ ` `` 8`&` !` ` "`|`|`| `@:   ``㿐` x  " :    _   x `@ 2 x "  2    x ~"@  a# `X @@ ` `&`ג Lꔐ 0"`X`?&`` ` ``?2`` &``X @`@  x 5   $ 㿐```:  `  7" X`D * `?&` X`@ ۅ ``  ```?2`` &` X`@ @ `ܩ` $``  `      2C >` ܐ  #\#`#h#d#l  ر 2/ ܀ 2+    `4 M  .`2M  "  M .2    D4 @8  `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# ܔ`X 찒 <   #`#\ #d#h#l   =  2> 2!`܀  2 㿘 @      p  @ @  " D D 2   `  t  D@    㿘@$`I        @,2`,`  @l 2-``,  *`,` @   #>  4  a      , @ 4 $ ,`ސ  㿘F  `> 0Y!/?#  * $`*` @   " ,#>  4  a b     , "$ ,$ ,   4 `ؐ  㿘. @@ , $ %`"$ (  2| E  `   p@"  p E  @2k E > X#. `> 1!Z  ( Z`"Y  , (. > 0c   $ <  `   p@"  A   @2<  > X# > > "(`0@/ > # < $)   2% E  `   p@"   E  @2 E > X#. `> > "X0x  4  E 㿘@  `    @,2`,`   @j `-``,  *`,` @   #>  4  b       8 ` 4 $ 8`ސ  㿘4  2?> /G!Ȧ#ߒ  * "`*` @   " 8#>  4  b  R     8 ?$ 8   4 `ڐ  㿘. @@ 8 0 %`"$ 4  2| E  `   p@"  p E  @2k E > X#. `> 0"Z  4 Z`"Y  8 (. > 8c   $ @  `   p@"  A   @2<  > X# > > "(`/Ԗ/ > # @ $)   2% E  `   p@"   E  @2 E > X#. `> > "X/  4  E 㿘 q   @> .#   > !>  " @   @ ` 8.m#P㿘 <  H @`W   s 0 Ha 2 @> .D#`'أ.''''ܐ Ԗ Z` ܔ<` @V J @` @  *`@ @ &`@@  &@$N" 0 " 8@#@&&  @ߘ >P < 4& @ 4&@ې >P`-   -@㿘 < @@`ϐ  ` *@ @" w0 㿐a .> -#   @0 @>P ,@''c  @Β  $?$ @ ?,@   .`"`@*@&`@㿐! @[   $۔ @\ p!ɔ  @?Ԁ   " ,3>  6  c  r     ,' 8'   <' @'܀ " ,@  ( @ > . 0@ # '耢 " 8@  4 @ ؙ. 8> @  '& $& (& ,䀢 & 0& 4& 8& <& @ ?# @6  8 4@? #ߒ @6  4 2  ( 2  0 2   $ 2   6 ?# @6   6 @  p!. \ @Ԁ S  " (3>  6  c  ט   2  (`" 4 ,   > . 0@ # & < 4` 8  쀢 . 8> @  & @& , ( & 8 ?# @6  8 4@:  ?#ߒ @6   6 @]  㿘>  <`#@`_   ,  @ `"  ` " @a  $  㿘! `@   *`">R`w  㿘> a>  4̔ > "`D>  8" 8"`p. @> 쀤 @ `> ' `4<> `D *  !>  8 2 2    ` "` "  "@' 2 >  8'> ` > > !@*`  "@  8  㫐 D@+  D@ ($@ 8> +#' D ?@" > +#` "` "  "@` "` " ?$ @`2@ $@" $@$  4 $ $ 4 .  .`@  #@  $     $'?''''''' ޒа  @ @@* @      4 `"  "` "@@2.' 4 2  ( 2   0 2   $ 2  4   "' < 2  @>  0 $ < @ 2 ' 8> @ $ @' 㿘`` ?6`` @`?* ` 6`> &``8``&` `""`p> #쀦`> *#` 2`Z > *ߐ#`t` %> `6`   `  l 5 ` `* ` 6`  ?ؚ`$''''''''( ` " ` "` =`?# @6`7 㿘   @`"?n&?  㿘  >`#&  `   g G``C   < #.%!" 0.&$ 0&" 0#wƐ[ ؐސ 㿐 `   &@㿘!p`D  `0`4&& 㿘> .ax  "ax 㿐 `` )&  ` ``  ``l  &P"&m F& WWWWWWWWWdd,8DPP((㿘 > a* @  @ "     㿘 > @a* @`  @ " #" ( "ʒ ` "`L"   ` ::p " <Y$`  d2 ``X ``   "㿐 `D ``  `(  V  &  "`    " H`B > H  ?> # ;"`  "` #"`> # 0"` 0   &   ` : :`      ` : :`( H`B > H  "    `>  ::0  ?&  㿘  `<`>T#*` €X @`1 ǐ 2, `  2 Xd @2    @"    p 2t   㿐     `(  V  $  "`    " H`B < H  ?> # ;"`  "` #"`> # 0"` 0   $   ` : :`      ` : :`( H`B < H  "    `>  ::0  ?$  $` $`  `  /$` $` `   p $`   `  t $`  `  ( t$`L  `   <`   `   $$`,  `   D$`0  `   ,$`4  `   @$`8  `   4$`<  `  $ H$`@  `  d X$`H  `  l P$`D <  ( $`(2 X@$`( P$`(  `  h :3`+  +`  2`*  *` <`P <$@ H<`X 㿘   @    `?2U `?2Q `?2M `(?I `L?E`T?A`D?"`H; ?"}  X @`3   ` `  p   `   "`D ` 2   `     d@     X@ > !d`  2`H6"X `  d X@  `H?# @   ` ?d "d?X "X ?` #`H @ `d "`d"d `X "`X  $ `H`    `   d`   `  X`  ` 2 X`?"`  X @`  `@ ` ?2 `$?"4`,  `    <   "  X  " X  @`r  @ ` @`$ g` 8  2`,`$(`, `,?2 X`4?"A` X @`2O   ` `  p  `,   "`,` "`,`` 5 ψ .`,?"`4  $ `4?"   $  ``4`, `   X @`   @  x㿘   `   p     "  "? "  < b" 4 O  `  t Ғ 2 d" "  ` @ 02@ o`  @2@  $  @`"    ` b2 @  㿘   `  `` p ` ` 2``t `p` 2``p@ 2``t`  p 2` ꎐ `  `` t`  2``p2``h" " } 0" t" pŐ` ` `" `  ``" ] E > ̖02F > %# `2`` $`  `  ``@ 72@1  -`  ``@ ;%2@ " t" po` ` `" `  ``"  !0C   E 㿘 `<  $`  ` d X` 2(    `  d` 2    X` "     Z`    v0@>㾈>   b ' $> $| x< 2 X X@ސ    ѐ0`  ` `R c  ` R c ιk `  `2 Xd @  ` @ΣU ` $`` ` `` 2`` $`X`@  X`@`2   Ɣߘ `?$`` ` ``?2`` $`X`@ "ͻ > #ܐ" D  ? ΁  >  q 㾀> "  '     `' ' $$2`X> #  X  #  X   ~G Aom?b !@    ` d X` ԰    ` d X` Ű @ + `<  ̐ 9 ? %> #K  %H b$, Ҕ   `  R c   R c Ò v  `  dX @`  ` ` d`    X` ͞ Q   <   0?<  : ` `    ` ` v )  @J`.@  `   Y   $` "     $ ` ` 2` $`X @ Y `X@ 2`   ! ` ˴` `2%# 瀤`  `@2> "M ؒM    2`@> "7 PO`  ` `R c   `R c  ` $`` ` `` 2`` $` X`@ ے  X`@`2  `?$`` ` ``?2`` $` X`@ p˹ mퟔ  #\Z`?$`` ` ``?2`` $` X`@ ˑ ``   >  b`@> @> ! @2` > !!`   `b  1` b*`   `# 2p@2  @"   ` ` p@     @    <   0<   Ұ B`` ɰ Bǰ ,    `2 2V 2`?$` X`@  ?$`X @ ݒ +X @@ & 2  `  ```?2`` $`  ``?2`  $    @` g >  6  ? %>  Ȑ ǔ B䀢 2  >  !  i ">  !  > R#$ Ƙ M  $䐂 ` `72c 5b)'`X ?$  ?$ ` `?2`  ?$`X @ ! b/b > !@`> "` '`$`>  2!P   ` R c   R c  L/> ` "`p/>  !  ̰ 2: ` `  ` "``  `   `` t  "t `` t " 2  B "`> #``  ~| $`` ` `2̔ " <$``  ``2 X @@ ɀ  $ ` ` 2` $ X`@ k  X`@/> 2  2 X D`> #`"+:> #'' '  '"' '`/> ''`#\  2h`  `ؐ `":``  $` ``  ̒ @ ȐH/>   X`@ Ȕ"`<6 ̖"`H 2 Ȕ`<&`H̐`X@ `2`  " X/  @@ &Ȱ  ɔ̔Ȑ 2  "`` `*"@?$ ` `?2` $ X`@ ȶ $``  ``2 ` $``X @ Ȥ ~ > i!h㿘  @  " @0`^      B`` 2`  B `` d X` t   `   d` j ` X` a `)$` ?$ X`@= : `  ` $` `$ X @@=% " 7 6X @@# `  ```?2`` $` `  `?2` `$ X  @ @ @?` @  ߐy ƐĐ㿀 (`  @d ?  "` @! X D@ 6   `  ( <`: p nj  ` <`:  $   #`#\  #d#h#l    x㿘   !} "$" "@   " 2N  "J >  > !x "@"  @ D  4@#@ #@<  \, "@ " @ "D @42 8$    `      2        2   8# #㿘   `   X D@ 2   `2 h : "   @2    `p(     } 㿘  ̙ T㿘  `̏ T㿘 `e T㿘` \<? > ! T P@2* T   Tǐ " T 0$ 4($ 0H /d * % H 00-?2 T H@ <$ @ T?2 H /d * % H 0 >   ` $ D 8*` €㿘 ? >  ! 2     `  R  >  ! `   `   p ` 2  t2  > " <` ̐ T> ߐ"0 㿘 > `> `"`<#* @㿘 > `> `"`h#* @㿐 `D c`  `*  "Z> ؐ  $  "`    " H`B < H  "C ?> # <"`  "` $"`> # 1"` "2> ؐ   $   ` : :`      ` : :`( H`B < H  "    `>  ::0  ?$ > #> *` €㿘 > `> `"`<"* @㿘 > `> `"`h"* @㿐 `D c`   `*  "Z> ؐ  $  "`    " H`B < H  "C ?> # <"`  "` $"`> # 1"` "2> ؐ   $   ` : :`      ` : :`( H`B < H  "    `>  ::0  ?$ > #> *` €`>T܇(`  `   ` $` "`     㿐    `P     #\  㿐>  !`` ` `2 * `$$ <>T#*` €$ 8`  `` ( th >  c& $ 8$ ̐$`$ 8`  @ $ @`H<`H* *" * *" *<`H& 㾀> "`$'2<> "8&  `   > S#0A` &"`p ` `    ``  t   "t ``  t  "`  ` ` "`w 2  깔 "`> #``  ␐ $`` ` `24 > ؐ!` `<  " <$``  ``2 X @@  ` `   `d `d 2t   `  ``@ ;2@`X@ `2`  2夔彘 2@> # &> #|$``  ``2 ` $``X @ "È " <e > P"P P >  2 >  8>  8 8 < "   <  `2``"` <`@   3  `  4  ` `   #  ,  #  @ `@" "  2   , `@  " "  @  2  㿘'` > +" `"0 "  @"( : 2 ` (@?& $@|&&>f"@͐   `&: @"` $` '> @> "$ 㿘& ` N<@ 2@R`(@F?`( >g @ "4 X  @!0/ `"" > "<d> #@ > H> 㜐  "H"H࠰ H "`d> @8> #Hd 㿘& @  ?&,    $    㿘` ` ` @& ?# ?*  *2` 2  & `.괆<.` (@?k    㿘  "f. @@6&@  , f@?   ݲ`f@"   㿐 .`&,  `S? & * `&  0q H  $&@Q 2 &@ &: * N& : .&@ؒ2  `2"  @ 6  N "*``@ &N  @ 6 N "*``@ &N @j - :`*N & :   > #x"$> # * .  .`&,$ @` ?2` ,& $ç  㿐 .`f, `}  ?f * `f $ 0m H`(@c `(: * L& : 5" : 6  @   @ܔ   > #d> ,#"@L *` .`  *``>  d>  :*  &+@, `<f,?$`  ?2 ,ff,@ ` 2`K`( 㿐   $@X&@ @ >  p @>  @ؔX0;&,*`?& * ``& 0* H  $@ѐ&@ `:`*L@ &@ :  @  >  hB$>   * +,@  &,`$   2 ,&㿐 @` 8 (>   $@&,,@`?& * &` A 08 `H@ (6`L@ `: 6` >  $L&`6`> b! @ ` +@*@,@  ,&,`$  <  @ 2&,@ `?2`,& 㿘 ``$@F&`$2 `$ `6" @Ӕ@   @˔   > ! d > !@" N@*   *   >  d>  !`㿘> a$N 0`?'T'P'X'`' ` V` `.` (?# '?* *@ 2 @2@ !?&?d U0ז \P  @*` @+` @2` 2 %`%` (#``%`& W '&X*@ `" TH@<" @ԯ  > !?`` '*`( ?# '?* *` 2 2 #??'  P7 o%`'Ė &  '&*@ " TH@<" @A 2' * * @ 2`2 @ + @ X" ` ' %` S ` M,`  P ,`%%`*  & &', <"TH@J "`@ `'* @*`@ * ,  2 2` + $ X ,`6,`* &?h }?# H+` 9? ** @ 2 @2@ @ /? E LP XX %**` * , @ 2 @ 2 %`@+ %``$ && ; &'X, # T H@ <" @ T"@= X&? /&  '&, " T Td#@@  @_&`@  &D "@* * @&?Ř "> 0!@*X H`$ u@,`* ' & ' 0`@" 0̠ @$ 4 `" "``  "` 㿘 "   ` "      @  ` X   > ` > ̐"H`'@P@2@?"Ȁ "ĐԖ  P'ࠕ.` ( ?c ?* *2`  (2 * ?&` `` @ؑ.`   ?ࠕ.` ( *`*   3`+   ( 2` 2,  3   `` '@& ?ࠐ * (c ? **`2  2?   > "pْ> H" 0 k   &P   0"2`> +" 0( ,@ $ 0$ T'> c,`3", ? H+`c *`*?  2Đ 2 `, `)`($`@#@ė.` ?, @ @` '@$@ @ .` H ?, @ "@Đ? 'Ā`X   "((,@`&?& 㿘$X?#? ** 2` 2 &@  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`   ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`  $ ** 2` 2 &`$ ( ** 2` 2 &`( , ** 2` 2 &`, 0 **@ 2 @2@ &`0 4 2`*  6`4 6 @ `2 *`@6`6 8 2`*  6`8 : @ `2 *`@6`: < 2`*  6`< > @ `2 *`@6`> @ ** 2` 2 &`@ D ** 2` 2 &`D H ** 2` 2 &`H L **@ 2 @2@ &`L P 2`*  6`P R @ `2 *`@6`R T **@ 2 @2@ &`T X 2`*  6`X Z @ `2 *`@6`Z \ ** 2` 2 &`\ ` ** 2` 2 &`` d **2`  2 &`d Ș @ @ *`+  3` 2` &`ȁ㿘6 @E?5? ?`. (6`0& @. (6`0& (. 6`6 & 0(6  0(6 (06 Ķ 㿘? @ `2 *`@6@ ?  2`*  6` `( @ `2*`@ 6` x (  2* 6`x z <  2+  6`z   3 * 6` +`( 3  0&` +`( 3  0&` +`( 3  0&`  +`( 3  0&` +`( 3  0&` +`( 3  0&` +`( 3  0&`  d+`( 3  0&`d h+`( 3  0&`h l(+`3   0&`l p  + (33  %&`p <     l     <@   #`l2 6  `L2`d 2  *f "`d8  2 &   㿐 >  aȰ  ``D > "k @ "0 ` 2, `  `X @`2 @   @? "  `$ e     @   `  㿈  X`@ 2p |  "  % ` @"`    "  H`B = H  > # "`   ?%   2 C ?%  `(? @f,* @@@f$`?f@*@ -f " ]0" ?%  f$?@ H* @  2  2  2x  2zV ΰ 0i   `<? ` +`X D :`ݐ82`X@  `X D`  `" > C#à ( @~  ϐE 2  @2   `%   ;  27f(4ff @f@D  `T 2U@q@M T T `%    72fy/f@ɒ  Tٚ 2cf@9@T$H@T TfFTf  : Df@B??'f2`$ 'f2 ɒ$'f:` 'L  <`(9X'H? 8 @ 6  (" "@ @$   ,` (@"  `%      <H ( `(  <  (>  > #  1?'f2`" 'f 2 m?"@'  8 ? ( @ @ *`* 2 2` f@, @tP 2P`   ("(L@ $Դ @?# ,` ( ? @ @ *`* 2 2` # f: @4  >  X 0 H@ cH (>   H @" Ӑ#` `l > `p >  Đ#xW ` ""`"`  % 㿈  ''X'P    2 ɒ?P@ : ' < `0" > #`, ",`0`<@ `8$`0$$`T>  w#z P2X" `H D ,2" * @ E 2'2 ?s?)&@?#, ? @ @ *`* 2 2`  . ??| 2'6?ݲ@ $P "`@ =,  ?c ? + *` 2 3  . ?N 2'`Ƒ  X`0 $`0X" <<<$<,<4㿘 !@ ?c ?*` * 2 2 &@   .`.`@ ``` `6``> "  ' < ` & ?   $ ? ???'''''ؒ _    4 .V "@ @ %' ۔ 4 ?$c* @ N  @E`"@&@`@@: =`  * 2` 2ݠ = ΐ`   2  @8"@ "@`  '@ Ų""@"@> " > #؁` ? @' `''`''    &''@ +`  @ `X @`? d m ' '耦2 `X @"`X  ?'`X`P'  : 58$2 @ ($  '$Ԩ  :    @Θ 1 ''ܘ =; @  B  '@ @T '@?#Ԁ@  "2 :   @   2 H?'' H@   > #`@ > ָ %  $U /   2`*  * 2  ?"@`䀢@2'  쀢''䀢@2@ ' "  2  @   "   2`*  'ܖ$   * 2` '@p  '`$ 2O @"K `"F`X @`"]  V:@ =B @ @'$ $x$x$ؐ@&'ؒ@’$|`$А(` $Ē 5@$ ?@@ ? ?* +  2` 3  $  @ `2*`@ $( `   ߡ:`82 @ ( > Ĕ  ?:   ې "0ِ $ @*$A @<l $x" $x 2`Xx'@  b "'@" '@ @ "'@  '@'`0̀+ @(( } 2`Xv   o '@($g Ē r@]$@1Ē f@$`X `  ĐF` C*@?$Ѐ`0 @-Đ5  "F0.*@ $ 2`X'@  Ѐ @ Ē  @$'@@@ 㿘? #`  `  * 2` ` > $  >  0` ? >  H >  p@? *` * 2 2 >  ?@# ?*  *2` 2 >   >    X> " '(&>  ! ?# ?*  *@2@ 2@ '/ L %` ` ""/ < @ 2` ` >q"*` €           //qx` J ?> !  @ `:2+    ?Ț'''ؒ 7'''''(`X`L@  > !8@ = B =`@ @ ^   $:   @ ?`c 2``*   x ?耤@ &" @`   *`@ @6`@   2 *  "@ x@ @ @?> 2!X# @ `*`2 @76 ?> !x >  !#  *2  *`@ @76`@` $| | :  @   :  x > 톐!㿐  x` :   @ ("" :   @ ?  @ ` *`2@  * 2 3  `$ 㿐 :   @ј A`?# ?*  *@2@ 2@ "` `L &`` !<` @ 2` ` >q#(*` €           * * q `$ `?# C ܐ  #\#`#h#d#l   2< ܀ 28  ""  `4, L .2( `" L .2! ?*` * 2 2   *2 @ D 8 @8  `` ` 'G E B ?*# 2< ?  3 ? *  *@2@ 2 @ @`$ ܒX  ܰ 2'< ߒ  #`#\ #d#h#l     2> =!> !耢 X㿀  ` `> > "b(`<`XD@ 2  `2 > > "8b( ( > > "Pzb(   @ H; B?`  2`` (`0~ | ['@ K``    `$' <@̐ * :  @ $? ?'#\#`{՚ ?{ (%$`@$6`H`H  |'` `@ b 4`8 "`X|`X  @@  %㿀 ' > > "ْb` 2< "&  > (>  (> #> 䀊`"B= ` ":   "߰  2 > > "pb`"b` + f  : @ i@D B? 2<@ < `@`D  2    ? `` `j f@ L  ff @"* $ ` @Q O=  BŐ8 @ C  Ȑ 5`   @z @zuf@"@@& H { f { {[  "  %`2f@      @ 32@䀊 o'@ @ b % =@    㿐  f@' f?zL {|0 f H @ & '㿐> #> *" *  < *  T:`   ="7 t 0@22 t \ -  A 2' t`   2! t < " t T@4 t: @$ t> "  <>  T;  "Ȓ?> a" t Ȁ㿐< > `a` 2 @  $ <  "$ 8`$ 8` (ِ  >  c& $ 8$ =$``  @ $ @`H<`H* *" * *" *<`H& 㿐!> ֠#(> >  Lch#\    > > #\!cx    㿐> #> `> ``  > > b4!> X" > #> > #c ""0H@6  "j "06> " "@  #a "@a" a"d@ ! `L` `@ @  ? @X HW @`0  l  `@@@"iaN #`@  @ @   :   6:@  ِ .`@@0@! N +`@@( ``ݐ @!  0 ܔ: .6: 6: . Do @&(&&$&&,N  < "  >  `@& x `"`@`@ !!` . 0\ `@@@2@6   "a0A!Җ"d@" L  ` ? @"@ @Q Z` Y Z`@@ߒ" N  : .> #&0> #@  㿐`D @`D ``u = ``  O "`> i#@ (?@ϐ,* @@g@$`?@*@w` @  $?@R H*  y0x`@ 2a       > # `h ? " (:  @$$?wܰ  `@ H `@Ր "ax0Y` C" @_$, ? :<` 4 8 `$$$ $@I$4 ($ @B$$#$($* ?wUܰ ܐ`H, ?@Bxy &>|''''`t㿈` ?  > "@    f `@   ?  `h ' $v찒  @2H 2  ;!X @!X  3&0&0 @% `H x '  , % : 2 4:4: , " @$, ? :<` 4 8 `$$ $$@$4 ( $$@$ $(7   $$,$* ?v찒 .`H, ?@ww' &` &a&`h`@ < &`D&`l&`@% %%  2 % $ % ,% (`&" ,f 쀢 "w`Y  \   I F &a㿘6` `@C >a`L& 2`@'  2 ` : 2` 4 :@ ``< "``" ``L&`   `?`&,   `@*@$`@$a㿘!  ` +   㿘!; cS`8 "f> 8 (f(]```L5@`d 1 f  f H/`D    @   +` + *@ " @ 􀢀 񀢀   2݀f f H`D&`f&``@"&` ` &``"@&`@&`` &` `T Z`  Z `@  㿘 <  ` 2` p ` @``  ` `` 2&@c 㿈! Lf   >  83d>  H>~cH''''ݔ耢 2` )` i 2 , Lf  > ,f#$`0@  2㿐a ƞ & > !  > &  L @  > ` T  "$ $ $$ $$ƚ$ "(  ͐0s@,* @9@$ ?@*@  t uV&@"$ H* @> aH  $u$x* @$z* @$ 2"  > > ! " !&D` d > H> 㜐  "H"HH# d`X @ $ &㿐!`   2* F (&( " F` & `  d`@H F&&   2@ "`d"` -㿘   $ v+ `H` teu㿘`f   + f`$f* *   u fvf, ? Hf`t3tϐf &f  2㿘 8?c  * 2p cS " Le ? * *` 2 2 ?>  h   *`*   2  2 `>   0A "?  T @*` @* 2 @  2`  >  X  * 2` >   ` @*` @* 2 @  2` ?>  ` 0`2  d @ @*`* @ 2 2` ?  㿘 > a* @  @ 㿘 > a* @   @   @` " L???# *  + @2@ ࠑ3 @"(@5 @" <@$@`  `   㿘    ` `"`  `@ ``㿐      $  "`    " H`B < H  > # "`   ?$  ?$` #$` ? /$` $` $`  $` ( *+ @ 3`@ 2@ $`L<`   $`0$`,  $`8$`4  $`@$`<  2` $`H ` 2$`H  d$`D<  ( $`(2X@$`( P$`(    * 2@ * <`P<$@ H<`X 㿘      ?2Ұ  ?2ΰ  ?2ʰ  (?ư  L? T? D?" H ?"+`X @` `@"` `` ?"` ` H` `2 "  " ` $` H`  ` `0  2X ?" X @`{   @ r ?2< $?" ,< "f  " X  "X  @`W   $ ٘ N ,?2X 4?"8 X @`2A `@" ,E " , ` 3 m , ,?  X @@ 2 4` $` 4?` $` , 4$     X @`  @㿘  @"  "/ "  < b" $ O ̒ 2 d"  o@ 02@  2 `$  @ "   b2 @q 㿘  "  @ @    2   " $  & @& @  & @   @ 72@"   "  @ ;2@ 㿘 <     `02 ` ` "    @  2  $ @:0㿘 ` $ `> D!@< 2XN X@F   Ȕ 09 #`(` '  0 2` `$      " >   2  $ > `Ð#܀ `` `  ` `'`'`$``$2`X> Ӑ!XX@  " X@ 5؀ k؀ e"0B  ` 0ް  ` ؀ (  < Ѱ B@qo` ? %`> !p %@ܔ~ܐg    #`@     0   `    <  8     ؀    ܔ p ` `J`.`   `  ܔĒ S $`  ب  ` 2`  $`  ܒ q   8ܒ  2%# ] "  ې Y@2> Ґ!Ҕ Kب  2=  `@> ! #@( `2 `$   鼖      2   $ 飖  ;s` @> `@> ~! `@2 > v!b"   `"   @"  ܰ  <@   Ͱ B  `Ȁư v9       2  $  `?2`  *`2 > $!   髖   % ` ? %`> !p ܀   "`> " 0a > "KI   ?2 `$ #`#\  #d#h#l   1  > ?  >  <  ?#?*  .@2@ 6@ '#`#\ #d#h#l    uǐ 2    2  %   ?%   D ?p`0! 7 5 ` ?$`ܔ   ` 2 `$`0O܁`` `$`> ^"@ #@  !  aܰ 2܆       $`` `$`$`0# <`I3`  3  $=  @c `?# ?*  *@2@ 2@ , '7/` `L  .``  / ./? ?* +  2` 3  '   f? * 2 7/` `L  .`` 2/ .  /#`/#\ #d#h#l    2" X ! @&L > "X:   P 2 ``$` "` 2 $ " ``2`` $`M"@> b#C㿘     j5> ` `2 B# 2) B ` % ` `0   2tI$ ` `?3`  ޔ `t9 㿀 (`  @g 0@@  X D 6 ` Β`(>   淐 ` $`  #`#\  #d#h#l  N 㿘 `愐`X  D 2   `2      (  \ 㿐  d   #\  P yƔ㿐$`> ː"p!<@& @ Ԗ > #i0V @ > !`$  3`     $ $ 2 " < 2` d     @ ;2@  杖  2l 2@> D#% &> ;# 2`  $ "`<㿘   `?    `?e 㿘> !Ȁ`   D > " ̐s(   "  `"> > !>  L$  㿘֐㿘 㿘? 6  3 >   Ԑ㿘@㿘@Β 㿘?2  . "@> *`!`A @@y   $ 㿘  $㿘> ! 4  @`@^$@`< !?c 4    * @      < 㿘@> 2 (> D* >h@ ? 0 (  ,, ,,<,,T,,l,,,,,,,,,,,,,,,,$,,,""  `?   "`"@ "   "`" "㿘?2   .  "@> !*`@ 4 2  & 4  @& 0Ð  㿘? 2 * "> *a `4  ?> ##$`4 ` +> `    0ԯ$  "``4 "`0Ԥ`0 ? $`0? 2` *` *  * " bl* `   ~    @ ~ 㿘?2  . "@> *`!@ `$`8S 2`40 `@' Ź "X N : "`0>  $`4ؐ! ǘ "`4   㿘 ?6 *"@ > *`!@`$ 8`@ 0Ł `@ 0`@͐@@ 㿘. "> * a  4 2&@   &` &   9 $ $  4  ?& 4a   "㿘. "@> *`!@> # 4 2 8w    44@> # i  `>  a         $`$@ & $ $$   4 $ ?& 4Ӊ((,  4@?` > `  "&( $ &(Y eR " ^ _R O L 㿘``E> @*` €@@A=@@_7@@1@@+@@ې%@@@@p@@@@А @@`>  h 㿘. "> * a   >   ` 2  Ґ` &   㿘. "> * a   >   ` 2  ` & ’ Ҿ  p` `  '`@''''' (㿘> . * * "bl* `@ > ~!x  `@h @@`"@㿐'> . * * "* ‐@@u`  ~Ȕ . @a @A 0` @3@0> >! 㿘. * * "> b*  @B` `  & x  2 `(>  ! x ?& x`( @ `X . `x * `.  H%> . * * "*  @` \a@.a ~e . a؀ @  $ $ D $ ($ `'$ ,x ' ,>  ` "#$`` $`x`(`@” @`<  `Xa؀ `X@  `X`ϔ `x`˔ `,`a $`p"(> "``~0> "> "а 㿘 . * * "> b*  `@ ,`H + `D "  `< "  t $ t " x~$  x <$ x`<`2`D@`D  ϒ  㿘. * * "> b*  ` @˒` > #D㿘`D `H " > #0> #H㿘 `. * * "* `> "@/ "Ւ`p``   㿀 '` ''  d""  㿘> `#㿘@ e``` @a*  * |2  @2   2   耦 @ |@2 ` @2 ` @2 `  @2 㿘`| e`` ` @( * `耢``"``& ``"㿘`|` e` ` @ *  &``"``""&`㿘   &`|&` &` &`0 <8> >>$>0><>H>T㿘>   {[  1  @ @> " @ $8$ |$   $ $   $ t$ x$ p , $ 5$ 䀢 2@> " }9 &@㿐 " 2 ""`p ,   &  |f  ` @ `H  "<` $ x`h  & 㿘 X  a}-&  ?$ "` " ]&  䀢 "V& ϒ 㿘} 㿘  "+ @  ~%&    ~$    `f `>  H` 㿘@6 0 ?" @ &@ &` ?" @ &@ &` ?2@ $?" @ &@ $&`  ?" @ &@ &` ?" ,@ &@ &` ,?" 4@ &@ ,&` 4?" <@ @&@ 4&` #H € &`( &`( &`( &`( &`( &`(  &`( &`( &`(> y 㿘"y " &` " &` "  >`P>`  " &`  " &` " &`0&`, @" &`8&`4 " &`@&`<!" $&`"* (?`!*`>#l €&@ &@ &@ &@ &@ &@  &@ &@ &@>   &`(&`H> .| | (  㿘#> .a| $!$a|$ T$! T$!㿘#> .a|a|! 2  @   a|!  T@   !T@&? 㿐` `@,  &@&`iH?  ]`> `= &@&`jɔ`` 㿘@ݒ $@o&  & & & @&  `2 & && pВ   㿘`0 &`h&`㿘 zǐ % `@` T ` zS``  T z 0 ` z>  ? 㿘  ?  A?2㿘> .!|@!| j㿘 k  *  * 㿘 䀢 "@@ &@& 㿘 "@@ &@& 㿘@ @@Y R   !  /  㿘 2  ? #*`@㿘Ԑ T    T  * @"@  4 $ $ & 㿘!> "|#>  $"|bx͐ "|/#@bx c$bx$"| @!> "'$c `$$ @$($( $$$,s|   &" > ڐ!pp> "'@l X h' l' $€؀ 2 ` 8` } " > Ұ!㿘   ʔyݐ㿘 @@6yΰ 㿘)X ” g  @둔(8"V "yX |$(($(,$(0y$(4V`> !> `!E ?" V  ( 26V  `(8V$ `$ $ $ $$` $ $  b(8 "  "     V 44(&   㿐`*  2  (# K 2@Ĕ  > ""D` *   2    `> "D   㿀'`  7` `ږ -` ";@ "`4"<":@ @0"0䀢 "x0#㿘@& 㿘@N㿘> #@\ -㿘 H!   - -㿘  -   㿘u 2   F` ` 2& P!> " '  , ["ה T"< H F - = -;  6 2a` * " ``H "`H2` 2 > ؐ"h"` "( &x" > "x0&$ D&( &&&,qr [< " wR |wא Gr ?@  2` +` *  * > " bl* `/  "@ " ' " #$!uDT!q @g"$ \$ d$ T$ X$ `$ P$ H$ L$ p @ɔ Z @Ŕ Z>  b@  㿐$    $   $Ֆ $͖  rN K 㿘!@  > !Ā`   u  2& & 㿀!   2''Ԑ'  O " " @  @ `@ "`@&@vh  㿘> ."u 㿘!> lC#lu#!> l>"lp" 㿘> V"㿘> z" 㿘   @ 㿘   @ 㿘   @ 㿘   @) 㿘   @M  - -㿘   @x 㿘   @ 㿘   @A 㿘` %  *@ `?* $ `@R`      2?   @h$  ?``@  @   p  @$ 㿘`>  @>  ゐ#܁㿘   @z  2@ߒvL㿘     @ ͒vj0v4v2㿐       #\#`@@vL v vvAv?㿘   @  2@u㿘     @  tv0uېuِ㿘    `@(  9  5  >  >     @"$ :    ,ג  @ # :   " "@㿘  `<   G) X`X@>   `_ " /0  @ W u\㿘    @   @ 2uDҒu?㿘  @H 㿘>  @`㿘 @$ 㿘   > n `㿘   > a x`㿘 `͐ 㿘  $> #܁  -㿘 @{ 㿐   #\(,  k$  - - - h X !  x `''b' |'  0' ' ''` "܀ " xp X! E  x" ` ` ''' |'  (' ' ' "䀦 " x` X !  x  (  , ," ` p@"  ` ''' |'  8' ' '''h "Ԁ " x㿘 `  b`8 '''#''`|`'`'`''i` '' ` " `t ?&`t㿘 X  !> Ӑ!  t  㿘 X ! <  `  t  㿘  6    @` " > !@ 㿘 `" @ `    &    ``{N` 0Ւ`, ` ' ``Z=`t "`t` 2 `< (< X$ <$ @$ p`I 㿘    >@ >` >` >` (>`  0>`( 8>`0 @>`8 H>`@ P>`H X>`P `>`X h>``@ X `! @2E x`"`  @2= x` 2 (`$?" `  (@21 x`$ ,@2, x` "` @2$ x`"`4 @2 x`4"` <@2 x`"@ @2  x@"X  @2 xR   `t  I"`t'e''#'' |' ' ' ' x @$ < 2`4` ?`$?`$ ' ' ,'`4'ܐ @' @' <' x ?$ x` X "a " `" `@" 㿘        *@2 ϒh> `'`X`!@&`` W ?`< S ` `J`.&qF # @ <7 1?`  ' '''' |' ' '` '``, `!( "܀  @  z  "  > ֐!X0>  X' ! '`|'`'`!'`@z'  ?'Y''#'' ϔ!` "b > ʚ!ph>  X"' ! '|' '''*''Ȓ@8! (  ?!( "܀ bb > b!X>  X'!`\ `XX@  "  X@" 2  ' |' ' ' !@'Ԁ `|'`!'`'`@'䀢 (  ?''E"8 "̰b > !8>  X' ! '`|'`'`!'`@'  ?W''#''  !X "b > Ր!h>  X"' ! '|' '''e''Ȓ@s! (  ?ה!( "܀ bb > ɝ!Ё0 2'ܐ` @ *  ``} P `( 2``@  2 ` @8' '`j X>  X' !` ' |' ' ' !'`|'`'`'`@'䀢 ( ?'' ]!8 "̰b > (!㿘 X `!@)X V )X-  @% & |&  & & j& &P&T @縔(' @粔! (  ?)X " 㿘(`f @   ``ɐ `Β 㿘 , <    Ė > 䚐! t $ t x 0 t   p 0  t $ t p`X`a x  <`$ xoȐ $  ' | '  (' '  ''b{㿘 >  |"(  N  x`"> > "X"`> C"H x`"> > "X"`> 8"h t> 4"x>  p0"㿘> cLcL?@  > > > "b— B6@ & > ⅐#* @㿘> #L#L@   > > > "ba ^ 6@@  & > d#@.` .㿘> #L#L@   > > > "b= 6@ @ @ > B#h.` @`> 8#``"    > #! €   .`  > !#  "  *`"   $  "㿘> cLcL?@  > > > "b 6@`@ @ &` > #.`@ 2"@ > #`` @  *` ?.`# `@ `* "`?#`㿘  &   &  $    " $@ $ ?   @Ö 0@ 㿘  ?@0' &    ?&  $    " $@ $ ?   @?0@?㿐> ֒c(> > #\ `  (  z 㿘> #L#L  > > > "`(pR   6> > > "`(F 뀠> @?2 `ن 谒 ". * 2  * & & & && & $&  b &  b  &   b  &  Ò b  b`    @ϕ*㿘  >    > > > "`(!  b  b  b $ ?">  b>  ڿ㿘> cLcL ? $ P"@   L> > > "`(˔!5 @ 2 > > > "`( ࿔!66@ ``$ ̀?ʐ@ɖ Ű ` `$ ?@ 6`" @ `$ `$*  " * ? ""$`,2 `$  ?  b-n  2-`$% b?$`$- b a b \ bW  ` 2`  b` b  bg & `> > > "`(HC!% `*``*` $``*`*  @`$` `*ې` * @@`$ #$``*̐`* @ْ `@ $`$" @$ `$2* *  % ?%" b$` $` b b ? b 㿘> #L#L $ "   P> > > "`(hԔ!2 L` @ .1> #` , @ "    !€ &` 0 '> #`,   L@  @6 `` *`  €` &`㿘  #>  ,  *` `@ ?ߕa "@@   & & s& 㿘`P 28 "*`$`$> ` cT"2   , @ݒ@@֒@@* `$`$@@:`$` &`L"@ߒ &`P`8 > `8 ?&`8`$ ` L" ? L> > > "`("" 2> @? `a 蠒 "- q.2  * $ $ $$ $ $$ $  b $  b  $  b  $   b  bʐ  W`P    `8 &`8 $ 0H@6! `L+` @ *`  "  @ `"`@ "@  "   *`"   $ `@&`L +` "   @x* `&    ?&  $  ? cL` `$" `?`L@2 `8&`P ?&`8&`L㿐`P @V?#-> -`@ - `2> !ފ $?`0 2;`(   4`(" @   #\   @6  `  "> @> @="@2- ?$ " `( @@2N6`(`@&㿘> cLcL? > > > "`($#m6 2 > ,"" " 4$> ""8 2 @   &` `" &@㿘  b*   & $?& $  @ܺ*  $  8"`"@㿘  $@@- .`,``  8 @&@ $  $ "& $ $  @@ڑ,`` -`  8 ? @@> ݯ"`S,-@,``  8 @$ $  $ "&  $$&  <> "@ @`8  $$ %8 $ $ "`2@@@@,`㿘 6@:  6   *  -* , @& ! *@"@  @  +`  ?+ "    *`"  ?& ` @qˀ㿘> #\ > : "a> ."@"㿘> #L`|`x@"@ 8$`|> `t. @ݔ   b> "{> # ǐ " " > .`""`" " @ۏ`x `@$`$`x>  $ `""`" > L|  |> ` > L "` "" " 㿘    0  @D !  " ( 0  ?> > > #c h| $ 0$  "> # 4 (! €@6n@> `> & cL`"` "`㿘  @GÒ   & > cL`p?"`p   0    .2 ." 0㿘> ." "!   @6 ,`@  6  @ "   `@&  2  㿘  @M`"$ ``" `> >   # ` @Ga $`  (> '?P# @4 (> #a€ @/㿘 (>` $ * @ @ >` 2  2 >  !   &" $& > &   @{ @㿘`  > D D#> ۳#` @7 @   `1 > > >  (`8ۍ!\* @ "@   " ?" `"`"> !I 0` .`@"@㿘  @0  ( &/>  $*@`> #L+>  `,  " @F p?$p  , @a  & $ $ c† /> > #L , @ " @F `p?$`p  &  Œ c㿘> #L `  . 6 >  > .>  "?$  $ $  " ` >  > .`">    " > ".  $ $ $ ``*>  6` @ : ! 8  c ( $ $> ِ .  c $ > ϐ! @ك `  ?$ > #$ $$  $ $ > .ЖЀ $ ,А ,"`0"$ 0㿐> .̀  "> .""> .!> ֠#("b> > !aH X   ў#\> > #\"aX 4  є 㿘@ " 㿘@㿘 ` 4 1&  ,`" 0 0"`0 0 ,"@   > #L (   4 ( > #! €@= @,@4?`2 (  & А㿘 `  > cL    * : : > L8    +@; 8D ;`  2 (  > ۜ!`L` * :  L  :`@d2`*  *`  2 @ `  ` `" @,m L f   $` ` 2] $` W @ :E4 @,Ԕ C` "  49>  6>  02>  0 21 , 2-> #! €@-K$  0 2 , 2 (  4 (> #! €L @m @\@3oz!` ``4`` 㿐'Td@h   @Z > ?#Lc?H@,c 1 @3      @  J `* `  .`@ `#\  @1V "@`(`. ` 4`(4`.@`( `! @ >  `4`(& > #L` :D@T"   @ ?#  2|> @w> !> #L @ΐ `!  `4`(> " `4`(& @+ޔ 2`(#\  @0 2`.> @7! 4`. >>   "  @  `* ` .`@`2@,`(@Df  `( ?/?ƒ@CԒ `(? @ @2n4`(0> 'b8 4`(€&> #L` :D@{ 㿘 (   > > >  (`8K$> #! €> #T@= @,`&@@2:  "   "  > > >  (`8)%     > > >  (`8%  㿘a @Cw 㿘> ."Ѐ`@ "`,0  㿘  @,  ( &?  $+ @`"? `*6 ` *`@-@ " (&*@`2 ?< $ 6  , @ 6  @  2  &  㿀> #T'.@  :`  #\'  #`#d= ",  &  (` " > > >  (`8 ~%˔ @B ?(# @2(> '"P €> #a€ @+%> . > . ܝ㿘 > *aD * ` @`Z>#@U>#@QO 1> @?E#L :F #> .b؀`& (`2` ` (`` `&`> > .`"ܒ"T b`` &``&`ɐ` ?,&`  bذ``2` ` b >  $& &&  & &  & & & bb؀`&  "`$$b& $ " 㿘  ?1&   >    > > > "pbɔ!9    & > > ."ܐ"   ` $"`$ $ " aV  㿘  8 ( \ `    > O  `> *aD * ` @    0&@ @ `B -> # <̟@      > @5#( > #L :`@ D @ ,> ,@@2       㿘  & &   2     '>  $   h `  @`"˔ 2   $  @  2  &  ` !`    $  " *&  `8 "  `( ` `  &  `& + `8     n   8`  >  ` 2> ` z > @5#@     k 㿐> #L `"   > #aP@ "@> #aPD "D> #L    0  R "/#\ ( `! `԰ 4 (В`$      . >  P" 9     > `" *     @-      > `$@4#p      `$ @A+  2  $ ` "`> G#  ݔ   @ Ԕ  ܢ  $܀J` ( " (ѐ (?# @` 4 (> #! €v`     ԰  A$Ԁ  2  > > > #c!&@@P ?& @.`     " > '"8@@(`  "  L @"    p   $>  t> 'LcLcL  `?'D'P# .@ '' ,'ؑH/` /> a4P @ P*T:H 0  '  ؔ'<''` "`> Ԁ#   @쀢        $" *'`8  `(   ' `'耢G`< P    ɰ ` 1  H 'HL H 'HH 2'P 8 P` (     ϐ> L` "` P   ( D   D 1 T> * `L*  @  > > > > #c"ҐcL  @ 2 8  $@ "2  ?,@   @ 'D      L% O  T`2O'@`K &$ #. @ "   "  ( 2  0 2  , 2  > #! €@'P &. > #L   ,@  0%B :`@ F ,`@> #L` ,@'@@@U X ?@ > # ԟT  <&@ "9&@ X3&@@" -'@@ `&> `0 &#L`( ! !#L@'H > L > #ؒ`"   `H   0`̒@4> #L> cL``@@` P @#`#\` <LX " `z 0r@ 2p'L> cLX "`  `0%`8B 'PP P #\ @ T#`#d PP`G'L @C> #L -> ;> `0/> `( @> 0cҭ# 'L@& > # $8`H   04`̟@?`( 2`(> #L`@ɠ @'L@ - @<` ``> 0> z XP  ` 0`@ 2< 9#\     @* 2     > @1 @&> #! € "  `0?"`0 #?"  c. @ @&A2.$ .c(  @ 6.6(&W>  S> L n$   #\   @*O  2*` "k   ph@ > > > #c$@2̰  x"> `$@1/ e@&G(?# @6( Lܖ # @? $@#L `"  HP  0> # ̖@4@܀   X > #L`h`p  > > > #cѡ$> @0  L  @$(?# @6(1@%䀥L?'L ? P> > > #cv%2` `8 @ L > #aP@ "@#aPD "D   > L`  "`'P 0" @8C P ?P `#\  T#`#dLP ` `> > > #c(%[ > > #  S > L`ؐ $`` "`> #   @   `ܠ  $`L (`   L a"      -L`( L L( > #L Ԓ`" $  > > > #cŔ%€ F@$Ґ L? (c <2 (b > #L! $!8`2L0 P`2#\Ѷ     @(ۚ LL`( LE L?(# @2(@$L  ,  > `$ @/ʐ!0@$(!?# > #6(aL€ L`( L L#( 2(L   @) @)'L> a!@ L#\8@?    @(  ;LL`(  @$BLL? (c 2 (  ͐ > L`p`h@ > > > #c&Q@`̰  $`r`> `$`@/Q!p؀?"#> > #La"a@$a  > #! €LL`( L L? (c 2 (L@# #La  "a  Lܖ 퇒# HP  0> # ̖@4@܀ (L( "(p(?# @6(  Z > L`h`p  > > > #cϣ&> 0 @.! ؀ @". ?(# @6(> cL @ӄ  r(@#( "(1(?c 6(    㿘%>    @ 0L  㿘  > [#  ~ @ ~ 㿈  > > > #c0'7 P@ >  T > > > #c!'E@ Ҕ @> '!v>  ,%> '> > # Ԓ > " ` @:`$> 㐖X'S@  0`@> ` ('㐖p'V H`> @W> #L > ` !2 >  2: + "@ *` @ 2@ @#@    2: 2?? * "@*`*  *  "cL@"HcL@@ > #㿘  > cP@8@5> t` "`> Ι" ~/ t@t` ~$ > `p   > !@ > c* * 㿘> #P@ 8 @   㿘> #P@ 8 @  㿘aP&` @ > @ &` > `t Ė  "" > ;"&`  @   D`wՐ"\@c㿘!P#>  @m% ,`t & ,`t@&!P  :`0  :8 :`  > :(L*@   :`:P㿘H o-*@n ,@   H 001& ,H 0> t !PZ@ > Ґ"H/` /N 1`@1Ð ,@ * & ,& H 0> cL` "`㿘>  X  J1 2, 2J6ࠐ?ऑ* @ "@@ $  2J1` > > > !     > cL``: >  > @,#0> 㿘>  X    . "->  ,  2# ! 2 L 1   (  4  @ @@$`(    2 ,`> L@* :@   " @㿘H/` / , 2 N 1H 00 ?`& ,@1'& H 0> cL`>  "`!Pt@ 㿐> #L`2> > #`  @˦ > ("`@!@ @@F@(]@$) @㿐  @@  =#@@| (> $ > #L @ @  8  @     a-> t@  UL@ RL 4`* @ *H G $@8t$ @ )>  & "h   @`"{ 2 &t@@  t` ` {   @ h   t㿀>'> "!4> "a0 > .> .> 㰔#"a(##"" ""> " ?!> ."" @> '#"@$"E#'#`&  #\#d ?@ @? b> #b> " t㿈\`@> #Pc'  . #`#\#d ?@ ? "@> #&@Fz  @@ 2 @> Ӑ (@$@@Ė > Ð X㿘 > #@ > > > >  `ˢ!>#L&2  *  @G   @ L ( "L 4 ( o6@ @%L@@  0+  (      $8 2 $( ( "  4 (@T`C@%V 2 㿘 ? > > > >  `B!#L &2@  *`@0@g!> #> '> %>    @R #L`( "`. `(!!   `H!>  `h!@% #L@@ ۘ 0: `7 #> %> '> ` ,` `$@8' 2"`$(`( "`.`(!  > `Hޔ!> `hה!@$֐ `2` 㿀> '#@ > > > >  `!#L  P## @ . '#`#\#d?@? P 2N>  t`PE" ?#   #\ @"њ ( 2(2` L h p@  > @@ ! > @)!? > #> '#t4  L ̒4 @ L&@2˜ 㿘> #P@ 8 @ @k 㿐  >    #>  &   bh j  @`"yՔ 2   & > #L @ 8 @ @  ͐   y  @ 9 㿀> '#@ > > > >  `"x#L > ` P @ #'.@ '#`#\#d?@)? > O  t``PA" ?#+>   @ " (  > Ր!2(  "a "`#\  @! ( 2(> #> @("` ̒4 @ L&@   `Ƞ  @[$㿘@ 㿀> '#@ > > > >  `{"#P>  P#'a(@ '#`.@ #\#d?@?  㿀> '#@ > > > >  `U# #P T@  P.@ "@@  #> `  Pc''#`#\#d@~  >   f `㿘?Ė?㿘H / * ' > #LD`?H p@㿘H / * ' > #LH 0㿘> a,   > # & :  $, $,, * ,)> '> #> L  tʠ a8,"*` $a8,> b"!<"$,>#`t 㿘>> #  t 㿘)> -> /> > !,!<@ 8 0 ٘  '> %> t L    "  H /f * ' !<8%@%8%! 㿘H /f  !> !<?$a8$!<* ' !> #> '> 8!<   a8 耥 > H 0!<,@a8H(> > a<!8""!8"a & P& T`& & & &    wq & & & H/` /> 44 "4 "`"4& H 0 㿐     #>  &   bh   @`"wn 2   & @1   w[  @ڒ  " 㿘 ?  &  P T @AC 㿘`@L "` "L$ `2&$` @ $`@" @`$`` &``@@2"`"@&&@$`@` &`@$ $`  $   $ " @$` $ @2"`"@&N$  " @ 2@$ $` $ L2&$` ` $@`" @s`$`` &``@@2"`"@&&`$`@b` &`@\$ $`  $  $" @L$` $ @2"`"@&$$@; `$ @5$```"` "V`" 㿘 2 ` 2'& &` ` &`" @`&`` &`@@2"`"@&&&`@ &@$ `    ` "& `` 2)` 2" &   & " @Ր&` $ @2"`"@&$ &@Đ $ @&`` & &`  2" ` &`" @`&`` &`@@2"`"@&&`&" &` @ &@" @`&`` &`@@2"`"@&&&`@~ &@x$ @   "&  & Y" 2*`  2$ &  &" @N&` $ @2"`"@&$&@= $ @7&@` & &`  2" @ &@" @%`&`` &`@@2"`"@&&&`@ &@$  " 2@2& 㿘@2`K` F @ "` 2``` $" &2$$@֐$`"@$@`$``$`` $` ``" &@2"`"@`@$ @" ` 2" @$    0`` $" &2$$@$ o㿘@  `  ? @ `  2  &` &`&`  &@`6$ $@k$ $@  " `  @ ?@   2   "  20   " "  `㿘` 0@`  T2 ` > > > "xbĿ `$"@@`8`  8㿘Ր&`&```㿘ǐ&`&` (G "> ě"` 0@ܐ㿘`ɐ (` 0@ ΐ ɒ㿘 > !`I> H /f * ' >   h '#> ڐ  > Z"'>  %> *  ` "  cL@ƺ `? , * " Lx > ː#(cLT`  "h"TH 0 ". X t > #d`> cX@(  > #V  . X#d`> cX@' > !TG . X㿘 X  H /f * ' > h> & cLaT"h?"aTH 0 0> #d`> cp@'ʐ > #0 #d`> cp@' > !T㿐>  > > @"@#"`"` "`"`> > "#"" ""> > "̐#"`"` "`"`> > "#"" ""> "> " # c" " " > ?"> .c" h#h"`"h``!> ֠#(> > " `#\    > > !T` `   #\> > #`#\ `  u 㿘@<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P$ $< P `(`&`0@ B >`0&`  P  L`L `& `$ `$ #  "`8  v (0 `( €㿘@<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P< P&`$$ `  (`& 0@ B < 0`P `L䱒 L:  & $ `$ &` <"`8  & (0 `( €㿈`4   04 5` c      @` rM `?`   &  )\" E   \    #>  &   bh   @`"r! 2   & \#d#`@#\@  >    r  a@ "a@  ?   > > > > "xb(@#$ t `P@" u`$@@p 0@l`(h"`8` `0"@B]@[`8 V`<R`@N`DJ`TF`H B`P`` :` " >    q > c  "c `"`$@`$$`$1 d`|& 2z ` > #L   Г2@  n"Ѐ 0`@ @` @> c̐ "cF@@$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8$ <$ @$ D$ T$ H> #T *@  % $ P$ L$ L$ P `& $ `$ $` " & d 2 d> ` #L   Г2@  " 2 `$ @:&    p    0  >   @  "  $  >  /" 4 `  L` ( 0"" @*$@   (  @* "#   2$"#  㿐@?\' @L  ?@ @im#'&@ T@     0     㿘   а >* > P .㿀`'X'HXd  > > > "xbH$@  H> > > "xbh$H`P @ 'H`TH@0@`P@ ``0@ $'H8 @  $'H@H`T@ـ א`0 @"'`` :'`ڰ #\ H\ 2'``( '  H`$ `"``$:`$`:  `"* `$ * `(`@ `"*'􀢠H$@ *'H#\H 2r @:I`n`$'H#\`H "`\1> `'> > '  :bxb%" * '*  $'H#\Hʚ * $'H?@KfH H?@-k'HH`T@ `0 @"'`` *ܰ '`H&2#d#`#\㿐 P@* T8@8/  @ 2  &    @  0 &  0'& > #L $B $   "@ ( 2  H @ Г2@ " " H " 8 $ H $ 8 "7 ( `0> '# > > > "xb%  @:#>  t`P $ "  ("@  8 @9 $>  t`P $ "  (Q"@  8$ ( ?$ 8 @9 $ 2  &  &   #   g" "& $ '@` * $&㿘 1> #L#> %> '>  H " PbxÔ&5    $ "  L2  8   (  "   ( `" @   2 H㿈> #P P@  * ' #` #\#dΖ `?㿐6 `  `$2 `( 2{ `P u + > >  @ p$@ (> d!P      > Z!h  > S!2 > J!"(`&  @"& ` "" &"` ?$& ``&  @2 `&  & "`"`~ 㿈> #L @'L `> > > "xb'4 `" P> > > "xbؔ'6P'L 3 Lհ  @ '   `'   #>  &   bh   @`"mS 2   & U ` &@ ` @6 &   `  `'  0`'耏` `$e 8``     `8 Q`  "$@ @' "E $ $ $  $"@ $ $ $ $ (`$ (` "€ 0@B   < 0``8$ 8 @ <$ < @$ @ D$ H$ D P$ P> cL L4@  $ L   $  " 2 5 $ L쀥`' T$ T%``$@: ؠ  " '`  @[`2%L଀     @`ljఀ`?` ഐ &ഐ  L @ ) ` ଀  lI  `H " '&  ` *'& ' *  0&` @7/$ ' ?&   #   "$  '` @߀`` "  ଀  k     k `s `2L ଀  Lତ #>  &ଐ଒ bh e଀  @`"kД 2ഐ &L@ ଀  k        k 7`- `L@  㿐 2  P   #>  &   bh   @`"k 2   &  P@* T8@8z ` @a`$'`! ` 2 `$2 `( 2 `P 2 `8 2  "`8 "`( ; 0    k1 㿐     #>  &   bh   @`"k 2   &  P@* T8@8   ` @  ' 0@` `8 2\ `@2W `@ "L ` *`8F  `<&`<&`@&`<`< 8`  H`> '`H?&`H> ' 8`<`  ?`` `$ `H 2` 2` `$`  @  2 `@" ` *`$   j 㿐4\ 6 W   0   #>  &   bh   @`"j\ 2   &  P@* T8@8S   @9  }$ D "  * $   j"  㿐 2  P   #>  &   bh   @`"j 2   &  P@* T8@8   @  0  0!4 6 $ T   iɔ   "  * $   i  㿐  > > > "xbH)"  2  P   #>  &   bh !  @`"i 2   &  P@* T8@8 21    ij ( I @[ 0   $  @ ` ~ " * H􀦀 H "  ' H $O  * $2    i! ߰  0_ [ H 2  8 2 "  <  ( 2     @ $: H < ` ' H $! @ ` ( ?' H  $8 H2    hȔ   "  * H   &   h  ` @ ` H 2  $ < " @ h > "h 瀊`&   @> "?' H " * H H? ' H ' H $鍐 2 H2*  hc !  瀊`& c  hS  hO > "h 瀊`& O  㿘  > > > "xbH* `   #>  &   bh   @`"h 2   & `` L 0@`H "`` &`H`$`@2`H `&   g ̰ `  & 2  L   g   0@ `< " ``H 2``$` " `@ 2`<> #L  2  H@ @ (     g  @% `<`"``H  `8 2`H `2` `( 2 `H` `$  `H &`H`@2`<   &  g  L @`H 2`` `$h`< "`E gv > ؐ"h 瀊`& v  @@> ʐ"`< "``H?&`H`@ 2`< L@" `< " ``H? &`H` &`H`$_`@2`<  g8  瀊`& ;  g+  㿐 2  > > > "xbq+  > {"@ g  P@ T8@8    f а   08 2$ @`  fߔ    *8  '1> 7> P@(> "x∖+k i>  `"f $&@"^ L{ "R> ` M "5 4C>  @>  0<>  0 ;>  , 8cL . 2    "0cL> "x∖0ݔ+ۀ> #> "x∖HԔ+! €@ >  4 0 , > @? $@#> ǐ#`> cL 4&@$ $  `@ "`8 2      2 '  ^@ f) 㿐- @  0@" ` @*  `< 2 `$@ ` 㿘>  " @ 㿘 @ 耠@ /`@0 @0P & & "`  ค ฝ㿘   @Ɛ& @A@|㿘 @E 2g  " )  0   %>  $   h 4  @`"e 2   $  `$   e  P T  2  H   %>  $   h   @`"ep 2   $  H$ P@$ T   e\ 0 S & @A}@㿐 ? ?&  " ೐ 2     #>  &   bh   @`"e) 2   &    P T   @/> " B&㿘 2  #>  $ bh   @`"d 2 $T P ^ (L0@> #L'> '`8`" ` > 5# 2`D> /# P4` 2``   ՛ @<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P< P P  $ H   $ "  L!2  (`"  ` " €   H & $  H$ #  8"`a@<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P< P P     $ "  L2  (`"  8` " 8€  8$ H` $ 8  H & $  H`$ " "`P "`H  `H     `H  `P )&` "`@`8  `@ " `8`<` ` `$`8 $`8 @  < $ ` `@2 `8&   c  $㿈 P>  Tƀ# >     ƀ @?> ƀ H`2 0 L@.>  %> `0``P` `$`(#``L#dƀ#\`8  F T  F T  F T`D#\`H#``T #d`<ƀ`@`@2`0㿘>    ƀ  ` 8> > ƀ!`ƀ!`"> ƀ!(  #> 3>  ƀa@@  2 ƀaP   @  > ƀ!X㾐> "'> ƀ!ؤp (!> > !` !x .> !! p *>  , 4ƀ! >  "0 0 ƀ $> ƀ"h`g . 0 "    2> ƀ" .> ƀ" . > ƀ"  2  "> > ƀ" .ƀ# .  @Ð>  (* `    0 >   >  >   > ƀ#H 2 > > ƀ#`␟ƀ# > ː#0$00|0H2@0d01122 3X3434223X3X34㿘> c@3  2> > @ >  >  2`@ओ:`  㿘>  X` J`1 " a4  &` "   ` 8`` 8` ``2J`1>  (  ^%@,` ^4 $X=#` '\#\ @ Ϙ` ` >ː"*` €>  @ 0> L !X> #DoĘ tk> #L X' A ^ \ ` _V S*$ X@U d$ LM > #L \' # @ X `  _8 5*$ \@7 d$ P/ > #L `'  " X \  _ *$ `@ d$ T >    -"""" """"" "$"(",> X`8> `,/J`1+>˄,(> a4> 2`:`2`:` "22``2`,> #L ",   l  "  l "  " "(""" "$@@@@@@A N N㿀`` `@@ '_ ` 2+@   W% R` ('    2 '  ܐ@  @ `2( > P@ * ' #`#d#\ 2 `  `ܒ (& @ > & ` `0?"`0`, `0㿈> #L ` @  * @ @8   2 '⪒ ଀ > #Ȑ ` ﳔ +'0 3> 7> 8 " > c@!@:$> cXݔ! @"i ` c  $8 "!((`  8`> cp!% $`2( @ #L  @@d ``߰ L`"@  '@>@@@˰  d   ܀ E'@u?EY 20  $0T `2 ( <       @D 4 @ 8   @G`  @0, $00=  <2````   [ ``@Y M @   C >`8     @2 `" LЄ + `  ; b 2 ( #\;` d #h#l@ ' 0,?`$00㿐`@`   "> #P @ @ @ $@ .@ @`-     > D#Ȑ ^ٔ  $ "@ ^ɔ "    @㿐> #P@`  =$N> @6 8H  `  `` `'>  &`` h `  @`"^ 2`` &`Y  ` ` ^s  ;` ` ^e     㿘`@ `> #P @    #@  @       㿘> #P@`  ` #  @   0   㿘> #P@` @  ` #@ 8 >̐#̓* €  @    @    @  㿘> #L @`  $ * @:   2 H  #s@ "      㿘> #P@`   $ * @ s "      㿘@` s 2   Ud  2 #㿘  H  㿈\ `  >  L :  2װ 2Ӱ `@ *  &@@@ ǰ 1@@Ӗ @ 2`,#8-`??C B < `?@Ԑ ) %`@"!``   ?   ` ? ? `  < t r 2/ / -`  l#`#d#\ꏖ R`2`S 2 ``` `!>  $`` "h g`  @`"\Ҕ 2`` $`` !L`` 6`H   ` \  @@@   " @@" 0 ` \  `@H&(H㿘> #T!>  @͒ X@ @  P*` H /f4* '  2  2  $2 H 0 ,2D,.> " >   .? > 2.L`"`. 0 2 >  " >   .?2.L " L  ,2,,(2,> "  "  " > cL`"`.2.` "` 㿘 . " .`"  "`> "  "@ .?# > 6 .cL`?"` .`6 ,  `0> > >  `Ж ր "> > & &  &  ""  .>  cL6 .`> 'P "` (` > '#x@ ? (# @6 (`.!0 @2 ``>  "`` >  `@ `.? > 2`.L `,"`.@> ` ` `@ > 2`.L>  "@ "`" 㿘 (?> #c 2 (㿘`(?> ## 2`(㿘> >  4 cT> 22: @+ "@ *`  2   2: 2? *> > >  `Ж0]!; " * `@㿐>  'D'H > > > > ;> +`` "" ` `+`"" "  "`> " ̒ ""`T"`P""`X#"" > "a>  `> .!  >   "@ cL` cL.@`H. , @ @Ȕ>   @ ]> >   +`" *   " ,> $!> "  @ *@cL>   0( " ` @0&  @"`4" 8@"`<" @@"`D5   8 cL `% '@cL`@ ڢ`H> `@+`> "cL>  @*@D "@> b  H*"@> ` "P $ 0> "   "(","`"\"T$ 4$` "X"L㿘> cL cL"cLcL "> x"0` "    `* 2`# 㿐> #L#> ` . %> !> @9" $`"8  @ $$""@"> "> C"`@@,$'> %> '@ t3␐ #L 㿘>   ("* > #>  cL`>  Ԁ``> "` @x> ` @ 7`  :3  `*& @ `   @ #@  2?> "! > `  " " """""   @ 27? @ 1 * &@ ? #@ @ i  2?> "^! >   " " """""M ?䄀z ? C(> "`* >  cL  `   :/*&`@"#" 2?> l"! >   " " """"" ?䄀ˆ 㿘      㿘> #L` > 0#> #8**> > %#` > #>   # > #0` > ` `  `@ " `? >  @  ` `   `@:("* ` + " * ? ?""  "$"(","0"4#@#`#`#` (`?#`#`#` #@㿘>   `#>  9> >    "@   `,  &, `> `T#L`P.` ,  @ 8 @   to  >  P0q ?  "" ` H /f * ' ` " X" PG" T*`=> >  cL``"` ` "` " ` `"@$`` @1` X  P @ *`  $` @$ X  P, @`"@` `` X  P *@ "``2`*H 0> "耥 tݬ㿈!>  >     $>   1>   @ ;`    Țs#\`  `> j > g!> > Ta!@㿘\`   > > > >  a@X#> #L 8  :   > > >  a@x#  <@ >  @@  D   > 9 ܀   ` cL`  8` cL``,4`(`( > #> `> "܀      !> `> 3`2>   *+  @@ )@  %@  `  0  > > >  a@.#+   *   ` ̀`> !+` "`" "@cL?" (a $?"$ (!  "  " * I 6 (6 *> & & & :6 .`6cL @ܐ  X P*@ H /f * ' &  & ""H 0 &    &  "@ "  ( `6 ( "6 . ? (# @` 6 (> #!@0 㿘  O` (  > > > >  a@ #T!>  @   X  P*@ H / * '   " "`  "H 0  `"  "` "`   "@ (?#  6 (?" *& `6 *`H *&  ( 6 *` > > > >  a@9 > #T!>  @-  X  P*@ H /f * ' &  & ""H 0 &    &  "@ "  ( `6 ( "㿘 (`W 0`?# @6 ( (  > > > >  a@ #T!>  @   X  P*@ H / * '   " "`  "H 0  `"  "` "`   "@ (?#  6 (`?" *& `6 *0`" . .`?# @6 .z& `"  .> > >  a@$ %> `"  "`> "  "@ .?# > 6 .cL ?" .  0  `2   >  " `"  "`> "  "@ .?# @6 .L?" , L6 ,` ?"`  (?" @X6 (&> `*  & *  "@* "  6 .L``$ "`>  $ 4@㿘 @*?##,` ?"` (   ( "   `$€  ` c4 (`4 (`@ݑ,`㿘> '> #L$@6% 4ऒ  ऐ`` @ ` 2% 4 00` "`$` " $> #!@ (!4 (` $`" $` `$`$ $` $$$ > #耢`wLwtwtwtwtwtwtwtwtwtwtwtwtwtwtwtwlwtwtwtwtwtwTwtwtwtwtwtwtwtwtwtwtwtwtwdw\㿐> # Ԓ> '#  > > > > " b0xf A#T> ` !2 >  2: *"@ *` @ 2 @#@   2: 2??* > "@*`+   *   > > > " b0# C㿐!> > a t`#\@ ' > "c> > "c t"~@> > "b"> !"!"` >  , @@` @ , 㿀 /> )>  L`#`'#\#d.@ # ?#? 3> > c> " > > > "`@":@  #"@ '> > > " b > 4  "c> > ##" L $5> #> %> #-> '>    b  ( # b   4̟@`L @ 㿐> #L > bb .@ > "") ' '> #  ->  /> '   %>  $   h   @`"R 2   $ #㽘  #%#` ` R L .@ @@  X 㿈`'X X` @$ > 4 ??耢4 ?> 쀢(?>  L@@b :  2  @ ( & s&L@@ސb*`&   & `L  <` B C`(U "N . 2 ( "G ( 2 ( 2 (> '#x@ ? (# @4 ( ( 4 ( ( ` +> #!`4 (€ `2?&* & &D` 4 ``耢4``㿈'XX ` ` ;`#\`  &'@ &    `@  2 M K `D@A 0= `8@5!  `  `. > ` " #T@ `  `\   ``@ m`@ h`  '@&@ R㿘 d?> c#Lc @V T 2@ . !"@  " " @ @    @`( "@y @(` % @.  @2(> #a@€ @`& `$€  > > > " b8" 2(> '"P€@> 'b8€@@`( 2`(`㿘> #d`> cP@v >ݐ & X& > !  &  "@" $?ԁ㿘> #T 8:@ - 2  2 * #> #d``> c`@R  0(  4"  0 2   > #L` H,ː@,$  H .`@@ΒW P/>  3> 7>  @`. 0@ `"`` ` bp#;`(( " @@ (`@"@>  b#M`( @2> ' > '"P€ > 'b8€@@?( 2(@`( 2`(` >  0  >  \ "> 3> ! $>ل܇*         㿘 H /d * % >  > c <> <#> aģ: N 8> #\ @~ǒ"H 0㿘> #L` @ `: $`< : @ $`< `, @$`<$`<`< @o, $`@ $`@` @g $`H㿘> #> "`H > #L Ƞ> '> ! ܐ" ~|!` $! @"    @: @$ D `$ D  @@  D@#L@J#L, `2ѐ͐㿘> #L+> !H o$*@e%>  Ԓ"` ~2$$`H 0&)> #L0@" 8: "@$H /* d % X@ H 0`#L`, > s ِ0n`0p> #L @:@ .`6` :@ 2 * *`#2`p`2`'@*`# p'  ' `  ` cL  @ *`   ` ' `cL! > # $! @@'耢 "`.!, $!,`2``2+`(`  > !> !> ! `0xX!2`(`0  ?> !> !> ! `0J!`$`04`.`( cLa0 Z"a0a$  "a$  !0 O$!0!( $!(`( #cL`. 0 cL`p "`p> #! €cLa  3"a 2/% > !> !> ! `0 "#@ * @4!hp@ $ `.> !> !> ! `0"E 0  @ cL  cL h l $ `.> !> !> ! `0ߔ"X `0  2`(`" `.` "`.@ : `" `. cL @`  Ư``(> #`.` 04`(@  cL` 7"` " `  @  % @` Ǝ. cL @:@ '@   2 `(?# @4`(.  & % cL @~` Д  `&''  "@@ אcL6`' 'cL4 $4   ;`   #\ݘ  `8` $8$`. "W@U@T'G 2`(> !B! "`(}`(?# @` 4`( % > #! €@' & `$€ @  '耤 > '> '"P@ > '"P€> 'b8€`(`4`( '耢   . `@'耤`O M`㿘> cLa  $a``@6aa f$aa  a`d >   `>  Ē #L#La 2 `d >  #L @@ D"" lh@ > p >  "# > i e .`2   2  (   > !> !> ! `0P{$2 ( 0  ?> !> !> ! `0m$`$ 04 . ( 2=,` .    "  .@Ò  ?"  (c 4 ( . #L @D     `@  (?# @4 (` > #! €#La< "a< `4 (4 (㿐 'L> !> !> !!a g? > !> !> !!a h> #L #L   . @@wI1  8#L ( , @ Ӯ >  ,L@ ̢#L`> 6@  􀢠! >  2: + "@ *` @ 2 @#@    2: 2?]#L  4@ >  2: *"@ *`  2  G2: 2? 2@#L@, "@*` ) * * @ .`!> #L* * @  4?@  @  '* * @ .` s@à @<'>  *` , @ (2 @   $ **`  "  "@#L?" (a" *$?"$ *  6 (6 *6 .& & &`& `"@'` @' #L< @  > @@ D > { 㿘  => >  cL)> !+> !-> ! .  "!a0! ` "`&  " 4 .$L*  F$ *  @"@* " $ @$>  $`4 2 .Ր㿘>  #> !    bF  2 㿐> !"!> #L> !#L   " > ! "    \> ! P# #\ T X L ` 0> ! 4#` 8 <> ! @# D H > ! #  !T> ! #   > " 8 > " ̐ P П  > " ܐ     > "     > "!!!!! > "!H!$> "!!h!! !(!<> "!0!!!,!4> "!8!؟ t d> " x" |  l> " h"8 p > ""p> (> "!L"㿐> ""> "c> > " tȒ  Jx > ` > `  "!$> `&x "> "> ""> " ##\ \ { > "b> "#> > "#c0#\    > > " c8#\ x   @㿘> "``` $̀ 2$D$@ $D2$` `2`㿘`< ,  \ R&$̔@l >`.`,  \ R&$Д@_ &$ԁ㿐> #L  ,"     2     #\    ,  &  @ 㿘 ,  ` ,  $("@ ;  $̑* @(@ $̑* @(@ ("@   ( ": ̅( *@ @  㿘> " #>   4 "$ $  $  $   "` " $  $  "`"$ S \&  &$D &$H 2 $ "$D$ cL`d "`d> *> "! cL$@2$D`$D $H" H$H $D D d # d" 2$@ 2 㿘> "@  "$  "@ SI \ 2㿀> b #`#d#\   o "> "#@&$,&$(> ```"` $(&$D$, $D 2$(` `2` @> "`> ' t H @  > # &6> " -`$`!> #L$  :@`* 2`  $ A$ `$A$  $Dd` 2&Ұ ^# Β ``2@> " %  @ * > "#P$AU " @> "#`    $A    D'''''$  @    ( 0 2 `< "` >  |"8` \ P ג    f0Q`Œ ^  \ P$ؠ \ P  @[$ؒ $ $$@`< 2?` $`< ]@$$ȒU \  Ph$$$$$@ϖ "> "|#@6 # `< 2$]$$R \R \0s 2     @% tG  > "}#(> d@ b @ @AZ  <  2 4  > * L"@*` `" @?)  @Ag X + 3`    H X> `P&dL8   &dP&dP> <  2* &`#L  @* <     `> e `d4 "`> "  #\  \ F  &d0 (  "> "#(> #`XH Cٓ:` cL`* ` , <$d0> "#В  "> #> "#$ $@> # @#> ` ƒސ`cL ? &`&d`h  "`h @@ 㿘`d( d,&`M 2 `d(d, "d `  ?&`d$@" d@> #> #> # ``p:$h <`\dd$&d@> d@"   @@j ud> #L h d" " h<d@ > #& d > b d(4d,d0P \㿘>>=" l T\㿘>>=" l TP 㿘 T> : 2* #L @ޓ*   b 2d( 0 (& 4& 0H /d * % 'H 000$ @< d@* 2` <  > #! H /d * % d@+6& TH 0A0@㿈H /d * % > #ʒ H 0 %`%`%` %@%`>`<4,  ,  `H &`@$L$@: '@ A"씒 ?> #`! "$LH /d * % %`< @J `Bp"@4H /d * % >  l H 0`0 @$ 0$ <$ 8$ 4$ H=  $ T`,>!P ؒc!$ ,$ X$ $ \$ p`d > $ `$ d`<``""@$ ``<`d""@@8$ d`l 2`<$ h$ l`h""@$ h`<`l""@@8$ l T$ t$ @H /d4`* %` ! `  %` )$T’@=H 0 <`DSH /d  ` `* % `` ?`%```"> `0&`4(&`0> #rH 0㿘  & $$P & $x" !$&$x&$0\`t "`t@ $$P6 $x2$  ?& 㿘 t> #d` > #aH@L  < @`@" "@$`@ ?$  4 2$  \ > )z>    "`@`0($`0 $`4  2' 2#> # 2 "  > #> #> # ``pX& 2 > #h~$㿀> #`$\ > "`O``F> #L  "<$D$ $ 46$D$0   #`#d #\  2'$D$D@$H$`"dH$H@$D"dD$$D`$$H`@2`$`"$D$`$  $$  l % l$( $`` `2``` & 㿘" d$"d$㿘?j> #L d` `> #> #> # ``pp&2 d > #> #> # ``px&6 d(> #> #> # ``pm&d0&   > #!d > "$d  lĒ"@ /$ l ' "d($: * @dГ*` 2d($: * @dГ*` ` 2@ ߠӖ 㿘@?@+ 㿘> #L t'D` $ t> #> #> # ``p &瀦2 p ?$ pD @    p $ p㿈> #L @: *22*'H'P# `6'6:`'D@@  * 2` @?@ ' 'Dݒ   >  ` '> `Ā 耢  =H b耢_   &| ﯒  4n  <@2> #L H(" : * @Г*`   2 @ݐ  4 ,` `.@2.`@. `. :  :D@ @ը ݒD'  i H /d * %   > >  ` `> !ĨH 0 / f耢 c  H(" :`*` Б* 2(":* Б*  ` @Hݰ PP 'PP  `> !P  !% 0% ,% % H% T% pH /d * % >  % \'rH 0> L` .% 8%% <% ``> đ.`% dHkH /d * % > ` t "tH 0> `> # 0 2`@ @@>ݐ <% 0% X=n   0>  ē2` 5 ` 0@1 0(-  H'<`> #L H; ($ :* Б* -@ @-@:  @ : D ג 0@耢H /d4 \* % \  &x  >  \ "> %> !H 0㿐> "<> #"0J  \> #" 0A J$آ \ I $ؒ @А $`$d@ $@  \ I$d $d> #d"8:P !> > #"H#  3d@dK \K \0# <㿐`*  >    -0 -03> `'h    &` >  h㿘6  #>  &  ` $`㿘@> `&  && & & "`㿈> `Ġ  "`Đ@s > 8 8''7` ''!d耧`@ &` &`!d &` & ` 㿈>  Ġ`> #Q"@8 > 8 87`''''!dɔ 耧`"@&`&`ad&` & ` @&&&& 㿘>  @ `> !d``> !da $ !dj $ 㿘!>   > !d @!$ 㿀>  cL`  @ ܰ ` . &   )'L`$88 ` *@ `  *  +' #& #`#\#d ?? > #& ɐ" `& ̑2  @"@`" ̑2 "@$ ̰ 㿘  @> ' #L >`*"@: `   :$`04$ B ; @8  @  % ԰  p`   0 (  L g> > #L`$8 "<> #R" "U( "  "M =#F$>@ 8     * "+ 5 *` #* @#@ aH ''' #\#`#d#h#l7\   @ D #`#\#d#h#l7H   @ D & 028㿘 > ##8 > #P@ 8 @  㿘> "#> > > #"c#Lx  ?5 (   #> #!> #Vc ` & "# m  < 2  >  L*`" * `"  " <  ` ` q&  "m>  & ( ("`,"& , "_&  `!&  >  bL*" * ` @>   `h@  `(  @=   > #@8 "  >   "& n& &  & &  & &    & & > `& >  & ( ("`,"& , "&  nѐ " 㿘 ? <&  @  ?` & @    @ 0+`&     @  `  & ""   (`" , ,"`, , ("@  " > ## & nʐ㿘  ?  ?&  `H&     @r  `" !> $  &  "  l `2     & > $ " &  (`" , ,"`, , ("@&  nG㿘 (  > $ @> #! €`&@} `"&   " > $ h  b"   (`" , ,"`, , ("@  " > $k "$ n $  h> #L`@:* '2  2 * #p '  '`''#'` 8 ;    ;`D    ; @d2`*  *`'؀ ' @ `'܀`H  `B܀ "& `;?#؀`2`(` 4` `$ 4 `(2 ``$(``( 4`(`` ?`(# @4`(> L @ :E܀ "  H'`؀`` 4=` `$ 4`23``$ `-`> L @ :E```(  `) ` & #' `" `(`. > #a€ `(  > '#x@ ?`(# @4`(`(`2`  4`(26`(܀ ` ``|`?`, 2٢> #! €Т`"͢`(  4`(> #a€ 6> #`4`(€ `*;`2`''#\ꪘ` `"`> $# `  ܀ / `*2 @2 `ܒz  .`@q  `*/ 2 @2 `  Q ` ( ?lx (?c  4 (+ ;m  `4 (> '"8@`?`, )> #€ [ ` (  4 (" > #`> $` '!> $$!P'> #! €``@@ ܀``܀`"   !> $ &  "! j ` !" l   >& 㿘> @4 > $ $@> $E!@  > B?L8 : :` @ B   @   L  8 ;  @ 8C  @ ?㿘@ 㿈d @5    '  @? '`( !   >  2`(&@ > L @ :D ޲`'s q   j ?## @ X>  TL'> $1> $`( !  2`( "!Ж i٘@2`(&@@ ޽ '#\  Κ 'Ր@@ ">   @) `(  k( `( 2`(n0> '`( 2`(8€&@> L @ :D ` p@6  `%> $&" !&  ؖ iu ` 4 2  $ @? 7 2 2   & '> #L 'г. @ D 4  $ >  $>  $&@>  # ?''쀊`@''''' ` 3 8  `4e  `4m   @ 5 耦`&@`L L6@ L  `. "@} 2  ?`&  j] `  㿘   "   `&  !> # & 5G w#31`  㿘   4  2>  $( >   $ > 㿘!> #L :  > c" "c> #`#  "``X2`(` 2`(`  ` $`## $`0`0"`$`(`〦 `#L    ۚ 1```" `(``,"`,`,`("` $``0` L 9 㿘> "#p> y 㿘! A  D @I! > $ Ȑ (> b0%?>>>c 8!8 $ \4 T$ $ $ , X$!v$u < pۖ H /f * ' > pp`$!!"a$!"pH 0  㿘H /f * ' !`!"a!!"H 0 v!Ā "!C@ !Ȁ $!C: $!C6  㿀> "'@ϒ  /H /f * '  ` ` & & "`!?&!H 0 `" b @  0ٔ@  0 > $n!㿘 T f'D!Ā b!Ȁ ^   D@  I 1       DD`"B  2Β `?D` 6`< Do.D`p "`pD` "! `  " 0D@1D@D> $b "@ ֡ ֝ 2 D`t "`t㿘 !F@N  a2@a1@=a@"a a@~{ aI@a@"qr 0aH@";! !J@' !F@! a aG0H!H@ "'!!G@" !R 0!K@"2!K G2E /D !F@, !F@  7  !J@0  `    " @ / @  2  `  "  /     !F@"   !F@> >  /> #p`"d!Ā@"]aaȀ "YaaĀT ` @2Qa 2La  `@2Ga @@2Ba @ 2 aĒ@ @ Ǥ 1      `a ` 1 ` 2$a  2 a 2a  2a  2aa` 2a` 2 a` 2a`  1a`@!Ā " @Au @ ?  1v!Ȁ &!Af  ?  1g&!ȑH /f * '  T`@x6 TH 0Z !Ā "!A> &!!Ȁ "PA7 K&!Ȁ G0!G@0H!G@> 1  47 - 00!H@0H!H@' 1  4  `" 1!Ȁ  @ 1! @0& \ 1㿘`2> $C"8  .@     `.@ `.@㿘` > $("`"@  @      .    㿐`2> $"2`/@* * @&@㿐`2@> $"22` //    * *@ & P> !Ĭ !Ȁ`b'=; ` 7  3ب@"@  //`<'//`''"7``" 0 (0  $  27 7 , =+ /`'   '        `̚  > $k"؁㿐 'L'P'T'X@'H ?Đ*@86 > #p$ Ā`"Ȁ" ` 2  2T " ` @2 @" 2Ā`& `h`#`h`|   0#`|0P> !Ķ !Ȩ!b`'IG ` C ?ج@4"@0  //`<'c` `'`' `/'/' ''''"7``" 0 (0  P  2m 7 `-` ia /`' 1 2U  '3 2F @ f &&!  @  @^  @Ò   - -%  % % % !̀`" !`8 ܐ?"`8&!!̀  ! !̀   3   @H  > $j"㿐 ` , >'> #p (`!Ā"!!!Ȁ`"!  2! ` 2! T  @  2 !!Ȓ  @  "! 2!Ā`# `h `$`h !`| $`|(@0 !㿘 @>  > "`  ` k  > 2  , 2  0 2  4 2  8 2    `  `` `r`` `` `u /@0 "`k &`  `` 2 ``?#@"] 1` 2`  2 ",` 26`` 2 6`` 26`` ,`6`&`t "= 1 ,`7 1,`2  #I 2*> ct4 ;O " ` @R  2` 0`& ,` & 0`& 4`& 8`2 6 >@  , 0< 㿘`@ ``   `  `2`h `h > > ".b2  I5 q #"X> > "&b**`, 2 2` 1 7> @&$4@ #@?* 2`@4@5 :` 4@` @ 7U t `,:Ԛ 16`>2 1@7> @4@ @ * 2`@ 4@5 (` 4@` @ 7% t `,: 6`><  h` > `"`''@'` "` / " 1` 2 ,` 2  ,`?#@2 , 1 2 @ 0 2 @ 4?#@" @'`'`'` '`'`'`'@ "&`s  ,    H@Ƞ 2  HȀ dȐ 1'`Ȁ  <'@. s , ` 0   4 2  8   >:  " ,< 0 2` 0 2` 4 2` 8 2` > 2) & , & 0 & 4 & 8`> & ` ?& `& $` l& ( Ԑ `6 < & l@/ l?*  & l;K  > $h"p> `" '` ` > ` "` 2 `` 2`` 2`ϰ `  `?#@> $X# > $''' '''##`'`''`` '`'`''Ԁ `> > $#X#X`  `'`'''` >5!> "8 .6h!v`!/ , / 0 / 4 / 8 / H " /  4  / T`@;  L/   `@ ?l*@ ,@"  4`@  23@ "/4 `> 2'؀ ,܀  , ,䀢 ,@  26`< 2  2h> " > $g#H㿘`  @;&`  , ,`>4 `,`,$ `0 $ `4 $ `8@$ 㿘`  @&`  , ,`<4 ``$ `  $ `$ $ `(@$ H> "''@ @ > $#h#h> $`'` '`  ' '@'''//'// $    > %> % X  `  `@ ΐ`0> %` ՘   @@ ` ?"` `  &` "`@Ȑ  `8 4  "`8 3`8?"`8 > %f h㿘    4  < T` u   8?$ 8㿘> "`   0 @  2 ``$ ` v 4  < T`8?"8D ` "@     "     : 2   8   ?2?  * +   > b0 @ !k '@0!j@@8tS0l@20 !L@ ",0aU@"aV@!N@W @0HaP@ aO@aM@ ai0J!J@ 1!K@  ai x @[Qr@ag@ ad@ af@  !0!e@ > %` X -!@ " !@ 0Ha"0!@0H a" "C @<@a!@. H! @ - a@'aF@!@ !8 ! !aI@ aG@a%@ aM@  aT@aO@   %  "0H? ?  `"PP@" 2 `"P@ "@ 0Ha"@a!@> Ha@"հ   !@'a @0HOa%a@אa@0HFa%aI@"# a%@0H;a%aQ@aR@0H2a% " 1?    /#0H  0H 1   > ## @ *  > ## @ * 0Ha%@"N | H!@0 !@0]a!@a"@'0UaR@" aI@>aQ@W0HaS@9aT@C0@ (& ,& 0& 4& 8&  <&$ @=&(T "=  `& d& h& l& p&  t&$ x*&(& & & & &  &$ &( &+@~e ᠐(Ô  @~Y!᠐(! & & & &   #" @ &&  #"  $ & & & & > c & &  > c & & d l2Ű @˒ @ @~ `P ' `/ ''' '$'('P'T'X'\ ''Ė ? @"  d 2 * t* p@'?@mA ', @mR, 2q, 2  > %`~Ő g  ,& ,`\ "`\@oW@} `  '0W `  2/ ('< ,D'@ 0 'D 4 'H 8'L <'P @'T 'X '\ '` 'd ? @" @l   @`\? &`\ @ِ` "@mP -耢 P  b > %c 㾈> "''쀦 % `"  T " `H`-  "`H /`H 2 `  `   H@ Ԑ`P 4  T ̒  T`, `0'p`4't`8'x`<'|`@'`D''q 2`-x 2`-y 2`-z`" P P@"`-R 7z`- `h T   `> #d`> %a} >  > #d`> %aP}ܐ 3 `h`` 8- > #d` !> %!@`}Ő 2@`H 2<`H Ȓ 5K    7@| &Ĕ( .) .(> #&&& T  `&&> `|&` & ` `` 2`"`"`& & "@& `H (q| $ > #d` !> %!@c0}m  '`H&|`L&`P&`T&`X&`\&``&q 22`hxh@}ܔ  "+`h     > #d`!> %" @20}< p ?&p&`t&dx&h|&l&p&t&x`h&`l&`p&`t&> c &&> c &&`@_ W'`d&`d`> #&& ? &@\  &H V T@*@{ܒ `$< P 'c 7'/  7//'@t 2> #d`#!> %"h@ (|Đ 0FB "Đ"`&Ġ"@{ > $##`` '`'' '/@{/> $#/А#' /   P'7''  `@{ɔ    8 ?$ 8 2 80@{j @(!'H'`'8'4'< ͔ ' ؀ ?$ 8ؔ '@ > Ā "Đ"`&"> !`> a@ T 2& T@ߒ 2> #d`!> %"h@' |/ ( T* "Đ"`&" T [> $#x#x'` `'`''  `@{K    8 ؐ?$ 8 2 8@z @(!'' ''' O B' m쀢 ?$ 8@} 2> #d`,!> %"h@Ő ({͐ 0! "Đ"`&""@# `d ␐@c  쀥@F@  > %`"㿘 @c   `  ה  "  @} 0> %b {`(0 ?&   Ā`""`"@@*  Ā2@㿘H /f * '  ` "`&`  "@> b`@2 `"b` 2  > %`& |{#` "`@` @"` ``2 `\> %c@ {)0 0?"`\`&` &`@kh` ?&` H 0㿘   `g 2@ Րp> "'2 > %z#x!@ "!@"/ -0!@2* - @" 2!  2  `  2  @  " 8   !@ \!@"  -0!@P - @ @i " 1@ڤ ` Ԣ ` xܰ  x@y~ x# #ܒ' '  #Β ' ' /@Q *@' a@yP  @$0@= А# А Ԕ '  ''@z'܀ 2  !@  @  #   `#| Т @  '   ''@z'쀢   ` 2۠0F 1!@ ((#LT ` `#E@xڒ! & *&@xϒ x#1  ((#-T  , `#$`, @x |#| H'da" > %_#㿘  H /f * ' ` `@ "`  "``2@&`(&`,&`0 &`4&`8&`<&`@`耢 a   H 00*H 0```&`$  `a     ` &`>X D&`T`T @@c㿘  ,>  "   2  !>  J  `   ?"`   $ &  & " $ & `2 0.     2  > %x#   `  & ?"` &  & " $ & `2 >  2 ` "` @"  "@ " "`2"`" 2㿘>     2   60? @w $ $ `` $`" $`$ 㿘>   2 @ `"  "` "@1Β 60 2 p> b'H /` * ! &` ` @ "`  2`` `   @xڔ  2  ,  &  6/֔  2 @H 0% 7 & `& `& ` & & & `   "   2  2& 1l 6H 0 1&Q  `$  & " $  & А@v ` `  @`/`/`''''  0 a1@& `"  "` "@1( 6 ?$ H 0  @IH 0" > %]#p> b'H /`   l "А* !  ? /& @I`"  "` "@ `` ?"` А@vz      / /  '''' a20 6H 0 > %\#㿘  6.   7 &ܔ &0 6 㿘 "0 6  ?? " 2  2  2 㿘 `"  ` 2 `@w  2 > > (@ *` > @ "   :  2 23 *@(2  0 2  0*@`*@` *@`*@` 0 @*@ ` @*@ `0 @*@ ` @ *@`*@`$ŀ !c(* *㿘      0%> $   "    0 0  #h@w  2   ``   㿘̐ "  P   ? 㿘> "` "  0 @v  2  "    0    @ `  (0  㿘> &`v:   : . "@v     @ "@: :   㿈> "'        ///////` /> &`8u "@t ``: * @ &@ . `@ &.  ?. " > &[2 h㿘! ? > &w  0>  `{/> B>2n`` "j` ` `?` 2Z  2W  2T  D#6@ `6F   >  ؀`"?  ";  ") # " *  4&  4  $ 42 `  0  2`` 2 蒂`B &:耥,),*p B; p `B ;  `B ;㿐f ? ' 5' ` 2-  2)  2&  2#  >  ؀`2' D`2  2 0 $   2 ' >   `2  2  2   2  2'  2  " 㿐@,  ' `2   @[  2 T2  XAA`? > `4 a,`T2)` `\   8 ` (`    :```2a> 㿘  +ݐ @s;   +֐  @s3&  +ΐ!!@s+& @H& 㿘@I`@-| `-y -v (%> ' X@s]> !`> agҔ`f `   .`@> &YV  㿘 `"?@  2 `"` 2 X``2@{?  ` `G` 8  `%" ``" `#` ]?; Y?" G``G P? 2L?> a(@t< 6> a0@t5 /  ` $`2"` .`  .`  .` .` .`  .`  .` .`2 ?N `@ry `  .`.``  ?  .`> ` a(@s  ? 㿀l `> #d`N> &`Ȑ s\ (HcdY  > > #d`;> &`>  `!> &@C 2`  > #d`"! `( s0 (cd``耦@ > & (t`!"?> #d`> &aP s (cd > &a#l  (   #\ #`#h#ds  㾸> "x'@q x ( @q T< P  b//77' ''n  > #d`-> &arΐ ?> $ܐccȔ    ?  /'/''''''b / > #d`> &b (r X?e > &rN"X   T 2 ?ߐ $ @q~ ` '1> $Ȇc/p'@'D'H'L'$','4,'('0'8'<   @"d   ?'d'T'P@`Đ    @`Ք    > &W"> "x'@q. x ( @pɐ> $#h#h> $cc ''  ܢ?  ''//''''''ܐ////'''''  > #d`> &br ? b > &WL"> "'`"Z?N@  ." "J  ."&" ?H?? /G@p]G,H<`#  ` * 2  X@pG G&@p   ..6 P .6    > &V#㿀>  X b'"M"4 \F" \$> #d`=> &c X 5 V T@  T> #d`,> &cP (q\ '"> $#h#h'` `'`''' >  "> !$`  ";" > &V#p> "'@)/> $@HD `@ ``z 2@ `q@ `h``? ? 2b`Ā+> `""`"@ `Ā2` `( " `j6, <   `|ݚ ```"`& ``"@`  ?$` b`@ 2 ``%b`b`` 2``  > `"`s#d`> &c p (` ?$` `2@@G@o ㈔  '    P/7/''' b<   0 {4b > &UƐ#ȁ㿐 @ > &#ؔp@oS  ?/'?   ? ? "```?`` `  `  ?` `   ?? "``` `` ` ``       8 &   " `&  * 2`3 ?# 4#  * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` ` `"5* 2`3 ?# 4# `@`` * 2 3 ? 4# +   @     ? @ * @ ?    @  ` *`&  * 2 3 4# @ * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` ` `"3* 2 3 4# `@`` * 2`3 ?# 4#+   @     ? @ * @ 2i > 'n  ?#  * 2`3 ?# 4#* 㿘  `'@`           2  2  2  " ` > "D*` 00? ? ? ? 2 > "<@ > "D* y  `  ? ?@ >  ɐ ```   @E `<p "`@0Ȑ $@`I 1@ ` @n  " @@`8 ?"`8$@@ ` < 2@`@m  .` ,`&` &`  &` &`&` ` $@@   @)  0@ @0 A 1'@  `  `2a> `#`  # `# `# `"? ?? ?= '`` `> D(`$3 ` ` `` P3 > < > D+`23  2" @# `?# `?# ` # # @ @ ? @?  `> < > D*`"# P "#  3  ? @?? @?2 㿐@     @:> 'l 0   2 X!   ,  |   @:> 'l 0   4? +> ! @  $  `  ` `B =  `  " `   $@ @c?" ! $ ۢ@&@ ;!>  8 <㿐'D'H@'       @:> 'lf H    >  !- >  ? %>  4   @m!   ?`8 ?"`8> "  @kx   , , $  $  $  $$ p "  @ 2  * @2  @j !`B:` "@   @V !`B:`> !`B:``xB:`x H /f * ' > `   H 0    '`H 0    > '> ' ``mN > 'k >  Ā> #Ѐ@ @> # 8"$#  *  *`@*   28 @lr  2 8 (@lk  "#8#2 #2@ >  5>  `'̀  ̐ H`&̒ #V  @j H@$ $  x *  * *`@  $,, ?$ $ $  $$ $( $, $0 $$@$4$D ? *@ #@2 ?$@ , ? * @@&@ # 5? @ H /f4'`* ''`H 0 ư!# ? @c H /f4'`* ''`H 0 !1 $,?#@  @ $      $ ( , 0 4@# $2@ $ "  P@j $ ` *  * *`@  $@  *` 4` ,` ,`  4` $`$`$`$`F 2 2  ` ` 4  #2`+" ` 4  "  $ @ ```@" " `` " $ # ꀦ @T> #ЬD`"#Ш $D> "H /f4"* '"H 0 !  `"H /f4'`* ''`H 0 ɰ!5> ``@$"`@ 2$<# 2`# ?ؑ* 2 2 - - % %  % $% (% ,% 0% 4% $     %% h  @АD " #_%̐?I& ʐ@"*@АD " #I%?` &̒   @%> !h`B :h`B:`D"@H"H /f4'`* ''`H 0 % > `B:`> a `B : H /f4'`* ''`H 0 !㿘>  ` > '> ' ؒ`jՔ"x> 'iD  '> @*)> `@J``           $  (  ,  0  4@v $А" @2`@PА D " "$#̐?%#́㿘>  ` > '> '` j"> 'h & `& `"` &`㿘>  ` > '> '` jv"> 'h   "`  " 㿘>  ` > '> '` j`"> 'hϐ & <`8& 8`8"`<&`8㿘>  ` > '> '` jJ"> 'h  8 <"`8 < 8" <㿘H /` * ! H /f * ' > `   H 0    %`H 0    > '> '` `j "> 'hy > #`8)>  '> 瀤 > ! ?,  8 < ` `(`B <`(  <2 #@`< > ! `0 <B<`0#@ < 2`0H /f4%`* '%`H 0 H 0㿘H /f * ' > `   H 0    $H 0   $> #8@ > ! `  8B<`  82` H /f4$* '$H 0 ^ ^ ^4^H^\gXg`hggH444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444t$P|㿘@9V> `> "a > > "a,`6 `` `"+(\`;`"SXV`R>*@L:@G:@B:@=: @8: @4:(" 8*`0@(:0@$:8"H"@`" P`@:@@:H@ :P@:X`@:`㿘> !` `@`2`    2"`> 'f!!! "@!" $!"`㿐> cآ B:c>  h '& (   #    2  ``  2  2   2     ߐ?' ) @~ 5 :23  @     @:> 'fU!(   `2 J@c `B :    @`2  c`B :  @ c`B : $$В"@\ `` 0 8 0`  $"  ?ܐ?" 0  0    ?В`0& &  0       0&   0s 0 2  > #d`L> 'a@ f+!t0F? ?#  #  #  #  #  #  #  $# $  @ ? @? 2 , ,  ? ? ? ? 2+ (, , + ( (6* 6* 6c* * * .`&  `B ;@ < (0H㿐`'"`  ! @B:@ >  `B : F  @     @:> 'e`!(  '`2 `>  !`B r:  :. "> #d` #> ' @a`e > #((B:((` "O! `BG:`>  @#ؐ(@*` B; @ "N " "U  +> #dW k> #d4G  "ހ  "pJ  > #d" > 4> 瀢 >    ! `B:` >#0,  €Ҡ   ͠ ! `B:`Ġ      ! `0B:`0   ! ` B:`  c     ! `(B:`( "   cc    ! `8B:`8 c沔 Ȗ  "b   :\ H /f * ' > "\ > `4 T``ؕ*`@  $ 2@  $ 4 $$ $ $ H 0 +7`#֒ @4 `?$ `$ ` $$ ` $ `$` @ 4` $  Ȕ ( L Ô   0 ("$ $ J$  ('  , ,c(8$ B`B ;$ ;(8@      ! `@B:`@    "! `pB :`p  " ! `xB:`x沔    @6<'@68   ! `B:`Ĕc> a      沔   c@  cؑH /f * ' > "[ > 4 R*`  $ 2  $ 4 $$ $ $ H 0 0 4 - H /f * ' > #[ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    "I $   $ "  82 `"   0 $  $@  ̢$`̢?> !`@4   ( (   0@bC > ! 4 7 #֒ @4   $  $  $  $ $  $$ `4$ $  . (, c(8$xB`B ;$x;(8@x ( ߔc   ! `HB:`H Дc؀沔   @L_'@LZ   ! `PB:`P c؀沔   @L'@L   ! `XB:`X c؀沔 ʖ  @B'@Bޔ~   ! ``B:`` ec؀h沔   @FJc'@FEZ   ! `hB:`h Ac؀'D沔   @ @'@ 8*/c2#d`> '! @QN `" `PbP M@  @ !0c`B :c0`B :0@!!> "'/ >  `B :   `0@ 0r   0@:> 'a!(   2`>  Ҵ )> ' 33<+"< ,"  "   2  `@ 4   @:a{!(   `$3 ` *  * @ @  <`@  |  | @:aR!(   >   *,  2' @@הx  x @:a.!(   `>  ` 2 2  * ?@t@ `@ t  t @:a!(   ?  * @@ 2 LB 0p  p 0@:> '`!(   @`   / /`'`'` ' `$''' 'Ġ ꆒ'Ȑ " 2> А@_   //`'` '`'`'i '   > #d`H> 'a`ܐ 0C@?`* `*`*`@  * 'Ԭ`'''''/'l** *  @'l'>  > * * a8 * `@  >  ?`B : ?b > 'E!p> b >  '   * *`@ *   ! ` > !$ @z> !( `> !( @oА@_P   //?' ?' ' ' ` P7@ l D>  4 8  L 4  P .  <!` \  0 `` \@ 0螐 > 瀦 > ؔ @`B ;@# P >  8 ?# 8> !   @ 2  > 'EC"`> '`  8'Ĵ  ``   7̔   @:> '_}!(    @^   ؖ /Ѭ /  NӐ  ؀ ِ    * `@ " ?|-     s-  ` "9> y w    c n` ؀``ِ  `ِ   `  ` " P7ڐ@_  <0G``*@!` > @Q! < 8 4 ` @@`Ȕ   @:> '^!(     @5  - 2   2 > ! `> ! `2 " <      <@vē* @*` 8h4(0 <H /f * ' > "VŒ > `6 T``ؕ*`@  $ 2@  & 6 && & & H 0 2`  7#֒ @6 `& `& `& ` & p&  $`,& hH /f * ' > #V~ & $H 0 $ (  & 6 & 0& (& ,& <& 8  n& & ` (  `(ɔ  "     S, - M,, , G, , , , '`8 > ,  > , , * 8 8* * * `> !@F 1&@ -`   "& ,   8`&  & `  82Ā  $ 0  8"?8&Đ@ 8& &  ,v "r " m " > 'CV"㿘(`H /f * ' > "UԒ   > 4```` 2`$`$@$`4`H 0`+*`H /f * ' > #U $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` `` $@`$` *```$`  `   `8 ``a`$`0@`  J ." *J  hd   J@K@  .2`  a >_`+    S`  ) %А C0 ?   А `-3`  ` * + 4  J ."*  +  `#$` ` W 㿘@ @]q c `_\@J?`2Y J? 2T GE& 4H & 4B N`&> N9`?48 ?45 `ˀ`ŀ`%#@ 2" 4 4  @] &&&& &  㿘   * @ `    B ?>  : .  `2& `  0`@\  " 堐 " `  ` `   "   `@"    22&˨㿐2 >     * @  f` dx [ `2R    `"GF ` 0 2@  0I "    3  / "-   @"' (6` `> ? '@$'"@', `'  0? ? "4```  2 2 2 `* @`*`2`2`.`.`h>  ' 'Ȓ`   ̔   @:> '[8!(   @Zk   //ђ   > !bh bh ~ h!"u  r :2q  ,  , 0   , 4  , 8  , @[Ք  2[        $   (  @[  2E  Ԁ   2`*  `* "8 3沔 (  +h@Ȕ@ ʖ@Ȑ L 2 @iȀ "'c ' L@ "'  'Ȥ h2 h,h@@ ǐ@Ȑ Lr 2 @7Ȁ 1` L@    !> PB?:P > '@"@!> "' ''P> #d`> '> 'bX"  (Z'0(آȐ  (ϖs 0 0 " ֔ (  ` 0 0 "  : `(.` x`?`('` '`  '`$ '` ``&``&` `&`@YB&`$/y/x`'`'` '`$'   \X@Y+ /Y/X'd'h'l'` 점 D > b```0@Z  2`` 2```? ? `  @2`2'@@X    .T``8 w?"`8`2@> #d`!> '"אTY 0 `&`` :&` `&`` .@&`.`.`.`.`  "> !  `.` .` : (-R-* 2 2 -- ? @6     @P  P "! `B:`P "! `B:``>#D*` €P  ! `B:`P "! `B:`P "! `B:`P "! `B}:`P z"! `Br:`P o"! `Bg:`P d"! `ȖB\:`P Y"! `BQ:`P N"! aBF:aP C"! aB;:aP 8"! `ЖB0:`P -"! `ؖB%:`P ""! `B:`P "! `薂B:`P  "! `B:`J" > '>4#8㿘@,㿘ǐĐ1> > ' HZ>$ 㾐> "'  ` `*  `'@` 'D`'H`'L>  `>  `@ @   @:> 'XA!(   `2 `>  `B |:  ?'0` '4`?'8` '<`' `'$` '(`$',P72 @P7"@  > #d`H!> '#`H@ ` > #d`;!> '#;@ `XD 2> В @W0   //Вئ < >> 0`"#d ` > #d` !> '#0H@X 8 !?`@@X  '> #d`!> ( 80)W 8 ?$8#d`!> ( 04@m 8 ?$8  0> #d`!> ( 0? ? 0`?@XQ `? `> #d`!> (!W > `(?@,@, > #d`!> (!HƐW 0{   . Y ?> #d`s!> (!s YWt b> @3 `?P)> !,'> !0 @W"@VJ @VF p@VB   //q///p/  x    !,>*ǒax߱P @V  /Q/PXx ݐ ~"ߜ> ߘ> ؔ `B ;k" > ( "'>   k >  ` ```4 ``<` @UВ   //  ' ' ' K''@. `  | @ڔ w`H /f * ' > "N  > `4`` `$ 2` $`4`$@$`$`$` H 0`OH /f * ' > #No $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`)`$`  $`  `8  `"``$`0` " ?$@8% `Y ? 0   ``0  0`4 ? ?  ` :  `,, , ,,,   ,((,,,,,`4  Ґ0n  @j    0c @_  @- %( `Y&@ ?&@`4 $$&@`0  &@"$`    ,(< .` *  `Y6@&@$` ,$`% ? ? ``$  ` ?@   @T <  .@.``&@$`$`   $`q "` `? ? 2 - -   2- -  2, ,  2`,,` :?ؑ* 2 2 ,,,,  ( *  * 2 2 ,,    @n  `a `B:`` a `B:`` > a `B:`> ``B  :``   > (:!㿘 `   : @  =89   242 * "  ( "  `Ԁ` a  e2 *`Ԁ   ~ ' $ `Ԕ E 㿘> !> >  7Œa`?㿐  "'  4 >  0   ɚ  L"L P"P T"T XA"X> ! >*aN 5 㿘 2 4> (TW"  2  L    ޜ 00 "& P㿘 2 4> (T@"0      ކ 0㿐( @  >  ,   * @3L    *#\> !8+㿘   %   ``  @XÖ@TՖ , 4`@4   @X @TŖ 㿘Ǡ !@V & 4?$ 4 & 8 $ 4 & < $@ 4  & D$@ 4    & @+> & D D @V  @V    ,``"@V 2` 2  @V    c& H & , 0@& L ?*@ & 0㿘 , @> # L U  ,    4 , @` D  4v@VU?$ 4` , < 4$ ,  H;  8 0 㿘> Đ!㿘> !1?*㿘  Д  > > (S"`8#@ *"@ *`" *  *  * " * "> `: `*@@ 6*@>  x  @/> !8+`" + " **" "@ * *`  @ * *` @ * *`" "@ * #@*`"@ >   ``2 `4S```:+ `4@ > "0> bH@'"` F@ 㿘!> ! @R!>U!b64 > !65!㿘H /f * ' > H` H` "H""`?"H 0 `@ 0܁p> "' (?'''D    > Ȩ `B 3:Ȕ `B ,: !@>  > `P! * P  > !*  @ `B ;@>  `B  :>  `B :D  " !!@B:@!`B =!D` '!`  ( 'D``B <`!`B:`D` `!`B :` !`B:` !* `B : "    2  2   $ 2  `B 8b`      ?#@M 2 '  2 ' ?#@B!'  ' D' $ D's  D   @R  @ 2  2    2   D    D D $ DD``T  > !`B :`D `T) ? ? ? ?  ?  * @!? ? ? ? ?  * @!`B ":? ? ? ? 2  D`P* 2 2 . .  ? ? ? ?  DD`P* 2 2 . . D T`?  ? 2  G  D  i b    G> D  " D!`B:`D ` ` @ "`  2`` `    @Q  2 >  "`D!ఒ`B : ? ? "D@`B :@Dx D "h"h4 `  @Q   "h!p`B ':pل $"h"h !x`B :x8 ?"8$"h> "l@Oݒ "h  **  "  " " $""h,> 4  '> < X`"> @ऀ D 2ऀ >  ' #d`;!> ("p٩ ٦ P 0. `2 ! @B: @D` !!`8B:`8  * @'  dܒؔD@Ԁ  bD   *` 2*` ܀ 2&` !`B :` " D!`8B:`8D  " D!`B:`D  a b` ( )   (Д   @:> (O"  'Dؔ!`B :? >  `2 DD`ܘ؀ `( ( ` "@ #` D ("`   > "`D@ 3  !`@DBf:`@b D_D~bD@;xb  `2   2   ?#@!  "!  2P ?#@2P! B: D` N!` BG:` `B B:P`B :P`@B:`@!5 > >  aD>  ̀ D`@!`  * @*`@*` DԠ!> b!`B :` !`0B:`0Db > (4̐"㿐` )  (ʖ   @:> (O"   2 &> ` (` ( ,  (`  (   @:> (N"     > ?`B :?@  && ?㿐Q?# @ "  06 01: w>  `5 q>  ` 4`N  '&c>  ` .   *` . `8  4(?>  'H֔$@ @O?H &@C Ր$@  Ɣ ;?$@  翔 4?> ! ֚`C : $@  籔 &?> ! Ԛ`C : $@  磔 ?! Ԛ`C : $@  疔  ?> `B :?㿘 @/ "- 0( > 0#> `B : m ?`B :`   ` #  X ??p> " h'    Ӗ ) &@ h@@*ؒ ؀``ِ  ` ِ  7ڀ  "  P'   ) &@ h@ 'Ԓ   ) &@ h@- `2' h (@v >    `*`@ 0F> `B V:  l ) &@5 h@G (  3  <  +0:9␐@> ր 3` ,  , ` ƀ 3" <  +0  + ) &@  3 > (2Ր"ȁ㿐3 <+> ("N 3 ,  , H /f * ' > "E=   > 6 ``  2`& && 6 H 0 . - H /f * ' > #E & $H 0 $ (  & 6 & 0& (& ,& <& 8   ' 2 '  &  8`"   $ 0  "    ?&*  )& `(   (   ,3 ((    X> "' 2 > (Lg" "i? d3"< <,$ Z2) (+B Q?> M?: HlF;@ C (˖Ȁ&@ 7 ?#@.?&(@ $ & *  @b?@  "& * ?b > (1#㿐?'t ?㿐" @  )0> (  #{ > ' , "   -> #\"P" (((((((((((((((((((((((((((((((((((((((D((((((((((((((D((((((((((`> "' #'D '̲   >  2/  2+  2'  2# >  > @> > `B  :@x uD`> ( c0`(Ky 0Ӏ  DM ?,H /f * ' D  D `$" > (#hK $ k ( D?'DՒ #\  (̘ pݚ DH 0̀ ? /> @+> "'0 H 05 ө O%bh! /> +>    D  @  !@ D @K  D 2 S  !H 0D$  4   +l?``4 bh``8 ?"`8%bhːbhbh KD> `B #:  ǖ 0D %bh?` @K>  "/D?` `8 ?"`8%bh@I   .. bh& &  & $Ґ& bh D> `B :  ㌖ 0bh`<;> ! @ B`B ; ; @`< " > !`8B:`8>  > >  㜐  㜐K# HD> (`<c( #\`(JI    G 0 3H /f * ' jpа DH 0 AD'瀥 ? ` 2   '̑H 0q"`<a D  ` \  9`4! ``  \@  ,`4(  !`B:` ;`<!@ \ ! `" \ \  \ ʔ 0`42`0`2 T2 T>  `0 T l@!ɒ    ⫖ D"`<  T D  ? ? ? ? 2, , ? ? ? ? 2`<,,`< D DD8 4`<@'  '`<  > !`XB:`X> @`B :@>  8`B ; 8`<  `!`HB:`H`  H`B ; H ̀`A>2#ԓ*` €` 0 "  * "" > ).n 8(T؀ج 㿘 l> "@ ?V ?`Q>5#t*` €"J  ?@@@"<9  5@1.  *@l&#  [@  [@_    @ -㿘> "@    -  k& -0@㿘0 !k 0!j  @ @\㿘H /` * !  >  >     $  ( ,  0 `P  *` B ;`P    @H  2  $ $@Hٔ  2  2 `P`B :H 0`2``  < 8`h< @`p< H> * > P@*`  (: 0: 8 : :  >   "@ >   㿘V 2. - R `:`' -> # * >  0"b> " @FՒ$> ! @Fђ!> " 1> >=a| + > !Ā`&` *:` p> b'H /` * ! > #'> <`)> -> +> 3> ;> #5> .7> @* > $#X#X P,`2 * @*`@  ` `   / ''''   a2А`* 2`@ ޢ@Fr P4`*%>   *````    8 2 ` 8`2``*``@FK$7c&&H 0> " > ), H 㿐> #`7 >  P*2 * @*`@`@ * c2`@ 7> !>  ` @ *@ " ""22 $ @ p> "?' * > * `P `z 0 > "< r > "D* 2 i  ?%> #@!> > > )`` @Jߐ""T 2T2P4."TT @K -H /` * ! > $#X#X` `/` '''' a1аH 0 %"H /` * !   <`8,@$`<` <`(<`0H 0>  `2 " > )+Ð pp> "'> > *  #* `P    C H /`4* !  > $#X#X` /''` ` ''  a2А@E# `c?* @ P*`2    ?* @*`@ ` 4cH 0  > )+` 㿐>  >  `    $  ( ,  0  P `*B ; P     @Fn  2  $ $@Fg  2  2 `P`B :`'H /` * !  84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X$`XH 0E H /` * !  `     $  ( ,  0  ,`} > !  7> )5> )`@F  2n` $`$@E  2f`` "b``*`2   YV` 8#\ E[ $@  $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X<`p$`X<``<`h$`x ?-` "$` ` @zb 82 $````-` ,` `Q > !   ` @E  2B``$ $@E|  2;`$@ $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X`x$`X`<``<`h<`p ?,$`x````H  8@  2 H 0A 7 $@  $` `$` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X<`p$`X<``<`h$`x$`$`#H 0 P #>  '؂  @ $@ (@ ,@  0@  4@ '`b' ' ' ' '''''''''đH /`* ! > (` @ ؒ @D  2  $@D  2  2 2  H 0  1&V 8H 0  > ))N Ё㿘  L      A?p>  b'H'3?  ?@@ -?@* `..  *  &  ">  > @> > `B   :@ ̙ ̖ > ) ``(C  H /` * ! >  >  `        # '  P *` B ; P     @C  2  $ @C  2  2 ` P`B :` PH 0H@`B :  8є   沑H 0 7 9     8 'X (2  d 8H 0p 7` *` *  *  * +` @  +  ( *`   @  *   ,   (  *  -  * @  !+`@  ,+ "  *` *  $  %,  +  &(* #@* '@      ,` `@C6  2` `$@C/  2`` "``2`  8*   8H 0 7  (  2 ͒ 8Ȓ 8H 0԰ 7  ? > ?  ?   //''''' d l0  ++ , , 8 8H 0 > > #`P > H " `*`2  `H 2`dl+4   P> )aB   P``B :`S 8fN 8H 0Z 7`B :@@   ,`,@  $` > !$`  $` <,`,`$`# `$`$ ,$`( $`, $$`x$`0  *4`8 $`# !$` 8 8B: 8$H 0   `4 P ` "H&@&`&`H 0 > " > )&!H㿘H /` * ! >   5> !7>  @ 1 - ,>  P `"!x ? $x@` 8 2@@ @B=@?-@$ 82 ˒H 0>=a|$j > !Ā`&`$g:`p> c> 8" '  (> * P`" >  P 0B: 0p`C  >p(> * P  >  `"   @2   (        8   ' % ( >  7" d l" 0   ( ( ((2 ڰ > #> P `#> Ѐ  *`2  `     ?Д  ?//?؀`d'耣`l" P(' '' 0' '''P bB<    ` 7`B < ` 08( @< B`:C :h` B#> c`C > >`>hP^ > !<  .`2 2 * @  * E* * >  P ` =`8* @*` 2$8 2 8ɧ`ɣ2 ਐɝ`ə" 8਒`B >਒@ؔ`( B`C <(<8 @`> * 2`@ `  #> b > )%A!X㿈`H /` * ! 沔        8 ' ( 2  H 00}"4 `>   //> '  @ H 00c ` ` @ "`  2`` ``` ` @@  2@`  ,, $ $   $ $@.$a`  `\ :   `@ *     ,, $ $   $ $$` 0H 0p> 0> `␐B :0'H /f * ' > "7   > `4 `  $ 2` $ 4 $$ $ $ H 0 > #Ȗ ( $  $ 沐   $Z^ 7 ``"  82 ܀  $ "  "`  ?ܒ ܐ?""@@4 >  P&@* * ($ *      ? *??ؐ  //'''''   : > *`*@ P2``> 疂bB<`Ѐ  `` 7`B <`` > )#!`㿐>  `B @: @" '`!`B ;`ڐ 0 /  0 @@Ɩ   @:> )> !p  ' 2 !`B ~:2`  !`B:`0q2`    gʔ  `!B:`0\  T '> > 疂B# 48 ?#/ @2@/4 !(`C B8(h804 ` ( ; `  !(BV8(0" `0  J!0̒`> *@  P*`@`> TP '@2!++ +,+8++++++++++++D+L++X+d+p+++++|+++++++++++++-<-<-<****-<+++++*-<-<-<-<**-<****-<*-<*-<-<-<-<-<-<-<-<-<-<-<-<*-<-<-<-<-<-<-<-<-<-<,,,,-<-<-<,&X&p&&*`*`*`*`*`*`*`*`*`*`*`&&*`&&'*`*`'L*`'*`*`*`*`*`*`*`*`*`*`*`*`'0&$&$&$&$*\'`'`'`'`'`'x*\*\*\*\&$&$*\&&&$%*\&$*\&$*\*\*\*\*\*\*\*\*\*\*\*\&$*\*\*\*\*\*\*\*\*\*\(|(|(|'*\*\*\(|080141|379 9X999> "'p''@; '``0 ``" ` `@M* 2'``" ` `@A* &'``  `@6* '`<`  `@+* 'H /f * ' p \ p `$" > )!<\ $ \ ( p?'p* #\  ( b2 pH 0 J?"'0m!  p  @  !@ p @<  'pT 2 应  !H 0  A   A  A   A'H 0     "  "  ( 'd  `  p pp@  ' 'pp?c? "p @  'L'p 'pp`@ A',`,`, 2 2 ,`,`` p2@> );!ؖ <"#@ ``*,` 2 > );! *@+@"@`#@ 2 > );o!ؔ < *@+@"@`#@ 2 > );[!ؖ + *@+@"#@ ",` `'`'` '`$'   '  $`  $` $`  $`$ ו* * "?"?"?"?` 2 `` 2 `` 2 `` 2 `2 `> !  -B: ' > > !  -B: 'ϐ /&X`B :XА@:/ `'`` 2`  4 "  2  `@;  " `8 Ӑ?"`8& `@:   --`%`% ` %`$%`"M `H /f4 `* ' `   >  ,` ,`` `?`,`[#  H 0 Ap8'Ѐ  _h p? ` 2  s 'H 0 Xp 2©`2 `X> a  AB: ' "`X4 `<0p? ` 2 !`PB:`P`` ` `` T ` P > !`B :!`XB:`X A'`Ԥ`?р``,`?b "2    ,` 2`> ,``"```" ```> "D*` `? ?@ ` >  T > > a 3`B :'!X`B u:X ` `? `,` 2 &`2 `X>   AB: T'`< "`X  "V T!`PB:`P " V T!`B:`V T @2 > !`B :!`XB:`X 3&'Ѐ` @ "`  2`` `   `@:E  2  p  > @ j `> "` 2 `pȒ  `  T `2'@`@x| '%%' T )?` @?  'h? ? 2` ` >  ` @  @  h `> `*` D* 'hh`?'h`'h? ? ? ? 2`,` ,` `? ? ? ? ,`,``px  `@3 #  `t*` p T'? c 2 "  p  Apu'Bp`= `  `|    dp@h*'d ( ` `* @ (j?#@8'd" ` p ( /'!`hB(:`h` `  ,!* 2  " `  , *> !``B :`> a ` 7B: `' ,,`dpH /f * ' > "0 'p > 2 `` p 2` "p"`p $" p 2p" p"` H 0p   ("  7p#֒ @2p> %pȮ   ( # pᶐp"` pl@d 'd& ?* l2 2 *@* %l  *`  * 2 2 **d @ ?* 2 2 .`.`: yp@4 44 @@ 2@"@p "`p> "!l* l*`*`*`*`l*x`B :x!`pB:`pZ "  !``B:`` 'pU' p p`"`  p@h'Ap 'p  > ap`B :p `Ѐ` `8K Ѐ`> `8 ?"`8p܀> " > )"㿘4] 7H /f * ' > "/u   > 4 ``  2`$ $$ 4 H 0 --`H /f * ' > #/M $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  `_  7$  & 㿐 -H /f * ' > "/   > 3 ``  2`# ## 3 H 0   # ,`&      8 `"     $@  0 "   p  ?# g (4| 7H /f * ' > ".’   > 4 ``  2`$ $$ 4 H 0 -H /f * ' > #. $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ' 7$   @& $ @ ,@,`  ` *` ,` ,``'`˔ `  "`㿘( ؒ (m  K 7&@ 2     &  &  & ``.&`H /f * ' > ".   > 2`` 2`"""2H 02 7 " && 㿘  ,    4  @6  " `8 +?"`8& 2@4   .`.@&`&` &` &` -"< @` \@:  PW &   *P $  "%(!'L  "P" A @`\@:      *''`2'@h> "> ``c' `  @)  ` / 2 8!>A"* € @+ذ` 2 `& >A" * €!8 $  h ?$ h h ?$ h h ?$ h@ h h h h  h h h*@$ hŀ`ä  @`" h" h "  h  ?$ h ?ߐ $ h ? $ hH /``* !` ` $"`   U%  Yx H 0|``"y ` 2t `8o 6"> 7509<)04> "؀ 6/,  e 2) ', "܀ 6#,  Y 2 , > " 6,  L 2 , > "䀦 6 ,  ? ",  -`X <*@ * #$   $ h $ h $ h h@ h h  h  h h h $ h *`l`;>A!0*` € 沔 M ' Ȓ '" ` `&2>A *` €+  h(  h$2  h!2  h h2  h2  h2  h2  h2 > ' ,  @  h  2   h2   '` $` `"@ @tZH /`4 * !  !   '  !'! '!'!'!'!'! ' U/' $$` ` $H 0$ 6$` 75"  `<" ` ` "  *  ` > )"㿘`   ) 9 6 2 2( *  2$  2  2 ` R `:2"Ѐ  ` R` : В  ' " "@ ` 㿘> #쀤    " $P$ @ {Ɣ $``  `w {` 9 В " @ $ $Z {`> "> @c'`'  5ꌔ 2&@k 7$@>  ,`,`$`?`G>A#*` €@  < 3 ̀>  "<@ > "D* & V T @2"$@ 1$@     Ȑ`!  > ,`,`    Ā  ,`    2 2 2 2 ,  ' ϐ (> ? ?@ > *  @1R'А /Ԓ , $ $ $  J$ Ѐ  1 < "<@ > "D*    V T@2 1? ? 2` P6` `2 `@2  2  u 0 "p@` $ ` "`$``d$ `  \  2 2 2 2   D' @ >  "<@ > "D* . ? ? 2`6`  `2 `@2B  2  2  1`"  "`  "@_@ -'@ >  `@  `  ` @ݒ 5&@ > )ڐ" 㿘 ~   &&   -0! ``"` @`2`P" `` "`  ` ``"` >  "`"  -㿘   `""`"@  2ꉒ 5p> "'  ` @0 @?&``"&@װ հ &` "ϰ  @`"ʰ  @8ư ` )2@`?퀢`>A#*` €@ $ݖ`&`  ?` ? 2`2`>  < ˘> "D* "        "y@@/Ē `  //''' '䔒 "r 1`   P@ 2h 1 2d 1 2R@^ 1@ `` ` !(D@P "M @`"I  ` @*D `2&` @ f` &`@ (7 ` ``&`< @*`` " ) @ N`&` @*  @2   2   2@  *@   ?@& @   ?"@`6&   > )"0㿘沔 ~H  7   ' m ( * '8} 0"??  ? ? 2* * ? ? ? ?  ** F 㿘 (P H /f * ' > "'ڒ  > `3`` `$ 2` #`3`#@#`#`#` H 0`2 }9& 77#֒ @3` ?#` #` `#`  (#`  &  6 #`  ؒ`(& & #@  &   (&@  2   ("("<(<(㿐@   ۖ   @: > )/!"H   2 )>    2/  `,`    @: > )."H    > !`B  :@ !0 > ! `C : $  )  ! `,`@&@ 㿀> " '2°  > ! `C : &  ?2  " > ! `C : &   ?*  . b  2  2   2 "S>       ?#@"E> 2`  2 `  2 `  24> ` 0> ` `  ` `$ " >  ` ` ?#@2`` 2`` 2``$  " `> `B .:`?#`  ? # '` ' # '`$'# 3  耢 &`&` &`$ &`  P*`2`2`.`.`◒ ?{?" > )"`㿐> !> !"!H   , , , 7 , , ׉ > !?" " 㿘H /` * !  >  Pc$2` @.  "& $  & $& ( @~ @0 2  & (& $> "!HH 0㿘 >  Pc$3  > P#44  $   @.l     @O 㿐 `    +   @:> )-q"p   `2  >  `B : ?? @@ "@{ 0ˀ  " 0`T ` ` 2 `` 2`` ?` ? @? 2 ` `P* 2 2 .` .` `   "   2  ``* @+ ``*@2 > `P#$2  `r `#$@-ڔ  3 `  (/@` ``  `` `` `@-  2@2 `( @ $`($`$ ( @@/ޒ $`(> "!H@`Ơ`4` @9` 5?` ? 2 ` `P* 2 2 .` .` ` ` @ "`  2`` ``` ``@-w  2@`"`$`$$`(`? ? .` .` z?㿐> aH H H /` * ! $H> "`'' ` `` '' #  (  ? $ ( @ $ $$H 2 ` `` '' 2 (H 0㿈  J  2 H /f * ' !> "$Z  > `4`` `$ 2` $`4`$@$`$`$` H 0`H /f * ' "$2   > 0`` 2`  0H 02`yE0 @ ($`$` $@$`$`*+`+`+`  :  `*  +` 0#` 4#`  8#` < #`> $#X#X` #``#``#` #`"  #`#`#`  #` #` #`  #`$  ........ ?& &  ?&  &. .  (  :j* 2 2 ..@* > > "ؔ.`  @ `B 8 //'耤 `B:``"``$>  >  `B:` aB :a  aB:a> a`?  QQR,QQTUdU|UU㿘> c  > )b+l 0$>  X*X * > !!> ! +  (+a"a"  #c>\aD"z > !ē*"@ *`@ "v*`㿘  |Ґ 8@*0 8  @!0, , $  #2 * * @-L$ # $ $ @㿘n |㿘!@㿘 X  ` #2 \ \; @ \!v@8&`&` > `> )b (* > `! b㿘@)ے (&`& & &㿘 2 > )*"2 > )*#`"  2 `   `*  @ & @) ( 2  & &  㿘  > )*\#@  2 > )*U#` e > ؔ `B ;@) (W?   뀢0> `!>S!Г*` € *  > #d`> )c*m > & * `"& & $> #d`> )c*Y > #\  > #ؖ@ `B :> d  > )c*C    㿘H /``* !`  $&  & 0> !@'ǐ> c@ & &@ &  E $0 $ @& H 0㿘H /`* !  # " "  0 "  H 00 2 <> *) `2a> *)  H ` @ > *) @2V > * h)x`j>S!*` €> #P  6  > & Ս@'U#vJ   &  <"  ¤ @  0@  => !  7@ 03 >   &  6 > !> !> X T6 ?0> #L  6 > & D@' #- @ o 0@ʒ H 0㿘H /` * ! !> !>U ! kb> !> D h!> !!`> #> `" @c:@@@ `2`> "`$> #>  c" (v " c"   ?"2> ##> 8" cH" (@͐ 28H 0㿘> !!`#> `$ @` 2@H `2`$`> `$ @` 2@6 `2`$> #` > !@` @"`\ 2@> !"( P > @ >  ` ch>  `ch@ch`!ch@`@0` `  ` P@ @  ch2`h> "'@'Z     / /ђ'''b'䒒 '`4$ ̀` `8 ?"`8'̀ (̀` $ 2 J  '> $X > +̀ 2: ̀ "6  H`?2` 8" 84 $$`0 ``H  "@ @"̀`> #d`> * (> * '   > * = 㿘 ? ? >  `P@>> #+> 2#P " ( 2 , 2 0 2   4 " 2>  ` > !!`  > !"(`P   ) @ 㿀> H"> ' ' ''଀ R'H /` * !  <@ѐ  "*V  `"&V V  2"V `3> !> #9aĀ@ a#3$@0> ,XH 0!V  2< <@j @6 @CH 0    ( " > * u Ё㿘   4  / 4 $$* H`& 0 "  V` 2 ``> c`  &`` ` 6` <> a  x> `4`<"'`0O`H@^  `4 F  @S " `4`   `4 ;5&`4"ހ` "0-"!T*"`4!2` $`2T` > g`0` X,P4b `4!2"T  `  > * 8 X`(& ",P4`" <    &`H> *a&r "> > !TP`#!T"P@%W <>Tc$``$   ?4` $` ; 4` `4> $&`4chch$@"ch@$`" ` `<` ")`4@ Q? 4`  $` ` Yφ Y,> #T`>  `@ &`< ǐ?"   $ &`@@ڒ? 4`$`TT @<` #'  ' ''7P7'/'{܀ g> #d`d"!> *!(ڐܔ(% X"U`4@7'> TT @2<` #` '`  '`'`7'P'7/' ` @ "`  2`` `   @&5  2 PP`@$P"`?@"`$``4&`H ;&`4` "rْ " > * ؐ!P㿀> "0l' , 0 !L "` 0aUaV␐!NW30HaPm aM,aO/0J!J1!KN␐@$0!(H /`4> !* !> !! 2 /,"*  #> * ?&` &` ?&`  &`6` %a` .`  6`" &`$ `P6`( ` $ H 0}@#'H /`4> * !> #` ],* +@ "` "`(" `,"L`0# X *$8 <#@ `P24@ T +` 4$ ,`-  @ 8  <  @ ? D8?  0:(@ > *a$  ڢ`* * @2 6* %` ,H 0@#o 8 @`" \@* $  ` \  $  `$  `$  ` $  `$  `$ $ `$ (  `, , &`&`&` &`&` &`$&`(&`, &`0$&`4(&`8,&`<0&`@4&`D`$ "`@$@0␑H /`4> * !> # !  ? ?  > "``` @``2_ `2`@א`2 H 0qH /`* !@ߦ > !! @R @H 0R`?` @`?` ''''? @? • P7H /` * ! 5 "  H2 R H 0&`(&` R&`$&`,H 0 > !"(&`@` > *ɐ!㿘  > *#!`2@> *#" `  ` `   2  4 ݔ (2  "  4 $$" H   0`` `@   `` Y@#@ @    Y`.`` Yj@ `2 2  `    ?` 4 > !> X  @$ 2   "` `0 ```4 ``4  `  24 ` 4 `T   >  `>  `@㿘H /` * ! !> !>\aD" > !ē*"@ *`@ "*`>  `a  `"` 1 $ > #$  #2 * * @$$ ``2aH 0㿘  @ߐ  A 4  U   8 <?@' 8 4 &  0V   " \ T   A "  0 4   0( ' \ " A 4$2 H-    ` H` 2 T T ] ! `W > *b8! n  T`  > !> X ͺ4`T` 2T`> !> H 4`ͫ$`T` ) ?"4`` "`o$` $` ` 2?  $`!> `!͋@S#t @ *  xF  T  `" `    "   2 F`  nߐ XG" " # 05 0   0  㿘"` X"  3# 30-"/0*/ / / / / "/   `0` > *"m"x0`` }@  > * ("[n} 㿘`9 3  `  ؓ  %     *@@g  `( 㿘   H /` * !  @> !! +  `(@ (  ,`,@ `$` $`  $` $` ,` 4` $`   P4`$`(`( ڀ &@ &@H 0㿘   H /` * !  @> #` 5> * k<h@U <` $`$`$`$ `$` $`$$@ " `L=  G`L$ `X, `8$$`<$(@ P48`8 $,`H#" @ $,$,`\$4`P,!$0`T % ,2 * "@*`  * -    " "  " " ` {` , 4:`T   ,2`*`" *  <@  `` @&@ &@H 0> > '     '  ''''' '$ '@   td  d @:> *Y"   `2  >  `B :  `'` '`'`' > #d``!> *#ur (y Qcd (Ā $Ȁ  ̀ ?#@>   >  >   > #d`*> *McH  > #d`> *Acx? ? ??  h P7h`E~  l> #d`> *c# 0 "  -     > #d`ު> *c cd  L`?`  X  n`ǒ /`А@֒   //ѐ''''ߒ  4@  0 `     0  `A`@' '''`   " Y ?> #d`w!> +  Y lcd@   z> +`X 0V` QĀ NȀ K̀ H@0D +Ā (Ȁ %̀ !> $##` '`'`'' P7 ". @0 Κ  ".0@k/> cd  !> +  cd  !> +   cd  !> +  > ؔ `B ;k`> " > +I ȁ> "'@ے  >  Y cȐ ?  @g  > + ؔ(> +!H /f * ' > "  > 4``$ 2` $4$$$$ H 0T`Ȑ -H /f * ' > # $$H 0$ ( $4$0$($,$<$8 j "`$@   "4/'/Ȑ @$@ $ $*@ ,,, @  :  `*@  , @G,@C   ///р` /` @'`'`' ' < Pc'Ē 77'/' $$$ D$$   ` (`  @'`'`'` *'b    8| 2> #d`!> +!@| ''' '@ؒ ؖ $ܲ($ ?$?$,(.`.`.`.`.`&` &`  &` &`? ?  .` .` , @А ` Y  ?@$$ @ .`< ,` Y `, 2 2 ,, :.`.`+ (* 2 2 .`.`@  ߌ > ! `B:`  > ! `B:`> P`B :P8 ?"8  0 ``8 ?"`8i > +!@> "'    ' ' ' $'  > #d`!> +!$ ! (( >   @@pz   @@:> *"  `2 `>  `B p: ?'` '`?'`'``* `**``@  2 2 2   `? ? P7Ѐ > #d`9!> +!ĐДΐ 1>   `> #d`%> +a !> `͔  > #d`> +b( 0   ,`}  ` `@ 0  > +bX 0 Y ?> #d`!> +"p  Yx >    H`0 T` 4 Y  , ` Y Į> ` 4``$`<> a     !> X 4`4`@ ~42    ` Y@ @  ```T` v> !> X 4`Ր0k` `2.T`  Y , ` YP  `4``$`>   T` ` > !> X ƴ4`T` %2$4`  H o *@ a @"< "> @6 `<@  H 04`4 ?$4` $` F$` h"> ؔȘ `B ;g" > +"> "'@r  Y>  cȐ ?  @g   > +"Д(> +#H /f * ' > "F  > 4``$ 2` $4$$$$ H 0NȐ -H /f * ' > # $$H 0$ ( $4$0$($,$<$8 g* $@` "4/'/Ȑ @$ $ $* ,,,   `*  :,,@ @ޒ `  ` `/@/`//''''Ā < Pc 77'Ķ. ''$$ $ $$|   2@> #d`!> +#8|  '`('`?'` '$?$ $,($.`&` &`  &` &`? ?  .` .` `2`@   ` Y@ ` @  ` Y  ?@$$ @I .`< ,` Y ¦`, ., 2 2 ,,666.`.`.`.` :.`.`ʔ (* 2 2 .`.`  , > ! `B:`  > ! `薂B:`> X`B :X8 ?"8  0 ``8 ?"`8f[ > +E#x X5" !"!#! ! "!G ! 2 !ā> t"  22 㿘 >g `<ېݒ㿘  㿘> ̀ 2  > !t"!t"` " `` 0 ``(> +#> +c 0} '> Ѐ 2 t& 2 T> +*#Ѐ k f 8 |  [ 0 ``(> +#> +c] 0P@L 8 @I $> at`$""`> #d` #> , `0 (8 0A  `$ & $ $$$$@6 > a @͒#o0@  w> @ w> ĕ2`@ @Γ:`@@&@V㿘> #̀` ; S`"  "`> "!x "@= | ?0& 㿘H /` * !  > , `P  2 > ,`ː 0~ 0 ``(> +#> ,`>  0 ``(> +#> ,` 0]#@ > #d`> , a ( `2== @6@ > a `@(#ʐ04@ `2   @20(10%& > cd  #> , aH (X 0a `""`> "!x"@Р | ܐ?& H 0㿐z   0> ,ax; 0;08'#\ > ,a(*   `y&   (> ,a  > ,b ( `""`> "!x"@S | ɐ?& 㿘 `  & T  @   `& `0   㿘  0> ,"H> #Ā` > #d`!> ,"hĐ (̐ 0"     {0 "㿘 > ,a" ` "`cP> "' >    ' ''` '>  ` > #d`}!> ,"qn (u o>  &`2  2  2 [ @@j   @@:> ,#   >  `B H:  S댐  > #d`+> ,c1 0& `  ,`` Y ?> #d`!> ,#H  Y >   cl> ؔИ `B ;c_ > ,I#> "' >  a 'X '\'` 'd   > #d`!> ,#`(Đ > ? ? > #d`!> ,#X >   @@j,  , @@:> ,I#  ` 0>  `B t: `ꛔԐ 6 `> #d`W> ,cy 0R` *` * ` *`@  @] (X> '\ `'d''` /``*㜒@  '7' "8`  "` t%  #2 * * @_> c% % ` ` *`*`@ * ` 2% ` 2- @Ȑ<`T D%> 5> -3> - 2  d ~> - `( ` v> -`x q   ?  ?  d "b   Z  2h`@d "Q ֐  ߒ`H h@˒ `  /u/t  '| ' ' ' 'h 2`* *` ' * 2` `*` ' /  +  *  * @ '  +  *  * 㜒@ '@' 2 @” T*  (u DB4  >4  * *`@ *   d> #d`,!> -!@gp #4  `\  @ > %4#d` !> -!FN 4   ,` `Y ?> #d`!> -!(X `Y0 > X  @ra> ؘؔ `B ;a{ > -e"X@ @`<` `0'`'' `@''`4 ('> ␤''@ܒ @ؒ @Ԓ      / /''''////'H / +!  ` `8?"`8  & $H 0 > -" 㿘> !! "  2  @  2 2  㿘>  `  >  `" $ @  $ "@*`"  "`> !"! ">   @ " @  @`@^̜ |(> "' '> -"8А@/ @+ @'      / /''''////'  `"& $  `8 4& $ "`8& $ > -Z"X㿘> !!  㿘H /` * ! >    >  `> !> #d`>  > -bpԐ H 00e!  H 00Y)> -2 $  J "  $ H " $R  4 $ `` `` " ݀ ` a@ a``  @ H @R   @@@$@`'~H 0 㿘H /` * !   5 Ɛ0& . 6 & 2 H 00o`)> ! "`> ! "   "@:H 0X   (H 0M  |ɢ   H 0? @ ()> !$@$`$` $` $`$`$`$` $` $$`$! "$@ " $@ $@$` "& ! $` "" H 0 T   2㿘  |I  @ $  T $"  T$ @& T㿘`"  "` "@ |㿘> # @2  X X2  D  " 㿘 ` |   U @f `Ŕ `2&$`T`( `XO> `   ? @" H /` * ! cc $``"`#c$`H 0 `L `@_ `> #d` !> -"#  X () `i 㿘 P& 8 & <@ > #d` !> -#@  X (  \ +H /` * !  `"  "`  "@ T 6 | 2H 0* |@%x H /` * !    *@`?) "I 8 L 2 L  &L L2  L &L L )` 8&8 <&< D&D @&@ H&H L `P `@ > #d` !> -#|X ( `: 26 L1 L ' L0@䤒 > 䀢`2`L> #d`N > -c X (#\ Q0| "`8" <@> L2  o` [ `2R  2N  ے  X2F  0  ?" @":  ' ' ' '?#> > # "@ @  c" " 8 @  " <'' <'@ $ $ $ c$ $   2 8  @I " 1\ &\@ "`H 0㿘 T    U  " H "R  $㿘> #)>     L 6 ܐ  c> !!`- "Ac ? ? "  L 6  P    P $ P P "   "  P ?$ P  2 c"c??  "   L 6  P  ?$ P  2 c ?'> %> . ? ? "4  L 60  P  2 P@  d "  P/  X 7  P 2  L 6 @P  d "    X    2 "` "*"` @"  " @  "` $ @"  "  .   ? $  2 0   @ ?$  2 X>  P'"'> #d` !> . `  XȐ  > # "  P "  X X2   q  2s   퀤k  2 `@ `2``> #d`7!> .   X ( M @ x  ,  (/ 0' 4'''`  @  l̦ > ̀`" PW  P & P! #d`I @E`B X> .#\#`` (#dE ̀``8?"`8b > .!X@>  P'"'> #d` !> .!p  X | @   آ  //Д e@   (//[     @>  P ?`& P > # B)> ."*  P 2&  2#  X X2   "  > #d`"  X`(#\ ! `(  Հ#d` !> .! X`(  ` `8 4␐ "`8& > ."@ > hX"'qJ n )  x> #d` > .# bX ( p Z @ ] x ( @   //  hl @ pt  @''''0* @ '4*'8*'<*@'//ܒ8 @<'''ڔ > #d`!> ."    > .c"ȁ㿘 < 8  > #d`> .b   > & Dc & D 8> & @c & @ `?> "@㜄"@` ?> "`㜄"`㿘> !PH /` * ! ? ? " `PH 00>r6  ( a(H 0㿘 0`" ` 2 `@ %  2  4(2        0  > <  ` > D*`> ! > !(  ` (> D*`>  |> | ָ@lLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLטHtؠ$۸Tݰެp߀Lx㿘> !"h h> "> !' 0 `B ':0   2 ?#@    ?#@X␐@    //ђ  > !bh bh@ `h!"` `r 2~``, `,`0  `,`4 `,`8 `,@   2h`` ``  ``$ ``( `@ ה  2R``Ѐ?"0 `B < @ і"  `B ;< 7沔 Y7  /h@ٖ̔@[@̐ Lo 2@Xx̀ "0Xr"0(`B  :(n L@ "'  '̤`h@2y`h0h@@ZҐ@̐ Lo} 2@XB̀ "0X<"0(`B ;:(ng L@ 5  0␖"0`B : ; `B : ;2@X> ΐ  "  !`(B:`( #   > PB?:P > .#0!㿐`>5`C!@ ? =?     > "8 `/> $ #  ? )> ! 2#\"h`  C  r `?Ȓ#\#`"h  (> "'T'X' 'H'L'P @ '  ' ' R `:2  ZU  A 7    ``' 8# `  $" ' (  ܐ" '  " '  ؐ (& &  (W        (& 2  7K'@`&``&``&` ` &`$$ H H $, 2  *  1''&`&` &` &`H >  <`PD* 'l<*2 2  ```2 .`.`.`.@ r.`.` R `:"  Ѐ?`: А`@ '`( ]ז 2  7' 4@` (4@h2  ` 'R` :> ! "> ! `B:`?`>r"<*` €  ! `B:` "> ! `B:` "> ! `B:` "> ! `Bz:` "w> ! `Bo:` "l> ! `Bd:` "a> ! `ȖBY:` "V> ! `BN:` "K> ! aBC:a "@> ! aB8:a "5> ! `ЖB-:` "*> ! `ؖB":` "> ! `B:` "> ! `薂B :` " > ! `B:`> #ؓ-   B;00`B  :0  U    ``8 ?"`8> U֐> " > .#@㿘):- 00i le 0k  = "UX 0   )Ԫ ҝ :   U:h >  @ b '`  '̐R`F.`>s ` €`> .#P :'̑H /` * ! > >  k  '̑H 0> !bh  '̑H 0H 0 ?$`,`r  T  $`7 '̒  * ``(* 񀦠  > $#X#X$``` $` `$`($`$  ?6 j `2> > .J#`" 2``Ԁ ے $`ǀ  >  `S 1 O 1    ?#@A 1    | - 1"ऀ ' 1$`, $`0$`4$`8 Q>  ` 1 ^ /``H``,j̖ 2 ̀ m 1i'̐$`,$`0$`4 $`8$` $` $`$iA$`(WjcS   8J'̠А@   //А`X #2  97'̀ " 1'̠''' '''' ` /'̐'   -'̐ > .u#pT" > . #(> " ' @> ` `@ 쀦  ' f '& "T     2 /  1   8 ߐ 8 $ ې 8 ( א 8'''  ''''     H , 2 >  1' 2` '` 2 < 2  < $ 2 < ( 2 < 9 , ``  ` 0`8 0```$" `?ܐ?" 0  0  `` ?В`0&`&`  0S `a 7` `` 0&`X 7`? > (2 (c 4 4 4 `H4 `J l<+2 `2  ```2  ..... H   <.@&`& ` &`  (&&&&  O&$* `4 <c4 > # , h`" ,2    HȨ ' /'S& R > .#㿘@` +> #Г*`   0@+$ 2@ * $㿘@ 2> #Г*`"  㿘 沔 Ss  2 H /` * !  L> ci  RH 0 7H 0hʐ    㿘 & ` 2` `@ (  J  2`  TP` > RcБ* @ ``Ra㿘    $ 8 @ H /f * '    H 0 2  > #"` f > `@ 4 RБ* @ 2    㿘` > RcБ* @@H /f * '    w H 0 " 㿘  *`2`  > #Г:` `& +`0 | H /f * ' <H p@㿘> #Д  . `2  . -* *  *  Jє  *> #Р)>   @   $ 4@ 4 @ $ 0 4?`> #` "$`m J$`$` 4 J  >   $g 4> #  "$ U J$ $  㿘 >  > c" @"`````D     8XT , | x   㿘  V &   㿘  JJ  " @ > X> #$ $4 "X$ 㿘>  X X" @@@ "@ 2@@"@> ``?"``> `d?"`d ͒ J 㿐  ,   *  ,   J    5 4`     2 *@* @  | `"6> ``0s0 ː@"   5,,4$[ m>  X`` " @` @`2`W 0B X``  `  @`*  `@`2`PP@ܒ   5,,4$ ' X``  2@` g@`2`P,>  X` ` V@`2`P@ Jh> "'@  "  "  $  $  //  h  // ␐ J  ' &@t`&`T&`Xр  0 ( 2' 7 ( ,' 0' 4' J'7Ґ@$`&`D&`Hр  0 X b' 7 X \' `' d' z'7Ґ@`&`X&`Tр  0 , 4' 7 8 <' @' D' L'7Ґ@`&`H&`Dр  0 \ d' 7 h l' p' t' |'7Ғ@ǐ̐ &`P 2@р  "  x  ` " $ 0*` $ *` " $ H*` $*  > /5 (㿐  0  @2  P  @2 P  Ԁ@"  P 2   @2    @2   ܀@"    䀒@2 !% "! !$   ?! "!A!   ?!A "!x!@   ?!x "!|R    ?!| "!pR    ?!p "!tR    ?!t "!R    ?! "!R    ?! "!\R    ?!\ "!`    ?!` "!    ?! 2 2& Jє  ' &@*&`@;&`@]    @   Ԁ@  @&`@E    @   ܀@  @&` @-   䀒@&`@# &`@!$&`@!!@ &`@!@!x &`(@ !| &`,@ !p &`h@1 !t &`l@( ! &`p@G ! &`t@> !\ &` @ !` &`$@ ! &`|@ @ `p! 2" p @r@'pl p" `   l J  㿘@`! # ?6>{(> L, 3+*@ ("> H! 2 *@ " *@ "> P l*@  " *@ " - > "'H''X'H'T@ >  X '@ `> `2@``d ?  J  'H @ܒ H - - > #45 4HH% 2`H \ 'X`X      `\ 2 S\M#\H@H J'HH@  'X ?`>{ d*` €@"  /I 'X4@@@<Ȕ  XF '  J  'H| @m H'T''@ |TsX ` Ԁ ؀   ̀ Ѐ RԀ O؀ L Ì FЀ C  > "t`=   9 H /`4 * !        l  2 3`\ n `$ p"x'H@ HP ! ,! 'XWH@ Ð@!$@!@!@@  @ { @ w @ʔ @Ɣ @ @ @ڔ @֔ @ @ ؐ!#`#\ܒ!@ B@ܐ''' R$ #  'X`!$ !ZH-'H            @ P @  @  @  @H 0tX ` Ԁ ؀   ̀ Ѐ SԀ P؀ M J̀ GЀ D  > "t`>   : H /`4 * !        l  2 3`] o  ` k !h'H@  ! ,!L 'XXH@ Đ@ !$@ !@ !@@  @ | @ x @˔ @ǔ @ @ @ ۔ @ ה @  @  ؐ!#`#\̒!@ C@ݐ''' N$ "   'X H'X!u'H XHH 0'H H /`4 * !        l  2 3` ϐ  H 0pX)` f H b'X _'@ H /`4 * !        l  2 3`~ HZ 'X '@H 0*X`  H>  `$``" ` H J  'H @ HH 2@H> .`#c @H 8'Ē J  'H H ` * @$`H@ 8H 2@H> .`#F 0H ' Jy  'H @Ӓ H 2@H> / `0 H''X ` >{ <*` €H /`4> * !> !x`  ` `% 2 `H 0H /` * ! >~"Hl H 0X'`'dH /` * ! >~!S`'XH 0X Ā  7x t'X H /`4 * !        l  2 3`  `䀢     l  2 3`y  "    `" ` ""`  `"$ ` ""`$ " H 0X  ?     -       ԠئX#\#`̐@ tФ(@ݒ 0@ْ 4; 0H `0 ^ * Ȥ  0 8 ?"8@I 0 2  `0@B 0 2  `` ` `   `H 0X` $'XH 0XH 0 7> b8  #>  "b8> /`8a#\ ؔ  1 a` 2 H 0k @\ ؐ $`$``$` 0  /(/)7* 0',`0 0 `>{ $*` €",` ,` ,` ,` ,` ,``> !0#H 0(    ` ,``|u `|@  ``j  ``@         l  2 3` ,` $``  $`"- n, t  $``"> #A0!VH 0ΐ 7 2@` n2``"`"``R`` + n, G  $``"> #0!)H 0 7 2@` n2``"`"``R`` `G  ( ('X`" ``Ā``"`"``"@` "`` "> > !H 0aX> !x!x`$`x`"`А`""xx$`> ah "ah <`,`H 0AX"HpD 7'X`X " `" ` @2  D GDX  `2`@  d`$`  $dd $`?$d 'XX  F D 7B ,   "@X & /-     , `  @   ,  `> ax* @   @H> "@ @      H@ > 'XH "H JH J X 'XH 0X> " > / H> \$>  ``"\'l @  ?`  ? P h଀ "R    ?ఀ "R    ?ഀ "R    ?฀ "R    ? J  p @? 'l@;l 'pl 7 *2*"ࢀ 2* 3 ll +l -`"@'2 2@   r`@'2 2@   c`଀ 'R   ? 2 3ଠ3  RN`ఀ 'R   ? 2 3ఠ3  R9`ഀ 'R   ? 2 2ഠ   ഐ 2ؐ R`฀ 'R   ? 2 2ภ  22 R`''hh  *2 'd5> ĺ > ∀ 6` 6`ࢀ 2] l> Ġ!> /`X@ڔ   > / ! .`6` d6```@̔  > / ! .`6` W6``h@  > / # `p@  > / @ `x@  > /  (!.`6`56` `@ > / P .`6` (6``@  2"> /  ( .`6`6` > /!> > /`!@~  > /  !`@u  2> / .`6`6` > /@i > /  `@`  > / .@6`/6``А@T > /  .@6`"6``@G  > /! `@=  > /!  a@3  > ߒ" .@6`6`> "> +> > b> b> ";= > ⌙=`+> b> ==&`&`>`>` >`(>`0>`8>`@h`Hd `@ 'dlp   / l@ l J! 3  26 !  0 l"!S -! J!$  ?` p @  'lB p@j l@fl `'l'p *@*`!> *` \4`l"`2` # \'t@flll'x@ .`2 l *  $`?@}lll'@ !$l!'@l   ˜ @) J` `'\ @^ @ Hp@ \@X J\X` @ C `@ X  2  /a7d@/`/c  /\@``?&@&` *` 22 `` *`\@X \X@` "@ &`&@  X  X`  &`\  J㿐      p a "    "  }  (  } "    "    (  " R    ? R    ?2&h  J  '` &@p a &`@7 ` } &`@/ |  0@Ę> c 2@   &`(  R  ? @'R  ? 2 2 @2 `( R` 2   " &`,  R  ? @'R  ? 2 2 @2 `, R|` 㿘> !x    ̀ 2 ` '\n @ Wp@ \6X Y`X@ T `@  `  2/`/c 3 l    X /cX  2 /a7d@  0\@``?&@&` *` 22 ``*`\@X \X@` "@ &`&@  X \`X  &`\  J㿈  Y `2 T '/'''  &0B> c- <H /` * ! >#7H 0 &H /` * ! >#.H 0"&&㿘!>  @)! >{>{>~>!$!ؖ0#ta`" " " " 㿘> 𢡄! )L))))))**+++, ,,-())-P-P)))L)-P+\+\+4+4,-P)㿈> "'@  ` & * 2     > # `4 2n   `h f  b>  h* `8`(Z * @    @@ ߑ, `۔ @ ?Ӯ >#T* €20  8, "*  8&  8"  뀢   2  `` ? 2   `  "(6 `- 2    4` ` 2 @K `@ݔ  }`2 ` w- 2    4` 6` 2̰   (ư `\`?: *  2  (  8  (  8 v (  8  4kJ?`.@  ? ^(   *  T(  @ H @ H @ B 8k   8g  `@ * 2([  - 2    ,`2 ? 6 @ 4E ` ۔ `29 @(2 2/ &@* &`ͤ`2%  >  *`   @2      b `   b `   b > /ؽ!1$1,1L1D1T1\1\1\1\1\141\1\1\1\11\1\1\1\1<0000000000000009t99999`?"7 ` ` * ` * ` *`" `*!` "`  $" $` "`  $@" $`  $" $`  $" $`  $" $`  $" $ `  $" $ 2`" a*`$ * * al2`` " ` ` * `"`>(           * `"`$>8(           * `$"`$ " `$@"`$ " `$"`$ " `$"`$ " `$" " "㿐`"N`"`0"`0 &  $  $ ?& $` >  $  $ ?& $` >  $ :` B   & $2 (#  '  (]` $ ?& $` >  $ P& $ $ ?L& $ &  $" $ =& $` >  $! $ >& $` >  $ :` B  & $2 (#  'Ǡ X` $ ?& $` >  $$ & $ $ ; & $& `> `> `> ȁ@  &2"  $F@5; @@" $ " $" $ : $" $ : $ "+@'  $ " $" $ : $" $ : $"@  " : : Ȓ :": :@ #@㿘\` ` @b 0@_ 02   `@~@z`@v .`.  0.@.   '0i}s}o 6   .  & `. &  6 `6 6`.`&``&` 6``H6`F.` H   C }F}B 6   .  &  &  &  & `& ` & `& `. (& $ 6 *`6 ,6`.`&` &` &`&``&`` &``&` `&`$6`*`6`,.`( "` 06 +  3 *2` `"`"`2!+  3 *2 ``"` " `"`" `*"`" ` "`$"`,2 "㿘`' P `2>"ȓ*` € * *  *  * * **  2*  &' L2* &' T' D ' Xz ' Ht 㿘```  `` 0 .㿘@  ? 2 2@`&@`*@  ?@&㿘`(!!@ n*   &@`*`2 22Y n & "` n"`R`V` 㿘`.!p!t@ n*   &@`*`2 "   2@ 2@' n & "` n"`R`$` 㿘`/!|!x@ n*  N?&@`*` 2 022 n & "` n"`R`` 㿘apatR ` `2`2  "  2`&R А R`  ?@&㿘aaR ` `2`2  22`&R  R`  ?@&㿘a|axR ` `2`2 "2  " 2 22`&R } R`  ?@&` ``0"2 `0" 2 㿘`  ? 2 2`*`2`&a`Q```  ? 2 2`*`2`&a\@``  ?@&``2!a 000"㿘`> / !P 㿘> !` `@_`?@`> !`""> /!`0 40@V &`0> /ap@FN&`D> `"&`D`D> !!> #L""> /a@E`0&`4@ 2 *@&`8 <- '' @#\#` ?P  > `t$@ > / ! 4 &`@%> ' 4t` cL @>`<  cL`T    ҢcL@l`@* @ `8@e* ? 5 >#?`@`0&cL:  0$ Є&`@ :`@>`< `T  ?&`8&`< H `0" `0@* ?  "@`0 "`0" H 0 `0> /@!`82`4 `2,3 4  > /@튒aH 2'4 ''@E %> /#>@D@A '`։ @E  > L> !> !2@ * <cL#@0 @("@ 0 p > !`> L< "0@("0 4@㿘> !   `@`?㿘  > /"@& " 4> / "P 4> /"`> a  > /"p 㿘`> / "P P> !`` 4> /> /">?#h@! ` > /> /n"0k"4  > /@ɒb 2'4 '''> /@D$Р @2 &`<   &`8> /"칒@C@D<> /"|N`%"|)> /@@ "/쟐@@Ȑ  @ x >'՝ N 4'> )> /@C# b|@k 2@@ > /@[c( 2 $@ B >'g @C Ґ㿘` > /> !`> /> / b8@f  > /> /ʐ"0ǐ"1> !" >$   &"> /*#0@i$>u#@,㿘` > /> !`> /> / b8@4  > /> /혐"0핐"1> !" >$ ޔ  &"> /#X@7$>C#@P> !`` $`> /n"0P0`4 @T2 &`0`@< @T, &`45> /@C)Р $`0@7 &`<   &`8> /#뾒@B`0> !> /"#@ `a4  > /@랒b8 2'a4 ''> /"0#>'bp 'Ԩ> /b('bp'ԟ 㿘 < 2`4> /놐#? ? -   =" @ <  8@  &`0  * * @ 2 &`0P> ! ` q> `<2| > `<@"s `  '''!  >  $#P. '䀢  ?@> #L@Sw  ` '`'?'` '8` !'> /@b0  8> /@b(  2'8> /@b 2'8 ''@'   "'耢`">@'>  㿘l 㿘d 㿘\ 㿘> #d. > a* 8@S  > /> !"`4 ꗐ#Ȁ > !> /#  `B < "*` `" 0@  @ 0 2㿘> !"`?> 0k 2. > 0f 8@ 2"@> .`!> 0>  .`!> 0 0 2 0& 0  >#  0 2 8   2> 09 `@x 8#&& @LȖ 㿘> !`+> #L@ %#L?    2 #+`? ҃@ @ 2  @ 2   @RR 㿘> #L?@> '#@d 㿘> !"`P> #쀢`)Ho o > !`> ! ?8` **H 0 02> ! "?8`**"> ! "?8`**"Ho o > !`> ! ?8` **H 0 > `> ǐ(2 > !" 㿘> ! "  > 0 > 0@z x`?@t   > 0@m  㿘> !`!> 0> # `h@팔  25> !> 0@S > !> !"" 2/> 0 ,  @Q '&5> ! #> 0?8 , @Q a`?8 > !`  > !`*&> !>"b̩ > #쀢`"> 0? > 0교 㿘> !"`> 0 H > ! ⴐ*"**@H 0 > ! " > !> !" H  * *H 㿘> !` >`? > c@   D 8@ 㿘 > "#В   @Q0> !# > ! *`* @ *#b@ @ > ""ܦ ͐ > "  *   *   J#  ⼀`* `> 0` `> 0 > 0!@ 0 ` > 0`& !㿘> !` V` >`? > `$@\   Ւ 8@ 㿘> 0!8  0@P%> > "c"㿘> !`2>`? > `L@3 "    8@ > 0@% `?㿘> !` > 0!@  > 0@?aH 2> 0> 0!P颐!X> 0@ah  0 @Pa!> ##> ' c   &c @ 0 @PK(> #`> '#   > > !`> >  "`" > *  *`  *  > !#""bȁ㿘> !  >`? > 0@筐 Ѐ   & 8@  > 0!p" > 0!@`?㿐!> !   ?* *   @O ?   @O0? ?> !> !"""" `!  ?0 @Oϖ ?` ` > !> "b" '> 0 $ '$@ d@`> 0\!> :` @ d@  ސ᠁㿘H/` /  > a    "a > a?"a`?H 0 `> #L> !> #Ȓ  > '#  > !> g> ! `* `*  `*  `*  `*  `* 㿘> #Ѐ`!!> !Ā`d> 0芐! d> "cXВ d$!@"@!> !> "a" * " *` " h*`%> Ħ"@@  > 0d! d$@Ő> "a#> c\ c\$c\c\@ > 0M" d$c\c\> "#X@䫐> 3  c̑:  d@!> ǔ :`@4:`"!  > !> !b> !"Е* "+ "@!  > !?`*`  "* " c> !: !#"b!  㿐H/` /> cЀ  > !"  '} 0> !> !"@'? 'H 0x 㿐> #Ѐ`> > 0A"Pa  > !"> !b ' !> !"İ ""  "`0"! ? 'z> #̰> !"! @ > !"Г* "! * ?"`  㿘8`(< ;`; :9 (`/`+* *`*@  ( .  `.` . . `D@`E   43  F,  ?+  +`2aman> 0`. P @ 4`.`(&@& (.`& ' . ((㿘> #xTa@㏐ @徐 @㆐* @嵒 &  E& &    > 0"``?   ,R  4  6> 0"`*`R $ `& & 4& Ta@偐@K.& @y.@C <& @q <&@: * @i & @1*  @`&  @(*  @W &  @* @M  &  @* @C  &  @ * @8 & 㿘> !Y`?!bȀ  > 0捐"x ư!@ > #Ѐ`@>    `@- `-Ԛ> "cxcx  > 0"cx`$"@-! cx, ""cx6> 0> 0""Ta@⩐ > 0?"> 0a > 0#7> 04#x> #Ѐ` > x -> !"`)x@2> #x`!> !"Ȁ :  ' `,',',',',',',',' ' `,'#㿈@@㿈@J'@&> !⼅H> !⼖  *  @( `" (H > !⼅H> !⼖  * *@ `" (H 㿘!T!@!@1@..`@*.@ <.`@# <.` @ .`'> 2>>!m!lP`.`  "` @   &   "  .`.` 9 5  1 '    2mn 8  > @ * (@* (* ("@㿘> #Ѐ`0=H > #x#x& & H 0 > !  !   > 4>  & "? & ?/a `&&   "㿘> !` >  : %"@8@s /1> #  ! % `   ,    @   @`㿘> # 6 - >  ` "!> 0@N* :  .@> a@ђ 2c    @N* :  ٴ`  z 㿘>  ` #>  %> 0$` ! ֘ $` 2$` % 㿘> >  `" "@ 㿘> !`  > 0@⁐#(   㿘  0@Jۖ > !"b>  > 0* #0㿘> J 耢` > !" В`"@*㿘  > 0@R#@`?  `@I  > ! `?㿘>&`0aܐ`<ž> !` > 80 @J &`4> #> 逢"a,@> 0㾐#H㿘 H  8@2 > 쀢`& 8& 8> a  H  8> ! ?c 4  2H 0 a Ho o>  8! ֪@H 0 쀢  > `> (2 a <㿘`@`?> "' &`0> 0c`@9=  &`LX:   @2`H &`H`H  >_ 0>[!x> !  0 > 0#h> 0#p> "a8@j`H> 0`#xa0`@@[> !#``8`< (@~a`@5Q``4> 0 dF> 0 #> !> 0> # #h9> !Jb؀ b> 0# > 0#``"`H@6`H >!xH/ /aD@[(H 0b > 0#㾐'pp:   &!> ! "c㿘> 0c> 0  Ⲑ# `   > 0#> 0⦐# $ > 0 ,#❕: > 1` <-> 1 D ⒕: %> 1   `&c> 1 :` ⅐ 0> 1`&c l :` > 1 > 1    s h> 1 n `> 1` T> 1 \ : c`> 1^ 㿘> 1 D  8 < @  ""`l0= . 08" >&"`"`"` "`"` "!X"!H"!L"!P+"!T "`l"   "` "`"`"`  ("`l"   "` "`"`"`  ("`!"!"`l"   "` "`"`"`  ("`㿘!> !# #  "" 6y # !?00 $}0+!@  d !& & & & \!& d!0  "_^ @ !,! & & & & d& \b@ !$ @! & l& & & d& \& `& 㿘@4A> 1a@7 & h& d> 1a @7& \> 1a @7 & 㿘`? > 1a0@@7$`& > 1a@@7 > 1aP@7 > 1a` $`@7z$` `  * & * "@> 1!p * $`l$`$`> 1$`a@7\ ! &!㿘!  > a0 @ju > !> 1"ؔᚒ (㿘`  > 1a@7Đ& > 1aА@75  2&  & !> 1& @7!؀ > 1 @7a耢 {> 1 v!ؐ@7 & 4> 1a @7& , `> 1!> 1%> 1 )> 1`   * `2 * `"& 0> 1"߃& 0 @6b( 4& 8 8& $@6 & L "@@6& D`  `   *@ `2 * `"& H> 1"XS& H @6p& P Lsq P 0& < H 8  ,&  D@ 8  $& 5 > 1b@6 & > 1b @6&  `> 1 )> 1`   * `2 * `"& > 1!p&  @6|b /-&@6" 3"@6l & d> 1bД @6f& \ ` > 1`   * `2 * `"& `> 1"ؒ& ` @6Ec& h d h& T > 1T#㿘@ Ā( Ƣ㿘@@㿘 ւ>!  @ & T&!> 1&#@  T &!>ܐ#(c0&!H&!\ T   & 㿘 >`T  #@2 > 1#X@, 㿘 &   Ң @|㿘 H H:  < @&!\& 4& \& &! &!0&!,&!D&!4&!H&!L&!P&!T@Z&!X&ƀƠ㿘 H @> 2H` > 2`@5?`4 ` > 2`@5?> ǥ<  > !` ` > 2`@5?`4 ` > 2?`@5s)> < % ?"?`@5e?> 2> 8`@5[?> 2> <`@5Q?> 2?`@5K)> >  \!@2  ?2  ?2  ?2   ?2 & 8& <& @& D ` 4 2 \ & 4 \ 2   & \ 2!  & ! 2   &!  ` €`"!0 2!0! #> 1a @4 & @1~a @4 & !0 2!,  &!0!, 2!D  &!,!D 2!4  &!D!4 2!8  &!4!8 2!H  $&!8!H 2!L  (&!H!L 2!P  ,&!L!P 2!T  0&!P!T 2!X  4&!T!X 2!\  8&!X!\ 2!`  <&!\!` 2!d  @&!`!d 2!t  D&!d!t   H&!t㿘> "`"`2``?2`` 2` `@ 2`> 2޶㿘> `  "`Ho o>   \ `  |"` H 0 > !"#㿘> !`2    `> 2!@ܧ`?㿘> !` > !# 2"> 2ܣ!`2 > ! 0 @D > !"#> 2"!㿘 > 2" > 2"(> 2> 20!> 2> 2"p > !c`> 2> 2@"> 2o"㿘> 2#> 2> 20#> 2> 2#h`> 2U#㿐>!8€` `> 2#ғ2`> `Ѐ>  Ԑ " > ?"#`# 㿘 + #`!> 3ݪ 0> `؀ "`> 2#ݟ> ؀ + > `Ѐ ""`Ђ$ Т@  㿐>!8€ ''|㿘 4 > !#. @  `@2$ ` " 㿘``@ۻ "$ > !`2  > > !` >  > 3`x@3!?V`  `?#L  & 48@ 㿈`> !,#@`@1֐$@ 2 !0@ @"!0> 3ۈ `> 3 0 > 3   `0>  ```P,> 3`Ȁ '耤  > 3 '2> !> 3 '> !> '',&&&& n& &  > @& &> `  &.G.J.H .K @n >6 2   @ H /k * , @S H 0 \`\ \ > a 2>  > > `""> a8 @=> ap @=  a> 3 Ho o>  @  @ H 0> !`> 3 a@27  > >``0 " T" P" X? \㿘`" > 3<! > 36!  㿘> a$     a$,@ " @ 2L |L آ@@ `> !䀢  > ! "䀢  0 㿘> !c䀢 + "cH /e * & > a$   $. @ " @  $H 0 㿘@j @f   * 2 :@$ 㿘`2  > 3#!0.`@ 4 @ : 2 <`. =. <  H( @ *I@*G *I *G@@   *H*J*K@  *H*K*J *J*H*KH  㿘*3> a "z a `" r  㿘*3> a "e *a`] 㿘>  `" Q  㿘> *@!`D 㿘 >  `" 8  㿘 > *@!`+ 㿘 X !> !   l ! $!& X 㿘 X  > a& X "a  V 㿘> !#%>  @    > !`@q@1㿘H/` /#> a  ܐ  a  Ӑ H 0㿘H/` /#> a    a.  H 0> !> ?  @( `(  " " 㿘> !c㿘> !cǒ`> !Ȅ Ȅ " " 㿐> #` Ho o   c    cH 0% H/` /1> !`> !`$ *c`P!`> !`$*H 0 " 㿐`/Ho o> #  `   0 T@H 0> b> # '> ``!`@,['> 3 €x ??`> 3֐!-%> 3p x@ " > 3`@ 2 > 3پ!%> 3> 3`П€ > 3  a@/> 3@`Ȁ Op%> 3'> 7> 3 %> 3'> 7> 3`J@ 2`J@ :J` ` z$?@, €耢 > 3م!K@p @ " > 3@ 2%> 3> 3!m0ݒ@/?> 3@ʒb > #" `& @/3> 3@׾`Ȁ ?Op `J@ 2`J@ :?J` ` z$ ? @`L'> `H7> 3JJ@@`> 35"(`  `$ > 3*"X@0    > !> "c  -`x ,`> 3",  > !#̒ " > !"㴟@&aa @ > 3 "㿘` 5 % ` % `. 5. % % 㿘 {  p  0`` 㿘 0  0@  S 0&  4 <& $ 8& ,& (  b ^  Z  U   P  L  H   C  ? ; 7 3  / M J  %  !   㿘`0  8  . 8   @  `€   @ ` 8   @  `€ "  @ 㿘 0  N L " ? . L `@? \ * L * L * L㿘    <|P<d<,<t㿘> ǔ!   "     2> 3> 3""@2@ "     ?  㿘`> 3׷" 㿘@"  22?@ 2-? " d@  2#?@  2? @ 2?@ 2?  @ 2?@ɐ ? 㿈 2&`h80 @>< &`h`&` &`&`&`&`|`|&`> 3 b#`> "#L>a,&`Ԕ @8 > 3S# 0`> `ؔ`ԖPU>#8&`0 `0 @8M&`4`h&`&`&`    7 *` @ " 2 7+ ` &``h&``&`&` X&`l > 3#H0j` "> 3@ @V "> 3> 3 #`> 34 #8 7'> !`> 3> 3""@Z *>  " #bD 04    >  <@ >@  >'>bDa>ab> "@'5>'8 ``' @'Ւ 㿘$ N   *@ * &   & @ @ c 4 # @ Ѐ 2a"@  2  @ 2      `?   *@ 몒 㿘>aXa:> a`4 " > 3> 3 0#  @?<#?&`&`А l&`,`" @  @ @> #8`0`&`&`\x2&> ֒ "XQ&`@j6㿘 D> $ `:  6? $* @`9  T 4`Ԥ   <@Ԓ, `Ԁ   < -` @Ԋ,   0@ U! &#   $* : *` @@@$`Ԑ@: =& @*  5& 4& <`Ԗ   T*], @$& @H /d * %  a ҐaaH 2`$@*0  > 3ա#@H 00 0(& 0H /d * % NGH 0㿘 $  |&!H&! !&! "# @ 㿘!` $!  &!&!!"a!!"@`$ !&! &! "@$ &!H ܐ&`@& `$N &!0> !ē*!4@ $ 㿘 "   *@  *@U  * `  *@㿘 "  l |      l *` " ` + * ``*`*0X 0 *` `  `*` G 㿘H /d * %   $ & H 0㿘 $H /d * %  ?& |  @ H 0㿘a " '> 3 `Ѐ``$  g ? ,  2 > 4 W`?$ ?㿘a"? @   *0  ??㿘> $  :  6J $* @  p2``  ` *` *  > * b   Ж2 ,  "  Ԁ " # ?  $ $ 􀢠$ @֐ `  *@"     $  $     $ > $2 @  ( """ ଄( "଄( "ଐ ਄"ఝ㿘>>= | l 㿘>>= | l  㿘 > 4 0@㿈 |   > 3"> 4 Ӑ 8 "> 4  > 4%!h> 4!!h> 4 P0> 4  X ӻp0 > 4 ( > 4 > 4 > 4  #\#`#d#hpӧ 0Ӥ㿘H /d4 |* % |   > 4 ! Ӎ  & !0 "&   & @HH 0㿘H o*@ e@3 H 0㿘  "   > 4 W!0> 4 R!H /d * % @ H 0 㿘       & & &  |`2a0& r $aa`a"a& aa"@$aH0@2H `L> ̓*` €& $`< `$` T* @a* $`a`   & > ( l` * @ " ` "`! ?$ ``$`  ` & > !Ā`a`:`` ?$` " `0@2`@:$`@@6?$` & & `x`0BU<`x> !Ġ!*`  `     ܐ &    ` `@} (  $``Ԭ  `@ - `@ؒ$8> cL @Β8$`<` |- $`@ν|%@ |`|`ؒ@ "H> 4F"H` 0 & @ ` & /`0 *@& & & > !Ġ!*@ # M j, `@ ` b  \  V ~ P   r D, `@ `j < `d 6 _ 1` `Y + S % M  G  !  `& > aĠ! 2`0 s   ` ( |N@@-$`> aĔ  & !& & ɒ > 4b(0!0< @`0G" 0!<@`00" <   2   % 2  @2     `4  ` ? ` & &    &  1&   ` `@ͷ* > 3> 4? b0> 4F P&  ?? &   ? ` & & ```ؐ `$``"  $` $`܀$`@͆Z$@ ||6 d> !Ė 2`@ !& & & :`ȐS (!O> !Ġ! * & @ & & d  6 `^ 05  !  ` & > aĠ! @@ư 0" >?  "$`@ |` "  > 4ߒb@  ސ@ & 㿘 |!0&  9    6!  " - " ) 2  6  2 > 4"hЍ 1    2& 0&    ? > 4"x  !&     @ѓ* > 3> 4b? > 4` P> 4b}`0$`4($`0  & ? 㿘> c$6   bA@ "@@"  `p@Jb@G 0z ">@Se e@ 0p !@"4V  `m@`q@ 0a )"=@, e g@W  Ȑx!Q N L   @d " A> Ȑ@e%`|: 7 @Ґ3 2. n) @)% ԰ &&& & &&&& & $&$(&(,&,0&0 & $ 㿘> #$6  `  tԒ   29 7  &, 2@L t $D$,$0@`z+z(``z$Ԗ  @z* &a`:` * $<$T$HfH&~ 㿘>  c$2 !@@" 4 Ԑ ` !,* $ (> 4b$ 8Ԕ  $ , $ 4$ 0$4 H@̕$ <> 4 b@̐  4   84 J$ Xy$ $   aW4 $ $, ֐4 >`|@c > 4"㿘> !   $ a z0  \ 0    ? *@z!   *@ `p2```   *` ( > (  Ё/> @=%/> ج%/> L @ E < @   7A2Y    @2 $ ^$ 4@  , ,2 @$ $ +> a`-?8 -0-?8 - ?$ (` --00 @-a""  Ѐ2 @ , ?$ ( @-a"  Ѐ 2 @`  ,` @$ ( $ +> a`+?P `-`0+-?P%/> @@̀㿘`> 4 \" > 4@$.cJ@ > 4Q#3> cx @$0 !<: cx> 4D#(!@> 4!<?#0 㿘> !`2 2 ` D 2   & D @̋`?P`   "`> 4#H0g`> 4_^@cX@#@ H&`0> 4h> 4c@# ?&`@ 2 a4 H &`< L&`8)& D  > 4@Ub 2'a4 ''#> 4@#c @ο &`< -  &`8> 4#Fc@#u@#Ȑ 5> 4#>@#@ `  @ 'c@6 @# 㿘 < 21`0`4=#  ?*@2`&a@Q&a<> !`"`0> 4#>* `  &`4&`0 &a<=&a@ `<"@"`   0. `4&a<` (&a@`0+  *  <    `4  8@  @ ` @  #@  8@ `# `ޑ+ 㿘`$#> 4   b> 4`#> 5 ˬ @Δ  2 $& 4& $ 4㿘> #d. @> 5 (&  4 #> 4 `"  @ c(  2 㿘> 4 b@" a<: 2` > 5 8 㿐 /@ؒ @d @H /e4 H* & H   L  P`2  H@'H 00 > !wf@ͨ#貒 $  & L& H 0  PH 0㿐H /e * &  0 /& L & HH 0  "@"  "@"  4㿘# @ #@" D!? # @  #@?     @U  ܐ&   X㿘 <  ` & D(. <`   `0  `. <  . < ` <     . <> 5 x% 0& 8㿐 8 `    / 0  㿐.` & 4` `2``2` 0 // ` 8`? `> "` >'``8ɔ> ,* "* ` 0c& & &`4 > &``?&`\ # ,` @ *  @> :!x˽ `\  > :!`  >  "  a`" `"a" `\  > :!` >  a "` a"   2> : ! > :ˆ!> :@a > :@a 2> :> :u!> :r! #>>>a(L$&&&&l  * &`0#&`p`p*&`l &`|&`t&`x&`d&`h P 2`\ & X`\ 8 @ vg# ' ''ȑH /k * ,  1 . 1H 0&@̒H /k * , @ H 0 ␀ @ H /k * , ﳒ @u H 0 > :!؁㿘> `?2  @@ &> :P!p*` 0㿘 4 0H /k * ,  `. @ϒ . `@ @2 > !> ה I  \ 2  T 1 ` , 1, !Y  T`  X > :!@ 4H 0`> c`?> 2   ' 6 c+ @ 2 0 `  4`p $ $  ` H /e4`p* &`p  $`lP`"'@ "'H 0> :"H  '' `  @' ` @ ' `  'ȑH /k * , 1 ,1, H 0$`@ \`2 $` # %$`$`$`$`$`NH /k * ,  @m x> $ p㘐 p$ l$ t   `, @H 0H 0 `h> א ؓ*` € 2`p "" > :Ր"(㿘?2 >  . @ 0 p >  h ؓ*`  €u p` ǐ 㿘?2  > c. > `0 h*` 㿘?2  > c. > `0 h *` 㿘?2  > c. > `0` h`* @`4@ lј d H /k * ,  ]@ "4```y@8`x@6@ `z@`{@7  `\@ " j@(+ `m@&`k@*$  0 0&y $``@v 0 @s 0 @0@& H 0㿘 l? 2`>  㸑*  4H /e4 p* & pA =V  H 4 P & pא HZ  H , P H 0 H o4$ *@ l$ $  p  & p, `1 2   ,`1,`!M      $ $ H 0l?0> c(H4p(p " " p"pH 㿘 l? 2`>  㸑* `( 4``$`@" `  `   \  @,@   " w 2쒒 H /k * , @x 3 c 5 ? !   " #" ` 4`@`@ ` 4,3 `d,5  @"`@2`,4& & & @ @   $ $ $@@@> $ d $ h   , , ,L    `, @> #c$ d$ h@b H 0@@  , @  4 `G `H*`F " `F `I*`F `F `? "߆ *`?㿘 4 J`` 5 * *5@     & & "@ 㿘 4 ?2  l@ " 58 m k@" 5 @@" 5@* } *5@     & & "@w  4 5 `` `  D`2 @` 2 㿘 l? > 2` 㸐 * 4 K 4 H /k`* ,`    `*@P    ***L   `*@ H 0 㿘 4 K  58 %  @ % @ *5*% %끒 㿘 `p`|`t ` 럐 p 댒 0,,  :`xw ?$`p$`t `  ,`. L `  `d ``,`   ``,` 1   . 1<. !㿘 @  & @ $ $    b    $ $  1  . 1. !  ,  , . L㿘 & `\   `> #```b`2 F D F@ . D E  `@ . E$`$` ,`. L㿐H /k4 P* , P& X T& P& TH 0  > :"`> :"h`2> :> :"`"h#\> :b0Ő 㿘>   l> `h  t*` "  4 |   T X `& T` & X> !ē*"@  8Г*``p  ,@@ * $@ ? ` p  @ @ P X `& P` & X> !ē*"@  8*`@@?2`  ,@@ * $@    .  @: x2 `6& lH /k * ,  t& & t t h     `. `1  -`1"-`!   `. H 0㿘`p `&`p &`p `H`P " > `h ؐ *` €㿘 4H /k4 E* , E D, EH 0  G > `h ؓ*`  €  H  . > `h ؐ *` €0. 㿘  0H /e * &  .  .  . H 0㿘㿘> :@<bx   ` @@  " 㿈>!p` &`0>b`P>b`p`Ēh&h&h&h&`> ,`* "* ` 0`& & &`l > &`?&` # ,   *   > :"đ ` "!>   >  >P!>P"b!T""! " !> #  zɑ* #&``*&` &`&`&`&`&` P 2` & X`  @ o#0` @ H /k * ,  H 0@  1`. 1 ! H /k * , @ H 0> ǑH /k * , @Ւ H 00O!`&`@> "bP> :@ܒb  > :@eb 2`@ &`@`@ڐ`D`  '> :"`D> #`8> :"`8`> :`D"`D> #`a '> 9#*` 2"> c|> :'"'􀤠>  @>KC &`h㿘 l$ > : # c > :# ë 0H o+*@l@B `4 `3 ` `5`@ ``,`3,`5 ,`4(р   & & $`@꾐(& & (В  .(.(,`L(А   (А `.(@K@ْ H 0(Ӏ .(@@H/` / ?& D& 4@_ #nk#? @ `  <  7#?nT#? @ `  <  "! 8 2& D@* #n6#? @ `  D? ?> :#8H 0㿘H/` / l @ @  *@mH 0㿘H /k4 * , ( ? & @ (*((Ȓ`@&((&(̖*@ H 0 @ 㿘 lH /e * & (Ӏ 3 /H /k * ,  .( 1 2   , 1, !-  c   (Ȑ  & & (& H 0H 0 l `G `H*`F (ր" `F `I*`F `F `? "߆ *`?㿘 l J`` 5 * *5@  (р   & & "@a 㿘 l K(Ѐ  58 %  @ % @ *5*% % 㿘 ``` 栒 ߐ p ̒ 0,,  :`淐 ?$`$` hЀ  ,h. L hЀ  ` hА`,h   hА`,h 1   . 1|. !㿘 @  & @ $ $      (Ȑ  $ $ ($  1  . 1. !R  (р ,(ѐ ,(. L㿘 Xa `2 F D F@ . D E  `@ . E$`$` ,h. L㿐H /k4 * , &  & & H 0  > :#x> :#`2> :> :#x##\> :cH  㿐 >   l"@    `& ` & > !ē*"@  p*`1  `p  ` `@   `& ` & > !ē*"@  p*``@@`v  h@: 2 6& H /k * ,  % &    (Ѐ  (А `.( 1  - 1- !(Ѐ (А `.(H 0 lH( `E `D*`EH  `H  *(0*(Ӂ㿘 H /e * & (Հ .(H(Ԁ .(ǐ(Ҁ .(H 0`> !Ȅ ȅH l H  "@"  "@"㿀 ?> :#  ` @&`$ &` R'`$䀢 `48 " 028  8?@4@1?2- `4 ' `4` > `@ ''>h''{ " `$ "0`$0"`4&`$`$"4"D`( &`(  '㿘" > :J# / $ +#> :!> ; 82 0` D2 0``  0%c  " 0    ۀ㿘" > ;  ) $ % 0" 0 8@2" 0 D2 0`" 4 4"`4 4 0"@   ߀㿘`"  > ; : *` @  H2 _ > ;[ p 㿘`  "@ @`㿘 $ & 0 & , L@  " 0 2 L 㿘 $   L@  0 2 L㿘 $ & 0  & , L@  0 2 L㿘 $   L@  0 2 L㿘 P` 2`  8 4 $  T$=@= 09` (*`> ;M > ;x * @ > ;@9!`@ P 8  $ 8 P 8  $ 8 T @ P 8  8 $㿘 T ;` " P \2` @ @ P  8 8 $  P? X"`8 : $ 8  T @" P \2` "@  P  8 8 $ P 8 $  8`  P  4 8 $ 2/ i|# !$ P'  T`> !Ē`& T> ;0: T ߘ @?`2?` h& T>’`#> !ĕ2`@ !:`?㿘 ( "H /f * '  T  ? P& T`4 $ 8 L@  PH 0㿘 P T`/ 2, 4 8  $ P`4  $ 8 2  d 2 ` & d ` d  & ` L& ` @4 ?? ?㿘 T !!< P  8 $  8% h!`chܐ#``c   P 4 8 $ H   T $ P 8  8 $㿘 T  ?& T h㿘 L@㿘 P `0@ ` `,@`!@!`<@ $`0 & `,& H /f * ' H 0㿘 P , ` `   n 0 [@" d, [  d@$ d 㿘 T   P H*``" X  X( H*``# N  X'  H* `#  A  X) H*``& 6  X#  H* `&  )  X%  H*``(   \<@F@   T H *`& d& T`+    \ T H + *`@& d& T   \  T @& T& da$ H *``0  \  T`@& T& d!$ H0*`@  Ֆ  X  H*``  ˖ 㿘 HԠ P`  -㿘 T  h `"   (8 : @2` `2`  `2@   (""4# # & 0&  0 ! A !㿘 P  $`,$`0 P `4 $ 8` P`4  $ 8 " P`, $`, P  4 8 $"`0$`,o `0 $`0d 2 P`0`   4 8 $ P`4  $ 8  T @  \@  P 4 8 $ P`4  8 $  "`0 !`0  `0 `0  @`0 `0 @ $`0 `0  $`0`0` a$`0$`0㿘> ;*aL   㿘> ;aL > ;   (> ;&`H@&`L&`8&`P &`T&`d€`P  4`8`$? b &`XH㿘 ( `S "`"6`0C<0>` H2  9 0= H2    P 4  8 $ P$`8  8 $0*` T`   P 4 8 $ P%b`8  $ 8K0 H2   3? 0   㿘 P  $`,$`0 P `4 $ 8` P`4  $ 8 " P`, $`, P  4 8 $"`0$`,S `0 $`0H 2 P`0D   4 8 $ .  P 4 8 $ P`4  8 $ "!`0) `0    @`0 `0 @$`0 `0   P  4 8 $ @`0  $`0㿘ڐ P  4 8 $ P`4  8 $?b  P: 8 8  $㿘> ;a   㿘> ;a > ; x  (> ;&`H&`8&`L&`P&`T@`P  4`8`$? b &`X㿘 ( `G "`"*`07002` H2  - 01 H2    P 4  8 $ P$`8  8 $0` T`-0 H2   ? 0 x ~ 㿘 P  $`,$`0 P `4 $ 8` P`4  8 $ P  4 8 $ " P`, $`, P  4 8 $"`0$`, `0 $`0  `0 `0   $`0`0 $`0|㿘> ;b$   㿘> ; b$ > ; X  (> ;&`H&`8&`L&`P&`T@`P  4`8`$? b &`X6㿘 ( `G "`"*`07002` H2  - 01 H2    P 4  8 $ P$`8  8 $0` T`E0 H2   -? 0   㿘 P  $`,$`0 P `4 $ 8` P`4  $ 8 " P`, $`, P  4 8 $"`0$`,? `0 $`04 2 P`00   4 8 $ P`4  8 $ ?`*`>Ɛ! €`0 `0 `0 `0 @ $`0`0 `0 $`0㿘 P  8  8 $㿘> ;b   㿘 : *  2> ;"p&`L * :  $ > ; > ;"|&`Lb > ; {  (&`H&`P&`8`L&`T@`P  4`8`$? b &`X#㿘 ( `G "`"*`07002` H2  - 01 H2    P 4  8 $ P$`8  8 $0` T`20 H2   ? 0 }  㿘 P  $`,$`0 P `4` $ 8" P`, $`, P  4 8 $"`0$`,- `0 $`0"  P 4 8 $ P`4  8 $ `0 `0  $`0`0  $`0㿘 P  8 4 $ ? 8  8 $㿘> ;c   㿘> ;c > ; 8  (> ;&`H&`8&`L&`P`&`T€`P  4`8`$? b &`X<㿘`" 0)#0$  H2  0"  H2  ` T`_0 H2  G?0 0 㿘> ;c\   㿘> ;c\ > ; (  (> ;&`HP&`8&`L&`P`&`T€`P  4`8`$? b &`X͐㿘 ( `G "`"*`07002` H2  - 01 H2    P 4  8 $ P$`8  8 $0` T`ܐ0 H2   Đ? 0 ' -2 㿘 P  $`,$`0 P `4 $ 8` P`4  $ 8 " P`, $`, P  4 8 $"`0$`,% `0 $`0 2 P`0   4 8 $d`0  h$`0`0 $`0 㿘 > ; `b# > ; : *`@ 2X# (> ;&`H&`8&`L&`P`&`T€`P  4`8`$ ! &`X`P  4`8`$&`\`X?"@ <`\@> < +`0㿘 ( `G "`"*`07002` H2  - 01 H2    P 4  8 $ P$`8  8 $0` T`0 H2   ? 0 D JO 㿘> <F`4   㿘> <:`4 > < x  > < c:`&`< ((&`H &`L&`8&`P&`d&`T@`P  4`8`$? b &`X`㿘 ( `G "`"*`07002` H2  - 01 H2    P 4  8 $ P$`8  8 $0` T`o0 H2   W? 0  Œ 㿘 P  $`,$`0 P `4 $ 8` P`4  $ 8 " P`, $`, P  4 8 $"`0$`,% `0 $`0 2 P`0   4 8 $``0  `$`0`0 $`0㿘, < =  P 4 8 $ P `8* 2  $  8 P  4 8 $ P `8* 2  $  8 P  4 8 $ P `8* 2  $  8 P  4 8 $*  P2 8  8  $<<4>4>P?h?h>>?P?l?h?h?X?l?`D|DD|D|D㿐>    "> !> <#a#\    㿘H /d * %  `%> < ! `4    2   @?> !# ` @  ?4 & H 0 ?# @4   @> <D!H 0㿘> #d` > <a@ > !#n   ` 4 ?# @4 90  `@ p&@’ b h %/#\#d#`  @  " * *` *   * *` *  &? @> <ސ!Ȱ?㿀 @2 @  ##\#d/#`  @P 㿀@o  /@j :` @ܔ ` @ؔ `  @Ԕ  `$@Д  c $/#\#d#`  $@$ 㿀 @2 @? c /#\/#d#`   @  㿀@(  /`//!0 ##\#d#`   @ 㿀@ @   // / \h#\#d/#` @Κ x@@ ?# Z//逧/\h7 /#\#d/#` @      ( (     㿐\&` dh'`  ?@`2$@ 2$ " %  " #\     &% " #\  "Y*   Q  $& *  A 2@  %   '`    *  *`  $@`(   *  *  '`    *  *`  $@` * *   *   ?@ 㿀@  / //#\#d.#` @ښ x,  @  U4 ///#\#d/..#` @ 㿘> #d` > <b@}    @0= +07@2 0@ "    & 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @ `@ *㿘 & , $ & (`& . X> <?"  2 > <8"8``"D ``> <0?, <> <  -> <"XH /d4 * %    #> < b -  ` H 0"? 0  ?@U?" & ,"㿘`d`> <ސ" `Y Yy$` \$`$`$` $`$$`$`$`0  , `  * @*` p? H /d * % H 0㿘 ,`**`>ː! €* @Z?" $  @     ??&  & , ?& ?  ?  @  ,> <# 㿘    .`  #   "@*`" * [* ? !> 1> <# #0 h  ?㿘 ` 4@?m @ ?  `   U >ː"* € ( $@"K$ (J  @N   A  `  :0: ` "+4 3 /0"?# @4'  !, !  ` )`?# @4    l  ?    @㿘   > <#H > < #8 ?㿘 4 4  ``q> T> T"" > T @!В ) ``  |  > T *`* @ @ "0p@q> T"8  `` > T"P ` > T"`  ,  @> T"x ,  "> T> T"> T"   * *`  *  "  "> T> T""> TԐ"  ,   * *`  *  > T" @@ > T# `> T#  @ @ > T#8㿘> !@Q  ` *     ``a0"O a> !l* a@V a a M  p @> = \> = \> T^(> TPY > TT > = \  `    @ `D`` > T{ Ea A "@a`;>ː"@*` € @> T#h> T#p*> TP3 a\ # !a > T"@ O a*> T2aF a @ٔ  a*> T2a7 aG G8GGGGG\㿘  eA!@!H /d * % > "`` &" "`& H 0 㿘H /d * % ` "` "H 0 f’ H4> "(> "  @2H㿘> #d`> U`@  0`< > U 0HҐ 2!1 > Uy 0= , [ X, Z ,`,*`>ѐ  € ( $" $ $), [ , Y X 4Vx (  , [ , Y X 4Vo ( , [ > UN!   , [  , [  ,> U@!8 , [&㿈  > U1!p[ ` < @ aܐ> U$!N  2 H  ( `̐> U!> `2(`` ` #d#\#` ` H "H /d * %  0" #> U aȖ x  0b H 00 0& 4(& 0H /d * % &H 0㿈! 4! "A! @ 0!" 9  !"/ !),  ! !0!> T!  & & &  2 & & & & # `     `@ !"n !r !I> U{! ! `0!q> USUV `& #&  &&&   &>&  &&>  ` #hݚ &L&4&8&P&Dې<U$ `>07 ?# @4  4   4   @4 !   4  @'В"#\#d#`    f  !GUUUUUUUUUVV8V8V8VV V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V,㿘`> U"  㿘> !`2`> "!`.&`0 2`0 6`06`8 $`2`8 *$`8> U"`8 * b֔  &`4> U" `8 6`!> U  bƐ `4."@ `4 ܐ"P@ `8 `?@i?㿘P㿘* " 8 @6 4 4.`@ " 8dQ  8`@& 4 4dI  㿘` @2 `  "@@"@ `㿘?> a   aГ.  @  a @P> "'  >   6] Б. @ 2 0U  `  `&J `@6F  `$ &;  `$5   4.`@  @4'  @`@` :` .` 4  2` @& 2@@  > U"x9 @ " "  " "` @ " " """    􀠠"A @  \    @"*   @2 @  *   *  \_ \* @ 00* @ 800* @ 0*  @Ò`*> "'`> W!h      ` `@2  `  > W> W > W > W> W !> W !p> WN!L!> W!a`3 `.>Ӑ!,` €> W(!> W%!> W""> W"> W" > W"(> W"0> W"8> W"@> W "H> W "X> W"p> W"> W"Ȑ    h    #\#`#d> W"> W"#h> W#l"~ > W# 㿈4.@.`а  ` `  20ǰ  `Rt> a  > !> $  4  4 4 , b8   b8 `@"```` 0  > b8RE :> U! :@ `> a:  > U ( > Ub8@ : > U # bb8@vb8     ? # @4   ? # @4   ? # @4 쀢 b8  4 ` %`,, Q :``  4 >Ӧ #''  Ē> WȐ#*. (4`. $  ! 4  4 4. "@ ! ͐>ՐQ0a 㿘 2 '5 `@2-`2)@`` @ʔ 2` @â `  @ 2`@@` @  @@'в@pL 㿐> WcL  㿘> &`` ",$``$` 4` > "(`0`&`&`\@=K`" > W `2> W`А &`> W# 㿘H /d * %   $'> )>  0 $ $ $0"4h"0! $2$H 0  @*`> >פ!ТbL@@ 6K @ `  > >פ!ТaD@  65   `0H 㿘? 2  @ 2` `?> Ȑ"  0~   v  ` 9D[ !!    ! "I ,  ! 2@ ``4`@  ?`# @4`0  Ȑ ̒@  `6" ,@ `"      *@$  *@$    $ ``4`   !`?# @4`:f㿘?2  @> "2`:   0>  M05"      **@$  **@$    $  Ԓ a!@ #?c 2 `!   o  Ԓb 2 㿘 D'? @2  `@> "2` 2`Ԑ =& 4 `2`Ȑ 6& 4 <(@<  -& 4 ". < D   `А `̖@ @< $ #d` > Wc@   + `?# @5 p0 `$  $"`$ `2   0 ( <$ 0$ 4$ @ n ( T@4  D ` " <*  @  <?@ b" @?,@ @̒  0  4`4`///// @  0 * (44`4`4`///////  0!0#\#` 0 0( #d < Hm     > W#ג  2t 㿘  0`  `0`< `@ 0u" 㿘 D? @2  `@> "ғ2`  Ѐ "    ( <*`" 4& < `ې㿘>>ٔ!`!Ț bU㿘>>ٔ!`!Ț bI 㿘? .!!@].@!@@V K.@ K. *  ( ` * (   ?jP> b? @ 2  `@> '"2`n `    ` Z ! @"Mc@c@Cc@c @=.!,c# @"58" p ! `q@") !@"# # # @`m @0 @" !@ 0!@2@2    @",Qc@)c@c @!@O `a c @c@ `X c@"7 c@5c@ `J c@" c@" +c@c@ `7 c@" `p@`s@q `(  #@2 #@ "# e e@ "e  r @ ` @Y #@ ` @ "|# @h `  `m@T`q@ΐ `  e`g@`f@D  h@"8  #@m `݀  !@ `ր 0#@"j 0#@0#@ `ŀ 0 @2@ `  Ȑ ̒@˘ 0 ȐM8!0 `& ȓ*`` & 0   Д$  Ȕ @9  а $ 0@W @@K #\@~@; x@s ,B@ eÑ*   8KY   @( O  d ?# @ `*`2 @7L 0<  Z#$@P#$#\ - @  '```"@` !?#?*`@  &@  `$@   * 2` 2`*`  d ?@# @ `*`2 @6@@?8K'@ ߰   Z#$@#$   @ @ , `$`?# ` * 2` 2  d ?@# @ `*`2 @6@@  ` 8`&\ 0 @i@ @͔     @V     @M |    @D s    @< k    @3 b@ ^@ Y F T Ԓ @ N Ԓ : HV  "@ !<2   7 Ԓ  1  @ ) 0&2?#ϒ @ 2@Ð@@7@    Ԓ > Wv#؁㿘@ !@ "  Y#$@#$`ؒ d &8&,&(&0@&`ܐ &4` b> Wc@  > Wc@  6> X` @` !W!,  &&6H6J&<&X&&Ȑ<6 &6&.@  "   "   @  `[  `?2  @?`6 # @ `* * >ؐa`@7Ip(" & & h2; ܠ @ b h %/#\#d#`  O  2% * *` *  aa(& * *` *    c8& "&  ܁㿀'  X  2`5  #`#h#\#d    "  * *` * *`  `Ԗ"   `Ԗ"  Zk 㿀'  X  2 #  #` #d#\#h E  " `  .@ .` .` .`Z>  x'  Xw  2`_  #`#\#d#h N  쀢 "  I  /  / / `Ԗ/#`#h#\#d  쀢 "  *@ * ` @* ` * ` @*耢  `Ԗ"   `Ԗ"  cYҒ x @o Ô@ /#\//#`#d   8 㿀` b'C   W  2`:  #`#h#\#d    "  # ` *`  * `   `Ԗ"  " `Ԗ"  Yo x @  Ô@6`6`6` E6////#\///#`#d   ͚ 㿐C @@   W#$@#$@  0  4 @ &.  `  `  J  ? `  ;  .` #\ `@Y x\ @   G/#\//////#`#d   h x @ Ԓ K'/#\/#`#d   S 㿈'В"#d#\#` Ԓ    D x@d  B`/ / 7` @( //#\#d///#` " x@B @? C`/ / c7 )/#\#d///#`  㿘   ך 2`` "   +   Ś 㿘q   ? X> "'@ Ȓ @@` >֐#\*` € a0  (//#\#d/#`     ϰ 2 .`` ԓ*``0  (///#\#d#`    ˰ `I ` ԓ*``0  (///#\#d#`  r   `-``* ԛ2`!0 2`2` ////#\(///#d#`  O   ̒`2 2  2  .` .` .`͔ G˰ }` ԓ*``0  (///#\#d#`  '  d ϰ _.`` *    ///ɒ/`G  a0#\#d#`    A $ ` *    ///ɒ/`G~  a0#\#d#`     .@  .@ ` ԓ*``?0 //#\#`#d  Ț      > XD > "'@֒  T@Ґ@`a0 Ԕ  T(///#\#d//#`  T핚  M` @ ?**  * +`*`+ @ 4 +(( ` @4 2 2`  4@5` `   .........& &&.  b > Xɐ h%> '@\ ؒ @X` Ԓa0@  (///#\#d//#`    ܰ .`.` > X 8x( Tʔ * @$( @ ` ԓ*`0@ ( (////#\/#d#` (  ``Fg(VZ 㾰> "'@   @ @a0  (///#\#d/#`  촚   !*  &` `F1$  > X% Px( TZ / @( @ a0@  ((//#\#d//#` u   @ `*&``E` U 㿘@` >֐#*` €B q 㿐> X`d  㿘> &`0bd > X"2  "@x?> P2 `  6x P. @ 2 0p ` l  2` 0 雔 2^ 0 H  @ "@ `> !@^ > X \ G 0@     @"40 8 L  > X x> X  T > X> X x  H#\ H`2> X> X x #` P#d P`2> X> X x #h> X L  T 8 $ 4? c 2 ? 0> P* @?0` 2`㿘? 2`> P * cF  #D #H  ^  #H"Q#F"?8#D"+8H0 #E"(HA0 #A #C40 #B"-0@0 ,@~ (@ $4"  "?@$8   44" "H"L"P" T "@ƒx@ 4M `4I +  H`?@4A * ` ?@ X8  @ :  81   `` ` @@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d   껚 x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ `  `` `@ @  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d   J x@ * 0  H `  '  :` @W  4, `4  +24 ////쀋 / / 0ab#\#`#d    㿘H.`  S   QȐ$8 @I$ ;` ` ` *  E So   Q@0 "` ` `*  > X G  Q` -@ `@B`S= `S8 x @Ր 0a6`67  7 (////#\///#d/#` 锚 㿀  QR  20z  #`#\#d#h    "  > XA!(    *  $8  *$H  *  $<  +`@$L  ($@ * $P  ($D  (0$T#`#d#\#h`   > X!XR 0X@N \@J     ,@ , $ 0 R2 㿐> bt& d   `& d㿐> Xa  Ϙ㿐> &`Ԑ"$`$``> `0b&`\&``@.q`" " ``!4` ` 2`` 4``" > X `2> X`А &`> X0"(!> ! `Q!歒  ! @`ؠ`> X "0  > X" @@> X"8#\0> X"x0i(> >"XX j% &ad> X" 㿘H /d * %   $)> +>  0 $ $ $0"4h"0 $2$H 0  !@*`> >"bL!@`' !@ ` 6!d> >"aD``& ` 0!d`> iݐ"X  㿘? 2  @ 2` `?> "  0  n }  ` ?J^  4`!!w !!ђ  "J 0 `  委! 2> `, 4`@ ؀ 2  `?# @4`,  ̒@  `6 ,@ `" "      *@$  *@$    $    ` ]!`?# @4`#㿘?2  @> "2`   0H ڤ  0?"      **@$  **@$    #$  Ѐ @K  `   !@ #?c 2 `!   "  Ԓb 2̐ 㿘 D!? @2  `@> "2` 2`Ԑ A& 4  2  <  8& 4 5& 4 "6 <`@(  *& 4 D   `В ` `Ȗ@ @-`̀ $ #d` > Xb@p  `?# @5 v"0 `$  $"`$ `2   0 ( <$ 0$ 4$ @x ( T@ϓ4  D ` " <*  @  <?@ b# @?,@ @~  0@  4`4`///// @k  0@ * (44`4`4`/////// L 0 0  0 А & :"`#\#` 0 ( #d < H    6 > X"  2j 㿘   Ѐ @ ?#  0   0 <  @ 0" 㿘 D? @2  `@> "t2`  Ѐ "    ( <*`" 4& < `}㿘>>"#@ R㿘>>"#@ R 㽐> b? @ 2  `@> '"2`4 `    ` .  !@"! !@"8  p !   q@ " m@  0!@2      `m@"e e@ ";  `p@`s@$0 r@& !@0 !@"vV `q@i  h@0 e`g@{`f@ x0 Ȑ ̒@ 0{@ 0t>!0p Ȓ `& ȓ*`` h&T 0 a Д$  Ȕ @+v ̰ 2  e g@2 ? @2  `@?`4`# @ `* * > Ȓb@+ ̰ А m$ 05"4   А -$ А ?*$   ⹒@ " "  !22 @"   qd > Xz7#P> "'@ʒ!@ǒ"`&(`&0`&,`@&4 &8 d&8 6` `%  2 > X> Xc@L `Ԓc(@F `Ԡ`-@g `Ԥ @a`5> X8   @@=` &<` aW 6J6H&6&&&&&X&.i? 2`  ?6  +  *6 >b@*  > Xy#@㿘 Ѐ @1 x@B  @> 6`6`6`  //////#\#d/#`   㿘  4  ` 4 ? 8(?   2#?  (? " ?   ?U    ˒  "?㿘?2  @> "M4   /? `*@2 `Ԑ  2?` `, `Ȑ `"(? ?2`   ! 2?;㿈'>  ? 2` >  "2  #b $ "*@ (@\ R @.` @9.     @ > ? = "t7@ @p 6` *6`6`6///////@a   @&  #  & & & & & ?7& (& & ,?0& 0& $@€  $  _(*``  @*h ԒY&` Զ   h' 7ހ  J   %   26   #d#\#` #h  E 쀢 ? `  ` `*` `(@ `,  &` u  *`@ n' ""'  #\#`#d #h    耣 "# ? 2 Ԕ   *  *`@ @ * 7ސ> ?>@`6'  #\#`#d #h ۘ 䀣`& @ ? ! ` `*` `*  ` @ 7޺ `'  ` ` `*  '`  >Q>O&`K ` $ 2&`  ""&` ` @" d" b h@"  @@@   &@ @&@ &` &`ޒ .&`&``2 &``> @@J`&` x @  "`!@  aba 5/#\#d#`   ֚  > X#PD 0 А @& ЁLLxxxxxxxxxLLLL40`xƨČļt(Ŝ  Ӹ ӸӸӸӸ ӸӸӸӸ 㿐> Zb4  m㿘> &`H"$ $ @J> Z"H`T `> Z"X> Z!> Z"P5>   <  > Z@` "`d> Z֐"``> Zѐ"```"> Z> Zʐ"`0Ɛ"`0 "> Z> Z"Ȓ"> Z"`&`&`&` ?# @4 㿐> Xc  H  `& T`& h`@& 4㿘 T  l  @D @ ,@ h@`" $ @ ,@   , @ ,@   㿘? 2 > "  2 G "ܑ*@`2`H0?  4    6   v  $ 4% `@`2`0 @֔ `0(`@S$`@`  `0  $`0 @Ô ?# @4㿘?2  > bܑ6 *  0 a`  @h   " H     H @  H  `2  H @  H @  H? c 2  㿘? 2 >  bܑ2 *   0@ 4` Hh `g `@,`$ 0*  l@,` h $ 4 @i U ߔ  4`"@r I"@\ @@ ; @  *  t, < g, < 0 ?$ 0   @J  0*  p@$ 8$ 0@ > Z !@ 0 h$ 0 4"h 㿐 0( H @ @ @. @ ݾ!@` @ @ 0? 7& 0  @ 4 H" L0`"0"" <P2 <0"82>ԇ(0`"0""8""8`"04 `20`0"0`"80"8"0 < 4 0&000"0 㿘 D? 2`  > 2 ܑ*  <B@ 0 " L 8@g > Z 8 Ȑ#  &  P P    P> Z #0 & 4H /d * % & $ `( $& (`("@#"`(H 00 0(& 0 <& @H /d * %  FH 0㿀> #d` H> Zc`@А ` ?## `  4`n~0 Ā  $` ("`(&  (" 0h"`` `` @4` 0$ 4 <$ 0 $ @n` 4`"" 0 0@  @+ " 0 0 <h$ 0$ @$ 4T`  0$ 4 < 7$ 0$ @ 0   0$ 4 <($ 0$ @ 0 & 0:` @  0@  0 > /& 0% /( 0   / 8@Y <2  <2 2 ///# #\#d#` < H k > Z#hْ ` 2j`㿘? 2`  > ܑ2 * @H>`!8 K㿘? 2`  > ܑ2 * @H>`!8 Kh 㿐? 2  > bܑ2 *  @ !4` 8 <  ` aa 0 !7  @X @% 8 6 8& <& p& |& &  &$ t&( &, &0 &4 0`" 0 6 0(" D 6 D6 F64 F4 DV`o> *` €@   @ &@  @   @   @   0 @  @ } @ u Д  0*@9$ 0 0 4$ 0@ b`2 L 0 ?`@  P  @ S  P@$ 0M  0 $ 0 0$ 8 $ 0`B  , <  <  H6@ג > Z" , <$ 8 0 %$ 0 0 ?!$ 0   V   ,`0,` 8*  p"@    <* * t  * 㿀2 @1  0 `/ 8 `/@֐: 22///66/// Hc #\#d#` ޚ x`H  % @ a0h /#\#d#`     * *` *  $`P$`Lp`H ' Dk  ` /  #\#`#d#h ఒ F 0 "   `0 ?$`0 <`X$``$`d E4xH ' D/     D'  24Eޒ   " EӒ EВ  @o @l 0 <`/82 2 ///`  #`#d#h#\  ڡ l耢` 2    $` 5 *  *    "`5쀢 2%00  ,@ ,` ,`,`,`,`H,` ,` !0,`,`  ,`& 2@,@,` ,` ,`,` ,` ,`H,`,`!0,` ,`  ,` ,`E@ E= 㿀@ڒ  `/ 6/b /c  H #\#d#`  ۜ 㿀"# 0 8`0B 0"0>`4 =9`     " 0I 0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0"  ?& 0` @r H66`6` ///#\//#d#`   7  㿀`( `  0!"! ?& 0 0 =ϐ =& 0 @A H6`6` ///#\/#d#`    㿘 0 %$"  %  & &` 2  N x`  ٖ 2" 4  `2 @  @ H6 /#\/#d#`   ڹ x   0 =& 0@Β  /`/!06"#\ H#d#`   ړ 㿘 4 4    `   0  ` > `-` €    * *`  *    $ 0 "L $ 86o& (  @ ` 0 $ 0 ($`@  ` 0 $ 0 ($`@   ` 0 $ 0 ($`@ "  4  2 4> Z#x  4 "  (  2 ( 8>$ 8 ( $@ ;` 0 2R  3`2J$`@K & (  @2F  `A ;`<     6 > Z"#s /  `   `> Z#Ȓ f" & ($`@`2? 4 "  0  2 0 8>$ 8&2 ?"$ 0 $`& ($`@ ?㿘$ A  6  '$$`8(`82`0`0    ?$`09    C 0 2`8C   㿐> [c  _㿘> &`4cT "2 "> \ a@.  2@ d> \ a@!  2@p d@ d$  `&`&`<.`N.`O.`L&`86`@6`B&`D&`H.`M&`&`㿐> Zc  @ > \`&  $ 2&  > \ `!. ^@ 0  !!> #@J ,# . ^& ԁ㿘?2 >  #@  2 6' #@*@`2`4    > \"t`  !!֒  ? # @4    4 㿘?2  > c@6 *   쀢`" 0@   0$ P ?$ 0 4? c 2  㿘 D? 2`  > @2 * @ 4` 䀢€㿀? 2`  > 2 @* @`0 #>`܀`@ "`00 @ #  //#\#`#d`4   ؁ `0 $`0>>!0# E㿘 D? 2`  > @2 * @ < P 8& < < "& @H /d * % & $ ``( $& (`( "@"`(H 00H /d * % hH 0x 4` C?a#b`  4`g06 3 $` ("`(&  (" 耢€` @*  (/ <(2`2`///#d#\#` < H  > \"(^ ` 2`㿘? 2`  > @2 * @# : #( 5  # # *  ` 8@ ( 81? (0# ؀€ @0 쀢` -@  0 ? $ 0  -   4I(> " 4'@  $ 0///@/ ` `2`// (// 2 2 2 2 2 Գ2`55`22222`2`////////////////////`   "` / `   8 ` " ` / ` @  " `/ i4/ɀ g // %/ " / /  a  ' `" ` * * @* @ ' $" 2`//   (c#\#d#` ɚ > " > \lI"8㿈0  4 "0c#\#d#`  4֬ 㿈 4 *0` h" @ i g  2 2  *1 2*2#\#d #`  8օ h 4@ a" 4( /#\#d//#`ؘ l > \"(ڒ + *` `< +    &`<㿘> \ . ^"H`> \ bP@ 2` > \. ^"``> \ b@ >  > \. ^"> dd& & &  & & & & @& 㿘 0 " ` @N "`  @`$&`  @@$@&` @`$&@@ $@ [&` #؀@U`S!@8Y `!,  @* 2 $` 6`!,  @ǐ* 2 $`* 2 "U06` *`2 26 ` @ϐ?$? H!.`` @Ő?$? .`` @$? P .``   i4  g6 ^   ^.`& 8/# (@t 㿘 \1 X`<2 @z$&`<P 4@aؐ@   //ܐ@  D @/Ȣ H@  8@ @ <@ c4`4 42 ///#\#d//В///#`  L  2 @l  / /@c/ @ a,/ @ /@; d / M @? N/@ / O @r/㈐? p//#\#d/#`    2B@.  @  /,/Đ / L " h" i g   # @ H PĐ X/##\#`#d   ֚  2  <@X   㿀 P  4@ # /#\/#`#d   Ա   㿀 4@̒  \  X0/`<2 @`H #44(//#\#d/#` ԉ  > \" 0 T"& T`< P" & P x 4@   #//)>'> \(#d#\#`  _  2:耢 ` > !Ē !bY (#* *` * T@  > \#0D P  0> P> \#8 0 `  㿘 L "  i   6 \4 @ g 6 \ @0 8@^$ \ & X` ?` ?& X B0  <@N$ \& T0 X2 0& P㿘> \ . ^^#h`> \ cp@  2` > \. ^P#x`> \ c@  2` > \. ^B#`> \ c@  2` > \. ^4#`> \ c@w  2` > \. ^&#`> \ c@i  2` > \. ^#`> \ c@[  2` > \. ^ #`> ] `@M  2` > ]. ^ `> ] ` @?  2` > ]. ^ (`> ] `@@1  2` > ]. ^ H`> ] ``@#  2` > ]. ^Ґ h`> ] `@  2` > ]. ^Đ `> ] `@  >  > ]. ^ > ##&  &   &  &  &  &  &  @& > ] 0 @:  > ]> ] 0 㿘@(`  @ #؀@8< ``@ !@82 `?* 2 !,8+ ` c !8% `   " ^  ^.`& 8,s (@ > ]  @ > ] !Β 㿘@ > ] @ڒ > ]!!> @x##@8 > ] !8`㿀 4@Β `<a`H22" /(//#\ /#d#` Ғ  > ]!X 0 `< P@ "& P& P 㿀@  4a66 ///#\#d/#` g 㿀 @ 4a66 ///#\#d/#` L >  H  8p <0 D> ] @bh' B2#d#\#`3 3`ߒ  L "> ]  " 0 " 0> ]6 \ a6 \a > ]6 \a@ 0> ]6 \aȐ@ @Ȑ M N > ] \"@ؘ?@  x > ]gx!x`8> `<`  `L ' ? $`8 $`<    !> @##!> @##F  > ?cؠ  T 5> @ d : ?А  1> J+  @ *`В@  `L $`X+ $`X@O## >  c!  > cy`*@ޒ d 2 > cm` ?А  J,  @*`В@ `\$`T-i`X2 -f$`P  > ]fא" 㿘> &`0c > ]"2 ""> ]"`㿘?> ԑ2 `  6 ԑ. @`2`0  2> ] 2 "` ? 0> Ԑ* @?0` 2`㿘? @2  `> ԕ* 0Ԭ  4 |8> b '"V    `    `I  2F   2A   2< ' 7/   `5)/`: :/  ???????ؒ   @H7> a (( c#\#d#` Й  > ]   b@ @? " > ]f"㿘`&`0`4"`  / > ]#&`\&``@d  > ]#ݒ0-`` >bH  > ]ΐ#@`d&`l&``9ؒ ``` @ ` `d`Hr``@``"`\@&09 &`\㿘  4/  ``$ \Hא ` 6 \  d  P`" P `  ` \  49  4  / /  07  ?> ?> + ! b@  <' '//'/( (# 0a0#\#d#`  @  2      7& X & \    @ @ * * 7& `  & d \9< & `& \  ` *`  @~K*@  d %> ]$ X \ @$ \$  Kh`@  ` @  '> ]$ X \ @@$ \$  3p`@  ``  $ X \ $ \$ > ] cx@  `  $ X \ $ \$ > ] c@  ``   2 & l& h@ & p '> ]$ X \ @@$ \$  `@  `  \ `@@ & t  d  @r  ``@  `  > ]d#x 4  .  ?7 Z?* * * 2  > ǒ @ a #8*` € \       P` ]  P   E  \ "   "  P `C L `I!"  PD ` 8  <$ L2  P     \    * `" P& `      $ P< @$ L \    `     $ L< @ \ @@% h< @ ``@y,` t  l@@     p:` " L" L l`@` - 㿘  @0(@(b2*@ *@ b 2`* @ *`B2*@ *` ? ?@0( ( @ @}h  3`0 @ < D L D T T T t          h> " &`0'"``4` - `0Ȓ`-Ӭ > ]c@: ! 2&`X &`X> ]##@r > ]#`:b`d #>bF' > ]` #`d`" `d`d `` d"`d&`h d `"7 `d 2`d0 `d " `dE ` `d b`\6 &`\b > ^b 㿘  4,ޔ  d`" \F d`"  \`P "`P```2`P \  46˒  4  , ,  㿀( 4  i  (@{̐'   ///7>  ?*`'' ( (# 0+#\#d#` (   > @9  * @h2 @      @ `  @*`` & ` 4  & \@= 6V  6R  \6O  㿀'   ///7 b?* * * > ǒ !2  @''`( (# `+ 0 #\ \#d#`̡ @ 㻘'Lѐ 2  @{-$& d d& h \L c`  ` VL   ` @  "G @ "> ^  > ^<  > ^8  0  8  @  h 4   "C d< X< << < < < (< 0< 8< @< H< P< ` , X$ $ \ @ + @   `'@ } $ ` h `$ d h"& h &`L``  `` d"`d& h d `"5  d 2 d 㿘 4  +A   + 0A d 6 \ @ ?`>"*` €    $ L X "     @  `@! `@U ` ` 2 \ +D > ^}4 H`\ 2 :`@ X"`\00`\+>(( "   5A j>(      5A ja :`@㿘`\ G?7`/ /`f6..`0((F6..70 @>`@㿘`"!@> ^ |Đ x!@> ^|  㿘``@{  > ^@{ "   > #L `$&`48@ P "8, 2  80 @W &  > ^&`D @z`p 2#> > ^`@S> ^@zݒ` > ^@zג` 2 `D`D* "`D "'" > a   @ " > ^`@7??&`P&`P`P &`P> ^|I `D<@ @ %&`L `> ^@"> ^,> ^(@ > ^$@"> ^!> ^,@"> ^> ^|$ > ^|  > ^> ^| > ^| > ^|  > ^|!> ^`L| !> ^|!@V I> ^ 28`08 > ^@zX`  > ^8@zR`h 8@zMp 2'8 ''@ڐ %> ^#> @ѭ@r  " 'acH @ɐ  0> ^@z!`h  > ^`@!( &`<"#l > H>>>>h"h"t>>>>!a "|"l"p"x㿘 D@$"! D@耊d! ?&  Dd ?   > ^ D@!0> ^aP{o!Y> ^{l! D |` " D L!,@2 D"@ D"&x  D  "&q D  L@ `2 L L(@" P@" P D,@2 D P` *`2  D `   D," L@ 2& H D" & & H㿘~ 㿘``@yi 2 @ 㿘i  D  D 㿘 D@#> π$ %> @耊d! ?%  Dd ?   > ^ D@!0> ^aPzɔ!> ^y8! D |` "& `& da  > ^!@@ z  `?@@*" 8 & \'a > ^ \z! L,@   D "@  D" D"  2 ` \`  ` @ m& X & T> ^x! D"  L ` D"` L@2 D `> P \ @" D* D"  D  L,@""  D  " H㿘`D`<> !` > ^> ^""(`z9B> ^> ^`"z0(`D? ="`D@  ``H 2`D> ^x"@$"!`L@耊d! ?%4 `Dd ?   > ^`D@!0> ^aPz">> ^xp!`L,@ @`2`D`D@ @@ "@`D`  耊` ! ?% `D`  ?   `D> ^> ^!0aPy͔">> ^x<# ="`\`($`Ha "%> ^  (€ @€  * @  € @€  y   @€  a > ^#Xy 2,`\  € @€   * `@  @€  * 2 `\`\@@2`\ @" `\,a  > ^ @#x € @€   @ @€   y8>``!H> !`2 `d`T "`d`X@ `\`d ""``@"@㿘 D > ^ }" D> ^(` " "y  h@ 㿘`"!@> ^ x#!@> ^x#Ё 㿘``@wQ 2 ג@ P "8, 2  80 @ߟ &  &`H8&`L @ " > ^c@Ϋ??&`D&`D`D`L `&`Dc> ^#x:` &`@ 28`0f8  ''@Ρ %> _#>@t@9   '`` @ΐ 㿘`"!@> _ x !@> _x{  㿘``@v 2 ^@ P 0 @. &`<D&`H4&`\4 2&`L&`@@l @ " > _`0@/?&`P> _xD @0X > _x= P0Q> _`x@??&`D&`D`D`H `&`Dc`P :` > _ > _ > _`Px &`@ 28`0͒8 "' '> _x  @@ #> _!>`@א@ʜ  @X '"_r @ `㿘 @#> _@ͱ`Ƞ .3  & X> _ В wٔ05 @x& T X` @@u T (`< * *    X`8  @2 `   " `8 X@ ` "   T&`<㿘 0"!<.` X(   \ &@("!@ 0.`( T @` 4   X   & X @` @ޅ.`㿘`< $`  "} ?   2`P> _ wO`0@s`H$  `P$```H@s*`$ `P *``H@s$`d$ $ `D @ 2  < $㿘 ` ` `>@`B㿐H /f * ' > "m  > 4 `` $ 2` $ 4 $$ $ $ H 0 2$   0$ ) ܑH /f * ' > #m $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(  $ '􀦠g>   RܑH /f * ' "mN   4  `4$ $$ 4 H 0   +*H /f * ' > #m$ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(8  r$ $&@㿘`@t`?㿘4``x> _v?!0> _a0@?&b|> bXa0  @ 4&bt<  @#`&bp H @ &bx&bh <@*&bl> _a@@??&b&b> _aP@??&b D&b D> bb< `&b&`@`@&`D @b<M@bL>>Lࠐ @ ?@}h #  ! #   #&bP@ ! #   #&bP@ &  ! &   &&bP@ ! & ז  &&bP @ ( ͖  (&bP`  Ė  &bPbP` > > > ?&`x#,b," $$$4T$ $`nnq> _b|!`uy8 > _a@s֐ `@"&㿘b $ T@- T $@ @hb#b!4  c   !  !$€  D!4  b !  !$€  "  <  & & $ !?&! < " Yn b* @ b8  ," bt ""  2!4 T$6 T bt$b"`b 6 R$b$b㿘"Ā 6 W""p"" "pb " "p   "p" `?"# "pc    "p# `?㿘H /f * ' ː@H 0㿘> _a sl  `$ 㿘"l  "t``"p!`@J`@"  ``@` @㿘2      `  `    > _!> _!> _> _!tW!> _!tS㿘 @  > _!> _!> _> _"t="> _ t9!o" x!""*`#`` p`a"p  *`"#`` "p$2R"  #"#"T2T"?"t#" #㿘 x 㿘"", @ # % @@  "*  "@!`  "@ &" 㿘 x"pH /f * ' b@bDbH@ bL@ x@  x#b@#bD#bH#bLNH 0> !U"㿘 H /f * '  a2a1;a a L0!5A0 !6= A T 6 T ` @L x0? T@  2 Tu T ?36 T  @j@20(m/ xm x`4 T @ @ʐ "L xhx $  H 00H 0㿘"p x"t"hH /f4"* '"  " @ &""   " @ &" "@ "* " + @" " ("    " "*`   + " ""  "   $"&"&"&"@h&"@"@("A*  $c">"?* $c"<"=*`@ $c $c @Dސ  $b  $bP $@"$ "($ `K"$ $ $>$  $_d? $ , , $ ($a$ $ &"$ $ $b,$ 0b  $b c `$c T @ ;4TH 0> !Tv"x    ?#d ?#d#㿐"x"|`> _"p rf0# $   '$   'z   &"?$'0  ?&"$'0> _"rC 㿘"      > _r4"M1? @ @ @ݒ @ڒ ` < `@Ԑ?< >@ `@̐?>@" @W@U @R *?@@K@I@G@@ @ *?@@ @@㿐b bx $   '$   '  6  > _ $   '$   '  6 "q` 㿐b bx $   '  $   '6  > _ $   '  $   '6 "q`㿘"     > _"q} 00@. @+ @( @% `. <@ `@?<@ >@ `@?>@@ @  6 > `@?> `x*``x*`` x`#d x#d#㿘%  x> _ q)" l`$ l"`*`   2 h l  $ l < `$ h U_g㿘 ǐa !"  0 2  & & #&`  `   ?&`㿘"L X  K G  #  ?    > _ ;#z ` ``*  "pb " b ="b ?*     ? L $ > _  #p 㿐"p x T!c  @$c 0Sc ?$c  Tb?#$c@$cD$cH$cL0F?c$c@$cD$cH$cL T="!7777& @o  ?;n #       @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cL T =6 T㿘`@n~`?㿘 L`x> _p#@0n> _c`@?&b`0  @̖ 8&bX<  @Ɣ &bT&bL <@&bP> _cp@Ք?&b\ D>!`&bd&`@`@&`D@ b<7` >>&`x"Tc$>?b `"$$>>$4T|4<   # # $ $Zhh> _b`#o8 > _c8@n  `@"&㿘 T $@ @[!4  ]I  !  !$€  "E$!4  ]4 !  !$€  "  <  & & $ !?&! < " `S `h*   )p8 ' ,`" X `"a" x  $x T$6 T$㿘"T "X,   R ?    $@@`  B ? @ 㿘ڐ@*㿘> _ cm˔   & H /f * ' H 0㿘"P"\ *`2 2"X `#߀@q?"  @  " @= 㿐"x x $"|"p*( ' 2"x  p # p "x?  &"x"p*( ' " p"x "3 R"|  &"| T$ ;3 T  㿘" "p,`@ 2&" #  @ @E` "p* `"@a   "p@&" 㿘`x@   > _`nd# t `$ t@ t  $ t@ > _`nQ# t `$ t @ > _`nE# t `$ t @@ > ``n9  t `$ t  @> ` 0n-` @> ` Hn%` @  x  ta!$ x$ t@> ` `n`  @ > ``n   t `$ t @ > ``m  t `$ t @@ > ``m  t `$ t @ h x  la!$ x$ ld l !$ lb l !$ l `> `mА  l `$ la > ``mƐ  l  x` $ l$ x``@ l !$ l` l !$ l `> `m! l `$ l` `> `m!  l `$ l ` `> `m!@ l `$ l ` `> `m!X l `$ l ` `> `m!x l `$ l  > `!mu`> ``mo!W?㿘 H /f * '  a2a1;a a L0!5A0 !6= A T 6 T ` @L xp0? T@  2 T T ?36 T  @@20(f xgc x`4 T @ @ p" xb: $  H 00H 0㿘"T x"X"LH /f * ' "p "p @Ö &"t"p@j"h "h@ @ &"l"h@jt@  "p* "l,  @ "   # "l "p*`   , " 4 "p"   $"l"t$`"t($` &"x&"&"|&"$`$`$`$`$`0$`4 `&"\$`$`$ `$` `$ \ d  $`,`, "$`(` , ,,,, , ,@ ,    d ? $"<  "<,"=,">,"?,"@,"A,@=,T `@  {a4T , H 0㿘%  x> ` l6! l`$ l"h`*`   2 h l  $ l < `$ h Plb㿐"T x T" , `  d( ?     ,?0R T"6 T!7777```- `@k-  ;n # ? @    @2?2 $ @22*  * @5 ``ڐ , `  dא ? $   @ , $ @ #"`T @ ` "` "`   㿘``@i > `@i"  > `@iڐ"  ^@ 㿘4``> `kb"(0`> `kZ"H08  @0&bD  @<&bP  @H&b\  @ T&bh  @`&b> `&`xbh@? &b &bb  `!&b> `bp@??&b @&b @b @ @&b`0ʒ>#0&`@&`D``@ @ b> `b@  Scb> `j">>"Ēal>`| &`&`>>&``&`<??? `   "   "  ( >>>?""`Ԕ$ $ $ 4 T$6b  $ $!! $!Uc8`@> !P@i > `b@i > `b@h &㿘 T $@ @GȦ#!4  X; !  !$€  "/$  & & $ !?&! "#$ < N@8  ,`"  `"` " ̐  $ T$6 T$ȁ㿘" "@"    X "`   2 > `"j)  ?& 㿘H /f * ' Ӑ@H 0㿘> `bؐ hƔ !0`$!0㿘H /f * ' `_'  H 00} a2@a1@Ua @a@"*Te 0!5@Z0 !6@V [T `2TT  @U4T@FT`@4T@T@  2T^T ?34T  @TTTb )?ܐ! @  @' T@_Tc\cΒ 4T @  @ ۔`|T4bH 0㿘" 2 "" @J &"" 2 "p!@" @? &""&"̄((&"&"Ė @ " #@  `&"Ж  ! "*  #@ # 㿘"" ""@"ܐ?#$"`"  ?$@@""*` @  $bP"%"*`@$c " "*  $c" "*`@$c$cc$b0$b,$b$b"%`"(% " @  $  $ > `"hג $!$ % , @ % ` %@@"> `#h $c @Xڐ b  $$b "`2"$@b  |`$b c $c eT`@ {5T6"5R㿘"  "?#"`` Ȕ "`" &"㿘" $b0 ? b  > `#(hz 㿘" $c0 ? c  > `#@he 㿘> ` h^#X 㿐" HLD @ `x @$`x"H"L"D"@"Ġ `p { 4`T $`p "̐?&""̀  , "(@J  6`T&""̀ "4`R 㿈 k f6 a6 `<`\`WT?`P`  `0H` E 8 @@<8 ?`.0 6? "7/` /` ('`0'. 6?668( # 㿐"Ф @l $l@ ", ! '   " ", @ `ޕ2 &"Ё 㿘!( &!(*   !0 &!0* ?" > `> `㘐#xgk G 㿘b?a" ֒ @@㿘.`* * "* @  > | c%>  `2HH /f * ' V* @4@h  ""8@ <"`<<8"`8"($_B $0,4&0 6> "_-H 0LH /f * ' V* @4@  ""8@ <"`<<8"`8"($^ $0,4&0 6> "^H 02l 㿘%  > a f @ l`"$ l".` @ s  l $ l   h $ hO < "J]I㿐"  T!c  @$c 0]c ?$c  Tb?c$c@$cD$cH$cLc ($c 0M?#$c@$cD$cH$cLc h$c  T"A6 T!7777& @e}  ;n # ?      @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cLc ($c  T }6 T" ` "  " 㿘"" ``"  a2""  b   &@ 㿘"  #"*? .`c   $` ` @@ ߐ ` ?  3> a he 0. $`       >@ `>@ > `> > `>$`㿘" " % *`@ .` $` ` @@  ` ?  > a e_ B ` 1?#=  $` W ?R O L I  >@ `D?>@ > `<?>$`? ;*? 30-㿘 T  㿘 | &` &` "b "b !b "b !2!!2"㿘 > a@cO > a@cI 2` ``@c@ "  > #L   $ 48@ 㿘4`"> ad 0> a &ctd &cp [ > a`@ &c cp> a`@?&c" &c &cc 6`$ 0&cc@`b@&c 2X > a@b 2Q `> ad 0O  є  > ady! 0D@b) ` @gC`&cl80 @5 $`D> ade!@00<> ! $`L$`< @ " > aa`@6??$`P$`P`P $`P蚐D< @ &ch> ad>!p0 ' 2&ch80 @ &ch!> a !@fÔ `?"`&cl& <`@i! &cl" <`> ad!> ab! 2 > > a@br 2> > !!&`c  ` .`.`.`   `@€ _ "`8&c .``  `.`   ` .``  `@€  `.`` @.``  ` &c@€  P2c &cc#@`c`&c`` >g!(` >g!(@&c &c@&c@_$&c@&c>g!(&c(` >uc `$@c >u<>ub,ct&c0&c4c0@ć  !8 3> aa@a֐ 2.c <@   2"c `@2c @ c > aa@a 2c ?2 c `@2c @j c > c &c> atI @[ #h*` #h*`( #h #h( 㿘#l p@㿘#l h@㿘#l t@㿘#l x@㿘#l |@#lD"#lH {4 {@ {@ {L {X {p { | | | | |$ |h | | }@ } } ~D ~h ~ ~㿘> !`> b@a6 `? 㿘!0`> b bÒ0L > b  (b   N 0 @}  N .`.` &`.`.`@5.`> > a4&`ܐ@8 2>`> "`" > P`O` "``&`&`Ԗ`@Ò >#&`0`0 &`4@É > "@@V !* *  E** *  C*  *  h2   " h" " l" " " " "  㿘@Ȑ@& h?    @" 㿘@   > b`@`@d   &`&`&`   > a҅(@p2 (@2& (((0 > a҇(a2$2"(@> a2"2$  -*-H( i+ , c+ + ! f+   d0+ + ' e+ & j0+ + #+ "0+ + %+ $0+ + -+ H  `l @ ` !* *  #`l@ #`#`#`#`ā `l @ ` !* *  #`l@ #`#`#`#`   !*@ *`" l   !*@ *`" l 㿘> b  0 @``& `" @>( ` * ` * ` *`    `  ` * @`` ` @> (  *`  *` *` "` "`  㿘@` >!8*` €  ?&`&`> b`H &`$&` @cߐ` > b&`<`(`P  ?&`&`> b`X &`$&` @c͐` > b&`<`(y`P  ?&`&`> b`` &`$&` @c` > b&`<`(g`P  ?&`&`> b`p &` &`$@c` > b&`<`(U`P? &`&`$&`  > b`x&``@c > b&`(`H`,@c G&`@? &`&`$&`  > b`&``@c  > b`X&`(`,@c| > b&`@```D@cv ,&`X? > b&`&` &`$``? > b&`&` &`$``? > b&`&` &`$` `? > b&`&` &`$``p&`@cN    㿘   8 *   & > !`         ,    & > !`   0 ΐ ?㿘  H /l * -   @(  " H 0   @ H /l * -     H 0   @ 0H 0 㿘 @ M >b $ $  ܖ  @ /> %/> ج%/> "(D=(  ,%+> a`+?P `-`0+-?P%  ,% +> a`+?P `-`0+-?P%/> ⨁@̀ @ \ x  @  X 4  ` ` ( P ( 4 0 X h  @ < l   $ D h㿘``@] > b@]   㿘4`> b_B 0> > b _9058  @0&`x> b&`|a@??&` @&` @`0` &`>! &`@&`D`@ @!`> b_!> "   .`.`.`.`.`.`ׁ x( x( x( x㿘`x@  $ > b! ^`  " " 2 $    ,    ϔ  ˔   Ŕ   ,  $ `` ` `` "` ` 8    "` $ 8$ <@ €`   `` ` `` "` ` (    "` $ ($ ,@ €`  #" >  @pp?  p8      ?"?   &" p*`@  #`#`   @㿘  xB  & & & & & & & $` N  $` J` ` $` D`W ?$` @`  : ? @  2 > b!8^    @  @      㿘    @  א 2``?   ؐ 2``? N Š   ` ɀ "N     `N ƀ 2  N ƀ 2 ` 2 ࿐ `        ʀ "       @   ݖ `0 ޓ2`2  0  `  ~ 㿘 x@f@T ,  , & 㿘@`S > "P*` €> baX`@`0 A > ba``@`) : > bah`@`"  3 > bax`@` + > ba`@`  $ > ba @` `  > ba @`` > ba @_`   &`&`&`> ba`@_   &`&`&` 㿘? `  > "t*` € X A  R ;    "5 G  C ,     7 > ذ  퀢 , >!  • ! >!0     ? 8 E 2 &' $  $ $$` ?㿘 쀢  x  *  ` H /l * -   @,@ I,@ ,` H,@,` `W `c ? @   \> b!\o  \,@,` `W `c ? @  > b!\Y ,@ @W` #q ? @   > b"\C  ,@ `W`  #Z ? `  > b" \- H 0&  x?`"` *@ ` *@*`"ࠔx?ۄ"` *@ ` *`"㿘> c@ 0 㿘@` > "*` €`2`   x *(` 2 x*@`  x * x*@` ` 2`   x *` 2ڰ x *`   x `*  x*`  x *`ɠ ` ư` " 0` 2`   x *`   x `* 2 x *`   x `*  x *`  x *`` 2` 2 x *`   x*`* ` 2`  ` . ` 2|` . ` ^. ` 2s`? (` l Q. ` 2e` @ ^. ` 2[` @ T. ` 2Q` @ J. ` 2G` @ @. ` 2=` @ 6. ` 23` @ . ` 2)`  ` . ` 2` . ` . ސ ` 2`    2` .    > ܇(  x *x9* x(x* x(x **  x *x*  x(x  * x(x  *   x (x *  x(x   * x(x y* uq x(x 0i* e * \ * * SJØ M@ JJ D@ AJ ;@ 8JĘ 2@ /JŘ )@ &JƘ  @  {*  * t*    ɘ " 㿘@`; > #*` €  ? &`&`> bbP &`$&` @\` > b&`<`(bX  ? &`&`> bb` &`$&` @\` > b&`<`( bX  ? &`&`> bbh &`$&` @\` > b&`<`(bX  ? &`&`> bbp &`$&` @\` > b&`<`(bX  ? &`&`> bbx &`$&` @\p` > b&`<`(ӒbX  ? &`> bb&`&`$&` @\^` > b&`<`(bX  ?&`&`$&` &`  ?&`&`&` &`$              ?&`&`&`$&` > bb`@\/  &`(> bb`,@\( > bb&`@`D@\"  &`X  ? &`&`> bb &`$&` @\` > b&`<`(ubX  ?&`&`$ > b&` &``b@[  &`(> b`,bP@[  &`@> bbh`D@[  &`X> bbp`\@[ > bb`&`p`t@[  N&`  ?&`&`> b&`$&` `b@[Ք  &`(> bb`,@[Δ  &`@> bbh @[ǐ`D &`X> bb`\@[  *&`p? > b&`&` &`$`bȔ? > b&`&` &`$`bД? > b&`&` &`$` bx? > b&`&` &`$`b&`@[ 0 㿘    @ꦖ $ ` $ $$` 㿘   2 @ @겔 $@0 @ 2 > b"X  㿘   x> bX|#=  "& "   2 & > bXh#() ""@""   "8"<  ?# @"D " * * ** * * * 㿘   > b X3#PU  $ & $  ` 2@`& > b X!#xC $ $ @$ $ ` x" ( x"`, x `D ! `@@"         x $"    `  $   (    $  x" ( x"`,  H \ 㿘> " > "`  㿐```t> b> b> !`l`& 0& 4& 8 (\ 0`2Y 0> #@ L 4 P`"N 0@'2  E"G 02  E"A 02  E2  `"6 02  `/>(!\*` €$!##$%$"!" 0J "$   $ 0  %  0#&@%& 0& 4%& 4& 0 0 8 & : 7& <> b@0c& 8> b@*c& 0> b@$c 0& 4 8@S@ 8 8 & : > bc@& < 0 8 &  <: @&& < 4> bU# 4 <& @J   J* (J А 㿘> bc @Yΐ!(!  &!@ &!L&!<&!8 `D"`H `H $ 㿘%> `A 8? <& | 0& T 4& d& \ & `!> ""P> b@c ""P> c@` P  T> #   " Q` P "` T P P T@2b 㿐> !` D@- H " H& D& H H `& x6 & t D " & t?& t& H& D t & t x & x!$ 2  8 H >) D >)!&!$ 8`  > > > > " x"l"p# t! `  T> >  pl! @0  T!   @I t x!(@B㿘 8 :`8> h"ؠ %> '> @ ` `@  `> h"آ"Р @ ` `@  `p  @ p`  @ l  @ l`  @ x2` `> "> ""`"`  !(>*>*>*!tb&`&` &`!( ܘ>,'''''''=Y 㿘!P   T&'& 8   >  p>  l!@ !P!  @ !P  $!P!P"!P @#``#dd"@@d`?"@0 d0E" Ed0 # P`#dd2 #㿐 ,  ͔  `? > " `  #\`    0'     &` &@@} &` `#\`\  &` W  T   &` $$ $ $ $ $ , (㿐  "7T    `  3  0 㿘@` `> c> c> c H`XSs!\"`N@  `  `, @ @W  @&` 㿘> c  T> c@T Г.` < > c  T㿀` R .` < L  8 2 0E   4耢 "8#\#`3 2 & 0  € 40#H /e4 p* & p    0    ` 4$ l$ pH 0@N 㿘@ 6 @ p "@ l&@@` *`  <  `@Q `  @Q 0 㿘` > h ؓ*`   € >      <> !D>-b  !D  0 2  @  *@ 2 (> cR @   ᐖ 㿘` J .``<  A > " ؀@";   27  / H /e4`p* &`p"$`p&H 0  "1` `0 €`4> c! `SӔ`       㿘`  `@5  '> !> ` !>   `> !D>-b  !D  0 2?c.`  * "`㿘`> cS!8 㿐` <&"> " Ԁ` !> "> c> c> c H`XHQԔ"s 쀢 " #\> c> c> c H`XhQȔ"t#`     X& <> "> c !SS$ "@#9 > c!SJ` <&"& p& l > cSB!& 0& 4& 87> #> Ǹ t%>5;> 0@  W "`@&@ 6aē* @*`" * &  : & & 5 & @7 `4   > >5"Xh #>  '`4㿘#> "`Ԁ "  > c> c> c H`XQW"`4  > c> c> c H`XQL"  > c> c> c H`XQA" > c> c> c H`XQ7"&  > c> c> c H`X Q-"> "`"`> c$ $ @"8$  @> `>  $ "$`ԁ㿘?> 2 #`26b #*@  V * < 2M  F>1 p>22 `8`$ $ Т` $ l"  p`" p4 k  a# %$ $ $ $ $ $ @C  p> h $ p*`  `"   `4  `4    $ 㿘 ?> c6 X*< 2 Q  "'   " H /e * &  @ H 0 > h ؓ*`  €|ݐ  "  @   ?&   $€> " ̀`   $ > "`Đ ?& > " @O > "* Ȱ 㿘 ?> c6  * <     >  h`ؑ* `@ 㿘 ?> c6  * <     >  h`ؑ* ` @ 㿘 ?> c6 > cO"@* <   㿘 ?> c6  @_2 / *`< 2 '  > h`ؑ* `@@ 6ј 6 @? 㿘 0 4 @ 㿘b   0`@  cV"  cEcL  L #Q #P    L"<#K "*` #D"r``0#R~E"l`0 #Q"V"`0 #P@0 #U`0  1& .&,&  ` ?&`  `` &` @ ِ` "`02ؐ`t `0` `@А@ ʐ`0`4@ `0 `&8`0@ `4 y @  $0r`?f&`(`0j  2`4d -`X`0`> Ǒ*`" đ*  @Lґ* &`*" *  @Lɑ* &` H&?    $`` "2v`t> aİ  @Q'#` $`$`'> aİ Ւ @Q#` $`$`` @Q 0@h  `0`4@㿘 `@ ca@"  #V@NcT@@ 0cb@X@$ 0 cO@   #S@ cM@": 000#N@"k0 #U@# 00A#c@u 0@@{ sӔ 0ni:d@ ^ `Z  V(C$A@K  8m "&8 0< 0   4  00*" *   <0& #* "@*` ` < ?2 " 2"@7&" 2 0  ` @ 㿘 > ?6 @ + `< `?`  `0 `4?㿘> ?# 2`   * < 2    5 㿘> ? #2`   * < "     _㿘>   l * @H /e4 p* & p  H 00 H 2 o " p o<* @ 2  H 00  & pH 00x& pH 0 H % ` P@Ȓ p2  ( @ @ d   @ T    P@    @ <H /e * &  p H ?`& p> !Ē& p 蒒&`:` 0CV  H   p  ?& p,_ Ha H 0H4 p( p" pH `$ `( ` ࠝ㿘  ` `  ۚ 㿘     > נ  h*@ `㿐  > c> c> c H`X`LE% p C  ?}* 2  o!<@ 8@>@  > ?#@` 2> א h *` ` * 2 €0+` 2`   ?> ײ  hJ*@ ' ?㿘" > cM"p4 " *> c"K  < ` > c"M   """ ?> cMu"" $"$ p$"$"@c   ?$"` ` +w 㿘b > cMT#I b , > c#8K`< ` > c#`MA  "$`lb ?> cM6#b $b($`p$b$b@$  $`p`b > " ` >2"\` # r㿘" > cM#@ " ? $"$ p+ 03*> c#K^  < ` > d L   """ ?$"@  0> " ` >2#X  4@ #h 㿘 ` .`  <@ H /e * &  p` l@`2 "2 "H 0 j   H 0 _ &"&"H 0  p 2 l?&"J &" `2  .` < ` 2 @ v 2 .` < ` " @ i@ s  .` < ` 2 @ i  " " > " ` >3  `#  2  㿘 2  p> c> c> c H`X`Jz&䀢``` 0 @   $0㿘  " &  @  "&  &   " "   @"   " ` *`   <2  (p?l㿘' H /e4 p* & p  3> d!`0 (A  p` !H 003` .` <  `) H /e4 p* & p@ ` > d &` !0 ( @  ` ?&` H 0㿘` p "``"` -K > "쀠2 " \" \㿐> " Ԁ`/> " 쀢  > " <   > "     㿘> " > "` " `0 $> "`4€> " €> > "   > >5> "  " 㿘> " 쀢``<`  `0  @ `4`㿘`   p` `  0   p 4㿘 @` 0 `  `" , t 2& 㿘 0 ' 4  H /e4 * &     t ,&   &  `?& H 0㿘㿈 #X @'?"'?  ? @    @. @*   ?  @\ ?㿘  * 0  0 : @ 0 *`:`@ 0@㿘 ".`  `0/*`0,` ?&@   0 0@@_P@n@[@@@W0@6@S @@㿘  0 `> H " 8@Ȑ> "* &  > "* :&2  &!> d ( 8 &  * 0&!>  8. <`"@ p2  8@:`6`<22` 2 "2`$2 &*`( 8 㿘>  8`p`  @HF@F.  :` ?@ ` `8.` p:`   ? ? `8 `p` @4 `p-`2 @  `( @0@ `8 p `(  @0*`(㿘'> 8. `p6 `@E@G`0``45  '8,  p4 @, 4 ` ` w @E@Gʐ@` `@㿘>  8`p .`* @6`. 2    , 2  , 2 , 㿘#> `8 p @`"  @G "@  -2 @8. `8-p5 `4@EI0@Gx .:   - ? ?  㿘!>  8 `p  @GR%@ -2 &  8-`p: @`4@E 0@G8  2? 㿘+> `8)> dp H@  `@G. "@4  @Dߐ@G0`4 *   .2 8 `` 8-p2 @`H`4@D0@F * @ߐ` 2`㿘+> `8)> dp H  `@Fʒ. < &@D@F0`4 *   .2 & `` 8-p: @`H`4@Dl0@F * @ߐ` 2`㿘'> 8. `p6 )> d` H @DI@Fx`0``48 `p* @.` 6`@D2`p`@F]`0``4 *   @ 㿘> "J`Ȁ !>  *` 8p (` 8@̐  8 p (` 8>  8  p2  p2" p 2$ p"2& p"`2  8 p (`*( 8`p ( *( 8`p ( *( 8`p ( *( 8`p ( *( 8`p ( *( 8`p ( *(㿘>  8p `(  8@~  8 p (` 8  8 p`2`  p2" p `@C@EՐ 0` 4   8 p`" 8p`  8 a 8 p ` " 2` p" 2"p` 2`$p"2&p`" 2`p"  8`p ( *( 8`p ( *( 8`p ( *( 8`p ( @*( 8`p ( *( 8`p ( *( 8`p ( *(㿘%> 8`p  @CB ( 8@8 p (`8n 8 `p`b4 `p` ?@2"`p 2$`p`"2`&`p" 2`p" 8`p ( *(8`p ( *(8`p ( *(8`p ( *(8`p ( *(8`p ( *(8`p ( *(㿘!>  80`p ( *( 8`p`( `"` @ 8  8 p"`2㿘!>  8 p `( @@ 8 p `(@ 8@ 8 p `(@|㿘>  8`p ( 2q`8 :`8= `8 p$@ `8  p  @2  p 2" p 2$ p` `8 `8  p$ @2$ p$?2  p$?2" p` `8 p ( `*(`8p`$` :`8`" * `8@( `8p$?2"p`$2` `8p`$` :`8` `8@ `8p`$2` p$?2"`8`p ( *(`8`p ( *(`8 p``$ *` `" * 2  `8* 2 `8 p2"  ?*` 2``8*` 2``8 p2 㿘>  8`p `( 2`8`"` @`89 `8 p$ :`8"@ * `8& * c2 `8 p&2"`8 p&@`8 $  *`P2``8 p$2 `8 p$ *E "Ր `8  p * @ 2" p2 2"r`8`*` a2` `8 p " , 2 " p2`" * 2 [`8`8 p`"``8  p, 2@2" p " H * 2  C`8 `8 `p? *`"3 `p2` 0`8* 2  `8 p` `, 2`  p2  *`ٓ2``8`8 p` ``8  p, 2"@2  p @ *` 2``8p `( `2`p|`㿘>  8`p `( 28`"` @8i 8 p$ :8"@ * 8& * 2 8 p&2"8 p&@8 $  *`2`8 p$2 8 p$@*2"@"28`p @@@@* 2 ,`"4` 4"`p*  "4-`p"2` * G2 ,8 @@8 p ` @@Ò* 2  ,`4` 4  p*` '2` 8 -` p 2 *`2`8p `( `2`p`㿘 p `( ` p `( *`(㿘> `8  p `( B *`( 8 8 p`` " " 8 p`"` ("" ** @  8p 2$p` 2`p`2`$p"2 8 p `( @ 8 p `(@ 8@ 8 p `(@㿘 p `(  *`( p"  p `( *`( p ( *(㿘>  8`p   9> "T  " @ I* 2 ? $E- `8-`p2 @`4@@0@B4 ĕ-2*@  J `  `8  p`@B? `- Ĕ2` *   `*`2  -2 `8- đ2 *@㿘> "J > "`@E* `> צ %> 8 p `h*  € *`  㿘 > `8M 0`8I 㿘 8> " `H /e * & )> "   ,2` ,`Б2   `"4 @@   4  Q  % > eB H%`%`БH 0㿘 p (` 㿘 > L >   < <`@Ed  2 !X!X!X!X!X!X!X!!!L!P!P!P!8!! !X!X!X!X!X!X!X!X!X!X!X!!!!!x!!!!!P!P!P!P!!d!d!d!!!!!!!!!H!!!!!!!!!!!!!!!!!!!!!!l!x!!!!!!!!!!!!!!!!!!!!0!!!!!!!!!!! "` $ ($ $ $  `>   l @  ``   @ 2$ $ P$ T$ X$ $ |$ x$ t$ @㿘  > "  (`" > e> e> e `? ǔ Ґ \& ( & $ Ŕ & P    & T@>   & X!&   "& t  "& x  "& |  "& @ @`㿘 &@ & P " TM & P T " F & T " t? &  t " x8 & t x " |1 & x | " * & | "> "# & > "  㿘`  ` 0@0@ 0 @ & &   0   `@㿘> l> p `& 0 & @ P& D & 8& L& ,& 4& < & H  @=    :  t  P*   * P t  & p& h& `& & & & d& l& \㿘 H L  " 2 @ 0@*&  T`"& X J@`   2  ?@& X& & X㿘 0 ! !Ԑ 0&  ?& 0` d `* @` `*` d &  \ d* @` * @  0 " X  X 2"   ? + *@* X *@  4  @   X 2 " &  0 & 0㿘``[>=!*` € $0R `O 0 ?& 0J&  0&  ?E& 0 P" X  X2  " 9`@ :5& J 21&   `@ :+& J "`%&    2@ ""@  8 Β & \& \> e?!0  ,   & ,& ,%㿘`?`^Ǡ >="*` €. & & & & & & & & & & & .   0  !&  & 0 4&  @&  8&  <&  D& &  d  @ "@` \ `& &  0! d  &  &  & 4 & 8 & < & @& D   @ "@ `  & \t& ` 0 p& 0 0 ?l& 0& 0g P2  > e> e> e `P=̔! Y*  V& ` S& \ P& ` M& \ J& ` G&  D&   H"@ &  T`"9& XJ@    2  ?@.& X,& *& X@ 0%& & & & & & & & & & &  :@ & & `?&   `?&      `۔  >=( dd( d tdxd|(" ``5ฐdt(" 㿘`ۀ`5% >> *` €   d t* "             @{㿘``6@r      Ā ( " ā 㿘``\ @y  `0 9;  ` *`  ((Є " "   "  " ``$ 4`|0  ``p`q `t   " " ā 㿘`̀`}>> *` € X t   .`    @` 2 @    "  @ 8 T *@X& X X T 2 ,  .`  @ <  2 @:     `  @ 8 2 @*   T +  & X2  ?@8!& 0  :&   @    E 4@` @* * & &  㿘`?߀` >>!*` € +   `*` * ?А "   & .  .    &  & @`  㿘"  0 ( 2 0> e<!` @    X*   (>  H!> e@   C` ,`` ޔ `(;ܐ!* @ €& ,`2@ 0 @    X*   !!!!!!!!!!!!!!!!!!!!!(!D!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"!"8!"@!"@!"@!"H!"l!# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !"!# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !"!# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# !# 㿘 L@ 8 "  H   @ T H@ 䵐  H @ 8 T`  H@@9  T`"& X J@`   2  ?@& X& & X㿘 L@ 8 "   H @ T H w  H  8 T` H@@9x  T`"& X J@`   2  ?@& X& & X㿘`"1 ``" XT T"DP T  2 "  * *   @ 8  " `<`   8 T`4  @@92 , T   8  T " @9!    X`*  @ 8 T     8 T " T @9  T`"& X J@`   2  ?@& X& & X㿘`"``" X0"0  2 "  * *    X`* 8 @ 0   8  @ XN > N *`* @`@ `m'"m < `M `f`L6 `C"  `H`A"Z 4m `@50 " 0`J`D0y`K|0" 0`h`X" `c`P00"n `i`l0}@"'"p@ "4p`r" `y`nf0ː!p@0ǀ@ "4u"q@@w@0K@4iu@"> e~@ c@J@0@"s lh@-0@Kɐ p@^0> e $a ␐ ␐* ␢ @{␠ ,` !@ `@ ,`n  @i ,` !@ `@ ,`]  @X ,` ,@ `@ ,`L  @G␠ ,` ,@ `@ ,`: @Д 75␐ @ 7/ 8* )%   P   > e> e> e!aЖ(8!P $> eb8t   *> e PJ@  > e"@ > e"H> e"P   : 8  $N  * P> e $bXC  $b` `"   X 2# 8 #  + * *@  X ,@`ٕ*`"   H" 8 "&  T "& XJ 2 & X"  H L  " ? 8 &  T`"& XJ@ "& X  2  ?@& X& "   X 2 " ? 8 s&  "  @  08" "   "  L@8 H  `"  8 ?&  T`"& X J@`   2  ?@& X& & X "   X2@@ 8  0 ?& 0-& "  H L " @ 8 "$ & L`L& H& LҐ& L& H `"   X 2# 8 #  + * *@  X ,@2"`*`"   X 2 " 8 *  *  8 @  > e $bp8  P`2  > e> e> e!aЖ(7!Ѐ    *@ @6P ␢  < @@3 D,`   `/(>B#ܓ*` €@> >  l `p     ? ? ? ?  ?  ?آ`@ ғ,`@ s& D& 4& 8& <j& @ ?`e>B#*` €> e $b” Z 0   H"@ `> e  8 `8  $꥔=> e $b> e $bꚔ 2> e $bꓔ +␀`"     `?  8 " ` 0& L & H  &  &  l> `p& < & @& D& 8& 4 > e"㿘`  "  @` `; `  `  `` `   `  ```  "`"  2  `  @  㿘 `<`7> e P 2  > e> e> e!aЖ(6i"@5.  Ĕ    J `/" `94 đ* * ? $  P*?  Ė&   P*?6N"&  >C(!,`0`0"`0`0    㿘`0`CF >C *` €!, " ?4 5 3 !, " ?' !, " ? !, @" ?`0 @@``` `!, " ?   $`0㿘 ,    t   $> e" ,  x, ` @    > e# ,  |, ` @    $@ 㿘`   > f> f> f"HbX5 .`,      $@> fa(*> f   , @ * ` @ ` , !&|!'!'!'!&!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!'!&!&!&!&!&!&Єm(0  *`?Æ0>  x(l(0 *`?Æ0>  x(mo(0 *`?Æo0>   08mЅ(0  *`?ÆЅ0>  ؅( "*`?Ç0&(>I(> fDŽ> fĄ> g> g> g> g> g > g(` + > (" + 0<#w> g4#"q> g"""x ""j> g"} 0"n 0O> g ""R> g"S 0wC> g#H 0oH> g##"O ##6> g#< 0[H#M 0T>  ##> g#  0F> g# 0>>  8"08@> g H PX> g`> gh"# "> g> gpx"> g> g"> g> g  > g> g" 㿘 > g5 0 &   &  & @3i㿘 > g5 0 & 㿘` g (H /e * & @`@ %> g<$`!  ;@`@򀎠`@ !`" H 0` 4 4@.` * Ҕ@@ ``$#$@  `0H 0 #H 00 4` .$@㿘 H /e`A* &`A   @ H H 0!FP!FP!FP!FP!FP!FP!FP!FP!FP!FP!FP!FP!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!GL!Fp!F|!F!F!F!F!F!F!G!G!G!H8!HT!H!H!H!Hp!H!H!I!I!IP!Il!I!I!I!I!I!I!I!I!I!I!I4`  " 㿘`> g4ǐ!P `       㿘> aD&`p&`0 > #&``   $ $@2S&````"@``>L`~``` " ?&`d ```&`h&`&`l&`@ ` "``> g2!`> (`> &`(!8&`t&`x&`| &`!8&``&``&` )> g> #` > > g> g> g!xa2!c " > g> g> g> g!xa2!"c4I"`\`"> g> g" 4?`> g4<"0㿘#> c  !> > g> g> g!xa82!$##T>P>P>P!T$ $ b $c㿘!> #  > > g> g> g!xa2n!ɒ#"#"`"`$#㿘H /e * &  `2  H 00- "  \  6  `,     \ & ` @   > ag @4# H 0`"* ́ 㿘 " p& ֐  p > c" "c> g> g> g!xaP2"" X F>   B> H /e * &  Ȑ? +&   $  `8$ G   " $     H > !> g*`" p*  > g"x3a H 0>    > !D>Mb  !D  0 2    㿘 " & Z  :`2  ` \ " `O  `@˔ C \< ` c€  $  6   `,     \& ` %> aĠ  ݛ& @3ݒ#0@` > aĔ   & & ݂& @3Ē#ѐ㿘 X`3` > g2Ր"0+`,    ?@$ 2" > gb 1 0`Ż#``$`FU` "`$`ɐ`  `H1 㿘 \ ;` l  ? l d € h& l㿘 \ "  " d&   d€ h㿘?> 2 `  6& . @ 2   `  2 X  4 &`@  "& X㿘& X&  㿘?> 2  . @X   "  "Xz 㿘?2 >  . @ ̀   X 2 > g2"  $ h 4 Ȓ`$  㿘?2  > a. @㿘 Ȓ & Ȕ@  Ȑ? & 㿘 "}@ 8"~"|@01@   v@0) X  @ '" X #  !H  @ "  4   X 2  aH @ @? 㿐 @  #@"# #@ # @"   @ @   !  #@"$c@ "  #@E#@"  d#@ s t#c @>  d@y>  d #@ "/# #@ "m  #  #@" d@y  d@ "S #@. t d0# @" d d  c hÔ t " x & | &   & & d`  hc " &  " &  "   &&    & & &&  C > ۰!(!( "`"` "` "@"`q ` &`&&i " d> !8!8@@C*` *   m  @y  ؤ Ĕ  ` $ Đ蓒 0: 8&*  *R. +&?# a2 ` Đ !  ? ߀" ` @  '@n'  `$    h@㿘?2 >  . @ X  >  6?* @" \ * ?> " \㿘` `\ p 2)   \  !   @ & \g & \& \ > g" /  > g# /` 㿐> #` > # %>  '> = '> #> \?`'$\b * =* 2  o$b< 8@"\>  ?#` \  * 6   @;$\$b㿘> #`> # >   㿘> #` > # `  㿘 ` @ b2 d2 h2   ld €h " l`     ( " x \0'cY @'䀦  '܀ 60"''0 \ڒcZ㿘.2 <!@ " `4!! @"  `@@" `@ @  @@ @@ 2 .2 =`,`- `  ` `"  \ z  v  `"   \ n ֒ j 2= 2a =2 @2 \ p > #`` @ &@M  I"@ `+F>K l*` €2? \ ݔ :  \  \ n 01=2 $ ? % `? =2 ' ? ( `? =2 * ? + `? ) 0 㿈 `'H  ?Ð" @9& &  6 . * @@f  =!H?Ð"@`a>K!*` €H ؖ k H і d H ʖ ] H Ö V H  O H  H H  @A H  : H !3 H  , H "% "H ( ' h  H H`` 2 `  "   H "$ $ А $ H `  !@ 0" `* 2  o< 8@> @ 2 $# b    `?   @@> @ , @}* 2  o4!<@ 8@ >@  `?#@> > <c"24 >ab(.)=``!..`2 a .  $ &   2   ޖ$ & 6 .=2`!@2 i # 2  @2  , @@ 2&    "@*` 2  ? & @R   $* 2  o;< 8@6> 2  ?#` 2,6  0* 2  :.2 ` `2  * 2  `8" " 6    6 6  6  !P!P!P!Q!Q@㿐> h=> ` .(@77 7.. (.`0@2&`7   @`6``6`6` ((7@00 " h> `    68(( @ @ @ @@ 6868261=!-(0 @#* =(0o< 8>   * ? 2 ** 0> g( *2 㿘`0>S".` €4a666$666666 6666 6 6  66 6 6 6㿘4a66666   2  +@@ ?#8>@}* 2  o <  8 `8`8`* >2` @s+<    +d`+`@* 2  o<  2@ =@"6@<    26` * @@ ) ?# 381> (@ }* 2  o< @  @ 28 @`8`8`* 2    > h ()@0 `@*n@`2S㿘 . @  . * & \ &@ 4! @ 2@ @ 2 @@ 2`@ 2 @@ 2` p ? > h  `  2  2  )G P * "  ` T *@  *  G?# 8>}* 2  o <   8 `8`8`* >2` @2  <   < <    * 2  * *`X Г*   * ?#'8%>}* 2  o< @  @ 28 @`8`8`* >2`@"> h (< @  @  o " `  * 2  o<   2 =@*< a   aa **@ * 2@ *   * @ )@?# 85>,` }* 2  o< @  @ 28 @`8`8`* 2   ``@ > h (D* ’ ,` * @ *g Vа @"` !^!^!^!^!^!^!^!]!]!]!^!^!^d!]!^!^!^!^!^!^!^!^!^!^!^!^!^!^!f!f(!f!f!f0!f!f!f8!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f!f@!f@!f@!f@!f@!f@!f@!f@!f!f!fd!fd!fd!fd!fd!fd!fd!fd!_!`!`!at!a!`!g!g!b\!g!c8!cd!c!d,!g!g!d!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!b\!g!g!g!g!g!g!e!g!g!f!f!g !gx`" "`$" `" `" " " " > p> l  " H" 4" <" L" $" 8" D㿘#> "aݚ $  > a> t   x@ @ a`   @ @ 2$ @ $ P$ ː㿘  > "! P`"& > h> h> h В`0'=  * T\& P& 㿘``Q>V"*` €ڥ 0H  E?C& A&      "" @ 8 `4 @ <   @  %&      <& &   ?& > h(!H0  & $   @& @㿘` @ 8   @     &    @& @Ȑ& 㿘``[2  (& 0@%  㿐``3>V#0*` € 0 ?  *` (  & *    # 8  @   #  @  F < 0 ?  *` (  & *     "& &  0 ?  *` (  & *    "@ 8 &  0 ?  *` (  & *    "@ 8 g&  0 ?  *` (  & *     "K&  0 ?  *` (  & *    8  0?`&   *  (`  &  *    8 ?&     "   <     <"  0 ?  *` (  & *    " 8  @  "   / < 0 ?  *` (  & *    "@ 8    "@    @  <"@ 0 0 ?  *` (  & *    # 8   #  @    <" @ 0w 0  D H@6 L@.` (  `/'>V"p*` €@Q> >  p `l   @ .` (@  ?…@ .` (@آ?ز` @ @ 2& L& 8& <& D+& H> >  p `l> >  l `p 0 ?, *` (    8 & 4 p> `l& D & H& L& <& 8/㿘` 0!  9 ; 0  0   ( ,V  & 0&` 0*@ *` * ?А&@   & 0 0  & 0 & 0ܒ` 㿘"  P 2> h$!    "/@`=#`" $ `     > h $~  & $$W!& $`2@    㿘 `  @` `; ` `  `` `  `  ``` "`" 2  `  @  }(0o < @ 8> @ 2- @2 -`2-> (,,-(0 * ?,(0 * ? -o(0 * ?Æo0>  |( ",v(0  * ?Äv2`> ଑* 2i"<➑2`\> h&㄄♀a> h⛄▀^> h╀R> h☀U 0\"F> hA> h✀8> h❀1 0N<> h㇄぀(> hや⟀< 0>%> hダ# 06,> h ㈄ㅀ > hㆀ 0( > h㉀ 0 > h  > h> h"  > h> h" > h" 㿘 > "&@ a &ܾ 㿘``"00     <& &     㿘 4`2  &    <  0@  "    4  "   <  4 " & !tD!t!t!t!t!t!t!tT!t!t!t!t!t!t!td!td!t!t!t!t!t!t!t!tt!t!t!t!t!t!t!t!t㿘  *@F #    @j    @c > i$.!?  @  4& > i$"" ?@  2?@ 㿘H/` / ` ? (> i"u"8   ("`  \& $ $  ΋ & 4 $Ά @ & 8& 4 8 4& 8<3>]5>];>]/>^7>^9>_& 4 4n  @$ & D $@$ 8& @_ : $@& H& L& <& $&  T2 & T $O& X (K $ (` & P D @ Β  ( & (  (`@%& \ 5 <: "  :  ?@ 8&   "':  \ " @& & d  \ @""@* & `& d& ` ( +  \   " <  $@  8   8   \@@$@ t >_" `Xc̘㌚\ & & & & & & & ̀&  ( >]>]" !p & & ?`>[#*` €@ (@_ (@ Q (@ t (@C  ( ( =& (H 0 ?"& (H 0 㿘 2> i!b"h @6    @ &@   &  & " > > lp  2`> i 2 2**` #      (* # 㿘  $2 <:`:`  X( @ X#  @ $  @ @ * ?""" " """"    ?" ږ㿘 T֒ XҐ `$ ˒@ƒ ?ʥ ?@?㿘 ( "  ̟@ & `& $@` (` ̟€& (0 ( ?& ("* > h??-> h9?h"h ?* 0 h* UUU?""x"hh **`*`@**`"0gh ****"@0Y؂ h  , @ /8 /(( -  @ 08 0((@ .  @ 18 1((@ *`4(*`@(  @?( @*`2 2` @ `(0#@#@`2 2 "@" "㿘> h< @2  (    :  \:     <$:У: X̐   H@` "@"`"`"` "`"`"`"`` ""@`@ 㿘 $ Xˤ   T˞   " $$@"@:`??C  ?8" ?2 00??-    8*  82?8"  8* 82?2 㿘 TA X= 8?   < h@@ B$``??x> ?"?2 0g??c> ?2?2 0R?P ?*?2 0?` "@ `& @&>>??2 ` ` `*2? """" """"  " *22?2 ` ">a>`>aH"``  >a>b>b"d8"`"`"`㿘  ʉ Xʅ <  @  $  l h" h l@ 2 ?     P&d 8 (@ Y- > i, c@8  B @ @ &@@9 `2   *  *` * @82 @ @&@@    *`  * *@ 2 @ @&@@ ~ @  * &@@ @v@ > i#* > i␓, 88 @  @U @` @ @&@&`@H  `$"?   *  *` * @8`*  @ 2@ &@&`@"    *  * *` @*`  @ 2@ &@&`@ -@  * &@@-@` @ @  &`&@㿘 Xɋ @ TɆ  @ `$ l h" h l 2  + ,@@%   Pc& 8 (@  @8,@@ @    @,@@ @  * $@*㿘 X8 @ T3  @ `$ l h" h l 2  0 4@@*   P& 8 (@  8,@ 8 ,` @    ,@ ,` @  * $@2㿘 ` ޒڐ?  h <@ XҐ > `$  + .> i@ # ? ?=8 ?  #? 01> ic+ @ > i"*  >?/ ?/   # ?#?  `   #?2 㿘 `  y $ Xu  < `$  *,> i c??-@@?  #@?@ 0"> i#* `> i*` ?8 ?8 @@ #@`?@ #@?2 㿐'D  .*&D X! $` XD> < ? ?@@ ? > i #*.> i " . @: $``* ?  > i@ *  @* @ @#@@ @ @*@ @+ @`$ ` `@:  `D?`?@Ų@0j> i.c@  '> i"-   "'  ?@=`? D ` <>    "@ @  ??6;> i  **`> ic # .D @( : %`*  > i@ *   #@*# @`  @ #@#``?   : #`4#@* #@ 9 : %`* ? , @ *  #@* @#@c @ #@*@#@*`%  #`> i": #`?~D0>` < ?@ @ ? > i*> i.##  - D`@  B :  '`* ? > i@@* !#@* @#@#.@ #@*@#@*`'  #`> i": #``࢕`?   : #`4#@* #@``% : '`?* ? > i@@ *   #@*#@` @@ #`#@?vD  ">e >e >d">e>dd4" 㿐 X= @ T8?  h?  < @ <@  ` `$` //=  + 2 - ` P &  `(`8 @ ` `*  ` @*`*   @ 2*+ 2 `   * 񀦿$, 㿘>`<h>`<7>  > ?&p#0  `"&&#0`./ &#0`./ &#0`./ &( 1?@@.`(6 6`&``Ӷ㿘> #t` "#t$ctF0N> #p " X Xy @ Tt  $* > 0$$     P[&8 (@> #0 2  < $ *  <  $   >  cl* $$$ ct?$ct㿘> #t` "#t$ct0U> #p " XG X @ T @  $0 > 0&@&`&` @ %   P& 8  (@> #0 2  < &@ *  < &` 2  <  &` @  >  cl* &@&@&`&`ct?$ct㿘> #t` "#t$ct0Z> #p " X XĴ @ Tį @  $4 > c0&@&` &`&`*   PĖ& 8  (@> #0 2  < &@ *  < &` 2  < &` *  <  &`  @  >  cl* &@&@&` &`&`ct?$ct  ">g >g >f">h>fL\" , * ,* /`  * -* .`* 0  * 1㿐 X3 @ T. 7 7  h < `<  `$` ''?  3@`2 / ` P&`8 $@*  *` (*     2*  *3@`2   * $4 㿘6` h<6`<?> > (.cx     "&&cx &cx   cx & ` 㿘> #` "#$cR0W> # " X X{ @ Tv @ $> #x/ &` &`&`&@ @%   P[& 8  (@> #x` 2  x &@&` *  x &`&`  @  >  c* &@&@&` &`&`c?$c㿘> #` "#$c0b> # " XK X @ T @ $> #x8 &`&`&` &`&`&@ @,   P& 8  ( @> #x` 2  x &@&` *  x &`&` 2  x &`&` @  >  c* &@&@&`&`&` &`&`c?$c㿘> #` "#$cw0m> # " Xؒ X  @ T› @ $> #xA &`&`&`&`&` &`&`&@ @3   P|& 8  ('@> #x` 2  x &@&` *  x &`&` 2  x &`&` *  x &`&` @ >  * &@&@&`&`&`&`&` &`&`c?$c  ">j >i >h">j>hLD" , >k  * .* 1* ,* /* -* 0>k>kx" " 㿐 X @ T  7 7  h < `<  `$` ''S   ::+@`+@`+@` 2 < ` Pؐ&`8 1@*  *`(  *   6 WW+@`:`+@+@`:`+@`+@`* 2  * $ `: : , , , 㿘6`< h6` <?1> ?&! > ??  ```` 6 (6`. `(`'@.`'@'@ (&`@ . ( 6` 0'@@ . ( 6` 0'@@ ( . 6` 0'@ `?㿘> !` "!$a 0_> ! " X X @ T  @ $>  5 &`&`&` &`&`&@ @)   P& 8  (@>  ``   &@&`&` *   &` &`&` @  >  `4* &@&@&`&`&` &`&`a?$a㿘> !` "!$a0m> ! " X X @ T @ $>  @ &` &`&`&`&`&` &`&`&@ @1   P{& 8  (%@>  ``   &@&`&` *   &` &`&`   &`&`&`  @ >  4* &@&@&` &`&`&`&`&` &`&`a?$a㿘> !` "!$a0|> ! " X X" @ T @ $>  L &`,&`(&`$&` &`&`&`&`&` &`&`&@ @:   P& 8  (.@>  ``   &@&`&` *   &` &`&`   &`&`&` *  &`$&`(&`, ڲ@ >  4* &@&@&`,&`(&`$&` &`&`&`&`&` &`&`a?$a㿈0: `< h ?** 2  2 *   (* '耊`'#'?#?  @* () (`@ 3`2+.  @0@1 0`6 @ ''' @2   (   \   $a < X]  H@ $@!, , &@ +`+` &6;  谆?&@&`&`&` &`&`&`&`&` `$`"  谆?&@&`&``  6  .  &@ ` β@㿈 Ø0 X @ T @ ?  `< h ?+ / ?  ? /   (/  $`''#'?#?@@@ @ * ((`. 3`2+.`  @0@0`66` @ ''' `&@ + +  &>??I @ ?? ? *@`*@`*@`  薂"""" """"" $" 薂"""   ? ? *@`*@`*@` ?2  , >l  * .* 1* ,* /* -* 0>lЁ" 㿐 XV @ TQ ? ?  h < `<  `$` ''?  𔂿# 2 . ` P'&  `(`8!@ ` `*  ` @*`*   @ 2* *# 2 `   * $$ 㿘 8  ( $  > m# ,  * 㿘 (  $ 8 ? ( ?   , ,  &  ( 㿘H/` /> a     $ ( 2 H 0> a>   "a>  !   "@   `#! > "  22 㿘H/` /> a .`  $@2#`  @2   (@2  @  2 H 0   ׀H 0?㿘H/` /  $ (   H 0:? ɐ > > 4`a   "$@`4` 4`$` $`4`  Ȳ <$`q <  $ ( Ȥ `"`8` 8a84`$ H 0 㿘Ho oT 9 `,  H 0-?ʐ  " ,"  `0"   H 0?ǐ  " 0   * 4 &@2`?H 0㿘Ho o &@ &H 0 ?㿘Ho o  ? ?> n4 * 2 2`H 0 @@(> (P:`6 `62?"(+?&'?6"? "`0 `0   **` ? ?㿘@``!"  . ,:) *`   @  `@+  ` @#  `@  ܦ`   㿘@``!"  , *:' *`   @  `  `   `ݔ  ަ`     23`2(+`@ #@( ` ("@ @"`("`("`("``0 "@ @"``㿘*@ * \ *@  * Ŗ 㿘> n@``?㿘> n`@f> n> #0``&a`4&ad8> n&ah`?`@f: >ap> n0@fwat @wX&d|> naB@fl @wM&ax> na  @fa&`8> na0$@f[&`0> n#a@@fU&`4`8`0@ ϐ`8`8 & `4: &`<&`@`0> n`8V!Pd|@?&`X `m&`p>pb  `?BaT> a=㿘#A@". 4c_@"4 <c@@ cD@#FE@ cB@"& 8 #E@<?0; #J@"7?2cC@"  80? ,&& 0& 8& 8 @? a & & 2 !|@T   2 @n!| 2  @! ? > P  8  &?`@8 2?@ (?> at ad a`( a` ?㿘!|* "|#|* * @N 㿘@ `!"@(` n 2!` f 2 "`^  㿘@ `!"@(` C 2!`  ; 2 "` 3  @ax(""ax0@ ( a|b|@c| `ax(  ax*  ax( @ 㿘`&``@  24 > a  V` 2+  2 %  ?! 2  2 ^  E" 4 @" 4  ?倢  `@ &` 㿘` >   a    &`L 0@   @u &`P &a`0 @u &a`&`P &at   6> n > n"> n> n! > n`L@@  > n!p &at> n !h!h  a@dw> n!!`2!> #`L`*  J`@`! !? > #```?0&ad4 &ah8 &al@&ap# $`0> n`4i!> cP`@  at@u** @?&`X `&`px?`aTA> aJA@"' 4_@"( <@@D@F@ C@ B@ E@?0 J@  "" 0" 8" ""? > P  8  &?`@8 2?@ (?> at ah ad( ad ?㿘> !`!p @ L@J0*`Њ@@ Ъ@@0#Њ@@ ?Ъ@@0H/` /`!` `  `!` ` *`!` ` *`H 0 㿘`&``@  2 > !`2  2  u ?"    E `@ &` 㿘`    &`L @tD0> a  &`P> # " J  0 0 ? @t.&a`0ad&aT4 &aX8&a\$* "  Ŕ  $ s$  $ $   #x$> &`p#L `@ * @s @?&`XN ``0> n`4 *!`}?> b0 㿘 #E@"S #F@ "M? c@@$cD@C?0B#H@<#A@" 49? cC@"#!d  #G@+cB@!d)? #J"@ "!&!& 0& 8& &o   2 !`  ? > P  8  &?`@8 ?@ > aX aT(@ aT@ ?㿘`&``@  2 > !`2  2  f ?"    @ `@ &` 㿘` > n`! m&`L> a   > # " J  0 0  @s" &`P0 &aT4&aX8a`&a\$ 2 *ad  $$ $?$   #l$> #L `@ * @r @?&`X `B&`p>tb`0> n`4 !؀`m?> b㿘#A@". 4c_@"0 <c@@ cD@#F<@ cB@"!d #E@3?02 #J@".?)cC@!d'? !#&!& 0& 8& &&b   2 !`  ? > P  8  &?`@8 ?@ > aX aT(@ aT@ ?㿐!` #\ !d㿘``@  2 ` >  0@  > !`    㿘8?#4> n! W@044> n"0 O 0`> n> n H"X0 E"x> nb@aJ@ "> #> n 8"> # `  8 0`?@q  <    "0&ex&e|&eh&el&ep&et&e&e > n2&eD :`  "<&aT@&aXD &a\$:#`@<D*` `?&e &e @q &`X`0> n`4 ">w`0&e&ee @k` &`8@ΐexa`  @ "@ ` @ @? `&`p>vc` ?> >v"X > b㿘#A@", 4#D@ "h 8#_#@@?0`@"+%\? #L@ "G#E@Q?0P cB@!cC@"*%G? C&& 0&%   &% @? !4&  <* .&,&% 2) !`@ # ! 2 !`@ɒ 2@ 2%@<   @5   > P  8 " ?e`@* :  2? (?> aX aT( aT ?㿘 8#`2 X% %h @ A*@>vcŐ& 8@ @% %h p q*@%t!*(%"& 8&%d㿘 8 ђ > !> "a% A @`%h ( (㿘@``!"  + )% *`     `@  2` @  2`@~  ߠ `   㿘@``!"  , *& *`     `P  ` I  `B   .`   %d2%`"%` "%d@  * @8 "%d"%`%h(%x*`a`  @%` 㿘*`!c* !b* !a* !`*  㿘%h  "$    *%h `*%`%d  `%h ``2 `> n "   `!$!ެ!!!㿘`&` @T " > n@Mb 2' > ! !`2 2 T> #L  ,@o?@ ?"    ` `@ &` 㿘` 0 &`L0 &a`4 &ad8 &ah@ox&al   @oq&ap  *@ok&at @oe&ax @o_ &a|  `* >w ܓ*` €`L@@  > n"> n"> !`2> n> n"ئ   > nc@^B> ng#0> nb# > a  > #@`L   " J ! !? 8ap> #```?ap>y`&d&d:d @iB` @0$@ `2 *a @ $#V > #L  `@ * @n &`X &`p`0#  (>xcƐ >y! >y>z>z>zbl# &a&a&a&a &a @`0> n`4#(  ``0# ?:`aT:> c ؔ㿘#A@". 4c_@"0 <c@@ cD@#F9@ cB@"! #E@0?0/ #J@"+?&cC@!$?  &!& 0& 8& &&*  ] 2 @[ ? t?? |`"" "  p`@"l" " > P  8  &?`@8 ?@ >  ad a`(@ a`@ ?㿐!l #\ b!H!t`!t H 㿘!t `0 02 ?#ߒ @`"!l! !  !x`?""`㿘 \!x` @ @ 4"@  4"@G i$ $d $_$ $ $ $ $ $  *`3$  ̔$ $! `$  d($  4 `@$  d?$  `$  d$  4 `@$  d?$     㿘 m!x`j @@f D  4"@  4"@ R       $$ $ $ $ $ $  *`3$  ̔$ $! `$  d(@$  `?$   d`$ ?$  `@$  d$  `?$   d`$ ?$     㿘 `O!x @@K D  4"@@     $$ $ $ $ $ $  *`?$  $ ? $! `< h $! d($) `@$)  d $@@ $) `?$)    㿘 `!x  @@ 4"@J$`$`$`$`$`$` *`??$` $`>$a < h@$a @2  ( "  $i$i ?$i $i('$ d@$i `$i  d$?$i 4 ` ?$i(` ` 㿘  !x $   $$$$$$$ *`$ U$$ d($ `@$  d$@@ $  ` @@ $  !th( "h㿘``@  > n@#H "   > #L  & 48@  㿘      6> n  > $ "!` > n> ncP@ZL  #@   > ncP@ZL 2> n#@#> n@7cH > ncH ː#X> #`0 `?  @k`dp`ap&al>|+> /> n1>|)7> ` 2&0 > #  !> `" p #  (  $  (0`  0"&a`4&ad8 &ah&dp&dt@eal $* "  @̔  $ s$  $ $ $# cL  `@ * @k$ &`X`0``4T&`p` `0#  i"` `0# ? aT6p4㿘#A@". 4c_@"0 <c@@ cD@#F9@ cB@"!p #E@0?0/ #J@"+?&cC@!p$?  &!& 0& 8& &&   2 @x ? > P  8  &?`@8 ?@ >  ad a`(@ a`@ ?㿐!l #\ݐ!pH`!l `!l(!l(H 㿘!l  "    !p `*!l !w  !l(㿘`@`?㿘> nc@Y1> nW> nc@Y)J@ "> n> nK#> nG#> # `00 &a`4 &ad8!&ah`? ! @i&al "!@i&ap# $@i&at$ #Y`0 &`8:`4 &`<`0&`@e `?&a`8> #L `8   @iǐa&ax`0 #L `8   @i&a| @}&`8ax@?&`X `&`p" aT0?> >~"Xt aT5`0> n`4`Ȑ#> nc@XJ@ > n#c> c㿘#A@"+ 4#D@ "= 8#_#@@?05@"" <1? #L@ "#E@&?0% cC@cB@  0 && & 0&&& * & @    @   ? 㿘 8`?!' !p."`\!p " X!l "`p!l?"T!l"`X! !x@r !' !p."`\!p " X!l "`p!l"T!l "X@!t?#"c !t"#(!t]& 8' !p."`\!p " X!l "`p!l?"T!l "`X!@!x!' !p."`\!p " X!l!"`p!l"T!l" X!`2!x@ !% !p*"`\!p %"`X!l?"p!l#"`T!l" X!`2!|@ @Q  **!t "*& 8> P 8 (&&?`@(8 ?@ > ada`(a @   0@  ?㿘 8 & > !> "a!t ` !t2` `"㿘``@  > !` > #L 0@h1?@H 8@ 㿘  > n#> nǐ#> oR > a 2 0> # " J  20 0 &aT40&aX8 &a\&aT $ @g&a`#  @@g&ad @   #[$> #P`@aT * @g @?&`X `2&`p>Вa> o`0  `4`]?> `8㿘#A@". 4c_@"0 <c@@ cD@#F1@ cB@""!d #E@(?0' #J@"#?cC@"!d? &!& 0& 8& &&@T @ 0? > P  8  &?`@8 ?@ > aX aT(@ aT@ ?H`!`!`(H 㼐> @ `b'!"  *=    @*  `"  @*  `$  @*  ``  2`   `  b > o1 㼐> @ `b'!"@ ? `ٔ 28`  є 20`ɔ ",&   @ 2 "   @ 2 $  2  b > oڐ 0!d*` 0 !d @0!d @2d㿘> o@`H   > o@ `@   㿘> o``@Us> o X> #``@`?!> > o h` 0Q#L` @fO &dl @  #$> o`@UX " `@ > o j`00#L&a`a`&ad &ah` `@ @f$* @?&`X&`pr `al@#> a> o`0 G`4?1aT> `:㿘#A@") 4#D@ "@ 8#_#@@?08@"! <4? #B@ "!l#C #E@'?0&@!l"? '&!& 0& 8& &&@f  @ 2 @M  > P  8 &?`@8 2?@ (?> ad a`( a` ?$l (ǀ`$lƄ (Ɓ㿘.`!l@* `* `* @ !l" @$l`(< @㿘@``!"  . ,:) *`   @  `@V  ` @N  `@F  ܦ`   㿘@``!"  , *:' *`   @  `  `   `  ަ`   㿘> o@ `?㿘4> > o! 0|< `< "dt 0&dtdt 2`> o!(0g0&a`d &adh &ah@d8&apD< @d &al> # `  `?"! > #P `@a` * @d ap&`X&`p> o&d!P`0 ``4ap >&d" "p&dx&d|dx @^˖`  `0#4 ֐>taP@CaT0e @  > `0#? > `㿘 cL@"E##F@"?#D@ "~ 8#_#@@0?0v@"> <r?#A@"/ 4hcE@g?0f #J@"b?  #B@ "(!tW#C@*!tU?0#Z@ "@K#Y@)?0I (F& 2D @ݐ@ !& 0& 8& 7&5&ϒ 1 / 2*@_$   ? &@&& &@B& &   ?@   @  ? > P  8 &?`@8 2?@ (?> ad a`( a` ?㿘*` !t* !u!v* * @  $t (* av@ $t ( $t( @$t`(* 㿘H/` /pa`"a8" ߖ !p"a8@ݩH 0㿘!p `   !!p "` !p " l 0 l2 㿘 :>>>>>!l aL〘 &!&! &!&!&! b &$#b !l "!l""!l"b!l"  0 4? /!l o*  "$!l@&$"a!l"!!l"a 0 4? /*  o!l "㿘   Ē? ` $ d l3 $"l $o*  "  $ o@?l /*`@ X" l @ * $ #@  $ @? /l, "@ la$㿘  $ t?p dkLl3 $"l@ o$ `  /*  #@  4@ ` @ ol*`@  X"l @$ ` /*  #@  4 `  ? /l*  "@ l$㿐  1 "    `  $ d al?#$d"al""al@ o*`$d@#@  $ /@ /al, "@ al$d㿐  ɐal?#$d"al""al $d @ 2  (  #   /*  o `$Ò d ` oalo*`@"  4@ ` o /* al " al$d㿘   $  d   $ ` xal!$d"> `pal#""al /@ *`$d@##@   $  /al,  " al`S$d!p "$ 㿘> o@*!p`?㿘8  @a0&`0*`0> o !x*`0 㿘> o@!`?㿘`T> o! 0&dH0&a`L &adP &ah@aZ8&apD  @aT<&alap> # ` &d `?@ " @`@@ `   `  `> o!В ^ # "X> `@ #P * a`@a $`$``0> o`4 `8E"ap >&d" !&dx&d|dx@[B @`>"@g   E,2 >`T`* ``""@$``$`>ؒc`8 aT@aT,Œ @7  ?Z> aP㿘 cL@"E##F@"?#D@ " 8#_#@@0?0z@"B <v?#A@"3 4lcE@k?0j #J@"f?  #B@ ",!t[#C@.!tY?0#Z@ "DO#Y@-?0M J& 2H  8 2D @@ !& 0& 8& 7&5&- 1 /` 2*@A$   ? &@{&& &@ڠ& &   ?@U   @x  ? > P  8 &?`@8 2?@ (?> ad a`( a` ?㿘*` !t* !u!v* * @ !p*`#$"!p!#$!#$*`*  t!pb#$ ("b!p!#$!#$!p `("$"!p"$"$2` `*`"!pa"$a"$b2 !p `("$"!p!"$!"$2` `*`#"!p"$"$*"!pa"$a"$㿘H/` /pa`"a8" ߖ !p"a8@H 0㿘!p `   !!p "` !p " l 0 l2 㿘 H>>>>>!l#Ēa4D &!&! &!&!&! b &$#b !l?"!l""!l"b!l"  0 4? /!l o*  "$!lb&$"b 0 4? /!l o*  "!l@&$"a!l"!!l"a 0 4? /*  o!l "㿘   ֒?Ғ `͐ $ɐ d l b$"bl o$*` @" $ o@?l /*`@ X" l @ * $ #@  $ @? /l, "@ lT$㿘  $ ? d~?l b$"blo $ `@ /* #  4  `X@ ol*`@ " l$ ` /*  #  4 `  ? /l* "@ l$㿐  E 6   1 `  $+ d al b$d"b#** al* "bal o*`$d@#"  $ /@ /al, "@ al$d㿐  al $d"c*`*`@ *`al "al $d @ 2  (  c"   /*  o `$͒ɒ d ` oalo*`@"  4@ ` o /* al " als$d㿘   $  d   $ ` bal Z> $d"`p/** al* "bal# / *`$d@#"   $  /al,  " al`8$d㾸> b>  #'` O T`  @I(> o  Ȗ$  >' @M2'$$7 4`"2  ".  "* @ %> !$ $ $,: $ (@$ 8 2 > o   㸐"x$` h E   $`  > oڌ"㿘H/` /` a  ?t $  W  j $ ?&$H 0!p "$ 㿘N> oN , 2 N  b@Ȕ 2 > o@b@ 㿀> oJ@ , 2`J@ ``> #> o"`0r `#> ob `?@Kѐ`" b> o#($#''' 7@K > o#(0  @\&d  @\&d0 &a`4&ad8&ah&`8 &`0&`4&`<k &`@`0> o`4ʐ#8> cP`@  * @\&`X&`p@D@?Ԓ `a@e#>`o? @ (YaT> a㿘#A@") 4#D@ "@ 8#_#@@?08@"! <4? #B@ "!#C #E@'?0&@!"? )&!& 0& 8& &&@e  @ 2 @  > P  8  &?`@8 ?@ > ad a`(@ a`@ ?` $@ @$ @" @0 @ @$@ @㿘!* "#* * @j 㿘@ `!"@(` ʔ 2!` ” 2 "`  㼐> @ ``b'!") ` 2"`  2` ǔa ”b  " > oر#Hd:`(dabc*@@@ d ( d( @d`(2 㿘`!` @[<  2/` ? @ ? @ *`+` 2 3` @ * @ +`@ 3 @ 3`@` ? +@?@ ` 2$*@  @` $"@ ̈́2`㿘> o@c``?㿘 > o#p" 00+> e`aT 0?"`4"d8"h     @ZҖ &a *@Zː> #``#&b `? $,> oc@J] cL  `@ * @Z &b&b &b cL`@   * @Z &b`@< * *  @Z &b`@` * *  @Z &b &`8@Ē $@ `2  "*b @ b@?&`X `&`p>gc>#&e&e @T ?> >"X Ȗ&E> oc@I`J@ > o#b> o@#@2@3 `03``4 t `> b,o㿘#A@", 4#D@ "d 8#_#@@?0\@"'" X? #L@ "C#E@M?0L cB@cC@"&" C? #?&& 0& 8&" @? !4&  </&* ,&" 2) "ᵒ # ! 2 " 2@ 2" @   @   㿘"??#"h!" " 8@"*& 8" ` @`?# " ` ` "`2& 8>c& 8㿘 8  > !> "aH"`(" H > P  8 9&7?`8`@8 @ > ad a`( a`?`@(8 @ > ap alal ?㿐! #\ {"㿘"h  ?   "h!" !: " "(" 㿘> p@` > p@`   㿘> p`8@G> p0> p`P@G> p @`> p ` 0w> # ` 0`? $@X&at> p`@GŐJg2Ϣ$ $  > o> o*#c@  > p`@G> p`@G &`8&`0&`<&`4d&`@0!> &a`4#L&ad8 &ah  * @X&al`@ * *  @Xy&ap @ al&`p&`X  >aD^"aT?aT$K`0> p`4` > b|㿘 E@"J c_@"3 < c@@$cD@;?0:#H@"6?1#A@" 4.? cC@ cB@%L@"!? #J@ & & 0&&& * & @I   @E  ? > P  8 !&?`@(8 ?@ > ad a`(@ a`@ ?`15!t 㿘` @ >aD!t     !t2` `   㿘> p@2! > p@,! > p@&!   㿘> pa@FL "> p! > #``@`?> p> p!(` 0jaP @0&etPH @W^ &alD< @WX &apT>&a`X&ad\ex&ex&ah&e|`@Q  @ $# > #P `@T * @W4 &`X> p`0!``4c&`p  `0# %  v>a`0#  %"?0?0`? "aT> b5㿘#A@"- 4c_@"/ <c@@ cD@#F:@ cB@"!%t #E@1?00 #J@",?'cC@"%t%?"&!& 0& 8& &&@\!t  !t@ 2 @< ? > P  8 &?`@8 2?@ (?> ad a`( a` ?㿘%t  !w.`* !v*@ !u* .`* !v*@ !u* !t* @ 㿘@`!"P ! ; ,   `@[  2?`@S    `  / ,   `@<  2 `@4    ` , @` @"  ״   㿘@`!"Q   9 ,   `  `    ` 1 ,   `۔  `Ԕ    ` , @ `   ״,`   *`%t!t!p!p$  `"!l!l 0  㿘!l` " `  "` ϔ! !l  㿘> p@ax`?㿘00`T&a`4 &ad8&ah $@UY&dl .@US&dt P.@UM&dx  @UG&dp  @UA&d|> pa@DHJ@ "> pj!> #`` > p`?&`8a$@DB&`0> p#a@D<* `0&`<> p&`@ &`4M!> cP`@  * @U $`$` @?&`8 `Z>>>>>>&`8&`TaD\ (at#$`$`$`$`$` $`z > >"X R?&d@  @_  ƐaT> c 㿘#A@"+ 4#D@ "5 8#_#@@?0-@"" <)? #L@ "#E@?0 cC@cB@  0 & & 0&& & &@< ? > P  8  &?`@8 ?@ >  ad a`(@ a`@ ?!l( "l( #l* 㿘$@{`$t^$l  @"  @ 0  @    0@$x?n?"n$.#$.$. 4? 0*`? $.$.  $. P$.$.  4  0?*`  $`$` $` !l"l#l$` @ > h "ؖ @+@` @`+` @ *`>b`@Y&$ $.?$. c?$.#$. 4 0?*`  $`$` @  $`#$.&$㿘dp$ ` #* ?    > p!`㿘$p`& ` ` @"?&& `& &  㿘$p$Ð  #l!l$"l  * @@ * @$ `  $  $ $p `" 㿐 $t$l F 7  `  $1 d   + ?$&? \/ $n. *`$n  @  $ $ 㿘  $t$l \ `$ d??  .` . / @   P@ %@ %` %`%`㿐> `Pp#\ $  +` 㿐  P#\w 㿈 @! (  t l ʰ@   P& *`&   ?* @&`&` 0  P#\ DH 㿐#\ D o 㿐 #\c 㿀    P#\ " 0S   dtdl\` `$X*  , `@ PO&`8`(R   P& *`& ?* &$` " * $` `$`* $ 쀢` * $ 쀢 ??$㿘$ ے > !> "a㿘"D >  "clrE 0> #l`   p  ?" D@ ې> "Ѐ2 23f#"0㿘 #%"Ԑ D@"E" D@?2"ԁ㿘?# %#"Ԑ D @"-" D@?2"ԁ㿘"4 `  `1  " >  > (  > # !`2 -"Ԁ " - !`2 -"Ԁ    -!`2  "Ԁ "  "Ԁ> " 2  %D # %"`㿘> !`!"Ԁ``D `h@ "?"D "` " l@" D@ @" "㿘> !`"Ԁ "8  `` ` 0 `Z0A0>㿘"Ԁ  D@ "4  > p!X =0  > p"L 㿘``@ " "` 8#@ 㿐 > pbH @쾐> p bP`? @춐> p`?b`@쯔 4`? "> p"h0> p' "&b,&bؐ0  @P̖ &bЀ   7> Ǭab0b`7> Ǭab0b` 4 bP`@~  2 `P 2  ` `H&bT`L> p&b\&bX$`Pb@? %6bP    bT   bT @{?* @ @* > p&"&bX&b\6bP&b& @&b '8>"&bbW Rb &> "@   <@    ` > "@ ` @$ Ȑ>!D>>>al>>&b &b&b&b&b&b$&b&b># &b(>a>&b >ᨐi   # k  #0# bԀ   #[  % V   Q p 0  % H g %>` &bbԀ ">#0&b&b@J X㿘``@f 2 4 6  2  Ւ ? 0ϒ ?  㿘 t 4(@ d4(@ th@?Ȅ2h@h@(2h@ th@2h@㿘 t d, , t ( ( t(㿐`x􀠠"q>> p>>>>(!aȔ(> }#@&bL&bP&bT&bX &b`&b\&`p0 @OZ `p&`t!?'> 'Ö > """H> p# `p֔ &`l> p##> cL`p  @q|2 cL`l  @ "`p> p֐# &`hb\`l> # Ԓ&bt &bp 2 > p#@> #8  ̒  @ ?&blcLb<`l &bxcL`p" K&b|>>>!4aXX>0#@&bL&bP&bT&bX  &b\&`p&b`(H@N&`th@?4  @ * " `p@Nߒ &`h&`lhD?! 4hDb<* 4@ * 4gb\`l€`p`l`p$|# &bl&bt&bx&b|&bp#P0XE@ `> p#`0M( >!>>?`l"$$$4T$ܐb`> c*@ > p#xŒ  >"&`0&`4`0@HĔ 8 4 8>"&`0&`4`0 8  > pc@ ` @"$ 㿘> pc R  `@$ 㿘"t"`` ` t(@"""t(D> p(D (F#v (Da4(D"t ` @ @  `P``@``@` > p Z# `@& "t `` ` 㿘#P"t!p@ې`",` @ ; > 㼒`?& -# $ 2` ( @ 2 +    2 +` *`*2(2`2* 2 @ @* 2@  & 4  4  4  4 #㼐@ @ n'2" *"*2 3 "  n #@+`3 +` 4 @㿘# ̐c {c`6 6 ʗ*    > p͐#  4   @& +& > q   > q   0 > q  @  > q  P `& 쀌 > q 某 h  ` & & "d  # #p* @&"d |` 2`@ ?"@& x& & @ x㿀".`!''2#T#P 2?*`  2ap @ &`@ &@   & 䀢 !> ! "2`$!  ʭ  $! x㿘 ?#\at#X'0+> q*@`@` Ԕ @0  `2 * @2@@䛐 &*`@  2@䐐  &㿐 T`@%| 8hd6 Tx ഀ`ph*  2*` *@ 2* <# 2`*` 2 $* h "@ 'p  p M   $p$t$ x?$x A *  e    @  *  2  %(  > q }1,2  ; <"@@& <,* 2,2`2`@ ?"@$$%|`hx dഀ`ph*  2*` *@ X2* <# 2`*` 2 $* h "@ ' +  ( ( +  3`+  3`+  3@( n#+ + 3`@ 0+  n#@+`3 +`t 0@  $4ʁ㿐H /f * ' "l "\€"p "\€"t "\€, h$@' ,  * *,@ n`$ , 2 , 4` h l"@ ' `,` `* `*"L@"P€̐ d @ "t  @W `H 0  H 0 㿘H /f * '  > q䀐  ̢ x ;6 '  @f` @& > q k ` @ > q!_ ̐`6 ̒@G H 0 "x"t`' 4 !"P@>c$> aĒ @* ! L0@   㿘<%6`6`6@ n&@ *"t*2`@ 26`  23@@ 2`3@"t   ``$@@> q! `@> q!8 0` ?> q@ !X`> q@ !ڒ 0> q! Ԕ㿐"x# "|"\€ap"| 3@)#< &> q0!!,!,&*@ at#`&  "'0, "    !p 6  , "    ? !p 6 ,  @ *   n" *2 * 4` ,  !p*`@ h  2 , "     !t 6  , "    ? !t 6 ,  @ސ*   n" *2 * 4` ,  !t*` p  2 , "    !tc| & cc& cx & & !@  2` h $' `* `* `*    n!t"!p" "tcT&c\?&*cP&*cX2&  3 n'2"@ *`2 *`" 2㿘6@#6`<#! 6`!l*` "X#`** ** 2`@ 6` n &@ **2"t 3 ` > q@ 2 > q ⠐! 㿘"x< n#$ *`"t*`2  4`4"4 4 "h ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  ' > q 2 n> q g"(0J!$ *`*`2  4`44 4 "X"<    > q > q G"H0*)"t   `k n" ̖" * @*"t2 6 3` ߖ "t `ؔ "T`@ 㿘  ʖ 㿘 H /f * '  a@" Ta @"  TG a2@Ba1@ ? (!1 6 T ` L x"00@ #$"h T @ @2 T T ?"6 T  @00@۠ x x`4  T @ @   H 0㿘"D !l&   +#  4  ̐ @ߔ  "   "6 ̒a xz  *@ *`@    &  2 &"d` * ( 22$  *@ `   `" *`0*@2@  `  *@㿐0cX'   !t *@@@> q+ @  2*` @߭   ?` ɔw?#Xa@* @ X h"" #!"0"@ &`є  <@< @  @  @   @  @  @   "& & <@< @  @  @   @      "  2 &q !l  6q 8#   @  @  @  @   @  @   "  2A&E ה?    "& &`2  <@< @  @  @   @  @       &   @ &  ??$?H /f * ' >  ֣" &@ > 2`  2@"@@" @$"@2`@" @"` H 0@  ۰?+?0Ԑx&` &` &`>  ض' 'ܑH /f * ' b[   6```4&`&@&`6`H 0`ː &` (.` H /f * ' > #3 &`$H 0`$ (` &`6`&`0&`(&`,&`<&`8` (8&`  2 &` > #Ȓ @ 8&` ` &`&` ` $@&X U !@ at \,`  2 *` ` !"" `@@X@& / @`X@& `@@X@& `2@ `2@ݥ$*` ?c 2@ݗ $ """`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"("(""""`"`"`""X"X"`"\""""""""""""""""h"t"À"Ì"Ø"ä"ð"ü"""""""""(""""""""""""""""4"@"L"X"""""""""""""d"p"|"Ĉ"Ĕ"Ġ"""Ĭ"ĸ""""""""""""""""""""""""""" """"""""""""""""""""""""""""$""""""""""""""""0"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""<""H"T"`"l"x"ń""""""""Ő"Ŝ"Ũ"Ŵ""""""""""""P㿘 <""> > q6"a" H 0"& 0 0 & 0㿘`> "!""(`?*   *  `>`̒a@r > q"ݜ`+ `6"@`4`> q݌"`> q`F"`6 *2݁4``Ȱ  64` F4` 3,` / ,`4`"$ (㿘``@ 2# 2   A` ?  .` ` Ѐ` "@q ? $  `    x  0@D & &`h> #d*` &`|> q"0&` `x"??`  @o#&`&`@Ӓ#` &`&L j  &`> qۄ#@Ò&La` =  `+ ` "@ ( `  `4 *` @ *``` * $` .aB&`.aC.aD.aG.aF.aE&`&` 0#\#`    @  2`> qؐ#0̓,  S,, * `* @` " > q@ `> q#8> qܾ#@aE ` .aE͐aEaB`.aB `, `" aB`aB0> q #h ܠaE ` .aEaEaB, .aB , * `* @"`aB 2#`aB#`#\    @(  2aE ? `.aEaE, @*``@*`aB .aB , ` " aB``paB` `@ > q#O0C> &`0&`4`0 D`  "@n0 8 0 ?耦'?2 '`@2' @-Q 'aH ä ``'@n4" @-= >`$> !ē*@ `    㿐`0@٭ >  `&`&`\  6`6`&` l&` * "`2%`ؑH /d4`֐* %`ր  !> q`֒ # d `ր ``> q#Д``ؐ 6`#\#`   @a   ! !E? `.!E!E, @*` @*`!B .!B! +   " !B``B!B`B`> qۉ#6`" @ > q#~6`> ry `ؐ#\#`   @  2!E  ? `.!Ez!E, @*` @*`!B .!B! +   " !B``c!B``@ > r (`ؐ#\#`   @  ,    2!E  ? `.!E>!E, @*` @*`!B .!B! +   " !B``'!B``@ > r P 6`6`6`.`.`<#6`ޖ``  }2 2 ? `ؐ#\#`   @  2!E  ? `.!E!E, @*` @*`!B .!B! +   " !B``ߐ!B``@ ^> r8 x #``ؔ #\ @a  2!E  ? `.!E!E, @*` @*`!B .!B! +   " !B``!B` `@ '> r ڇ6`֐`0.`Ȑ  `> r` s `` ` &`ܒ"`> r`: #\_ `ؐ#\#`   @  2!E  ? `.!E`!E, @*` @*`!B .!B! +   " !B``I!B`"`@ Ȑ> rI!  ``ޒ` ?`ؘ#\#`  @  2!E  ? `.!E!E, @*` @*`!B .!B! +   " !B``!B`" @ > r!PN6`?#`    2 " `܀@ ~`2  `倢  ~  } ~> r!pٷH 00)`Ô"  @*ʒ  > q"@ ` @"$ @m6`  `֑H 0? 0 > 2 * " ` `` ( ("` ( ("`` `"`㿘?2 >  #` 2   #*  > r!`Ka 㿘? 2 > `2   * @  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@u 0}| H /d4 * %  "H 0e  Ȓ !_  Ȓ & ȓ*`` &!  @mҔ M ր I G4 E  "  Ԑ 4 ?# @4 Ԁ2 3  @m , ր   4 ֒@?`4# @ `*  *  > ȒaL @m$   @ $   @9㿀?2 >  #` 2  6M #* @"G ր  آ'  @ja" ?'Дl@j~"ր  )  `6! . @ ` "   *@$ *@$  $㿘>>=!L l 㿘>>=!L l  㿘?2 >  ` 2  60?* @    *@2  Ȑ r " ?,` `?( 2` 2  d ?㿀 D? @2 > `@#2` #*@   T &   (@A <  u& 4ր  آ'  @i" ?'Д@i"ր  "  < D  " < O& 4 OȖ @l̀ $H a > ` .` 0t.` 0r 02 .`  .`  `?.``.` .`  `?6`   `?.` 0Y 02 .`  .` .` .`  .`  .` "6` .` .`0B` .`  ``0   ` `  .` &6`   2 6` .` ` .`  (@.`  @S @.`  @K 6`  (@`  &` $@`*   = .`㿘` \ 02r !B = @q  2g !B 1 `!B  ` 2!E!> r!B ! Ƙ 2Q !B !B!E (!B!> r!E !Ȗ  2? !E !E!B  `א ` ` > ry!.!B `!J , *  * @@. l     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@㿘!B 2?> rE!.!B! J@  ,`*  * @@ 2$> r/"("(& (?"D l 2`  2 * D T`ȕ*    H @g< 2#<> r Ք"!B,`.!B , *  * @"`!B  !B &$($&(( "@%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   A`0@  㿘.` h*   * `1P2!Gk !#* !G @Ӑ !D.!G`  .!D0=> r0O> r0 `@2Q #> r b0   @ @ C Ӊ"8 * h2 *` h2 * h2 *` h =*  h * !C  .!C0> r0 P> r  `@2 #> r b0 ~  @ @   @ J"P㿘!D @ h B B  a ?  B   `  ? @ ? ``?  @ 2!D- @!C 8!D" @R !D !C .`*  * @`!B "    "!Bx  |  @   @@  *@  =  `ې ` *  h*  h2`* h2`*  h2`* h*  h*`   hg ? $   h `  @ "$ h `@Р > r0"x h *`  h ` "@E ?  h ` 4 > r҈" *`  |) 㿘!B` > r"  h *`  h ` "@ ` h `` ? v   ` ``0` `2m !C?.!C"Y!F&` /   + 2`*`  +    `` ;`0`"`0J "5!EF  "`4`00("0`$`0*` " @`0`,<@fjH @`0`0 0< @K# LV`0!B!`.!B `*  " !B`2 !B !E .!E` `@ &` ?  .!F!#*@ !D .!D   4@( `2 !D!B "!Dx!B!D!C!B@!E@ @ ` > r" R  > r(> r> r"I > rF#㿘`)!D % h ` #> r!F!#J@ @ɐ !D.!F.!Dٔ P "іc  !D  h `"!F㿘 h ` @ `  @> rc0 ? > r#P> rj#h `  *`       ǐ @ĕ-  @ !C?.!C 2  ` `$ $  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*` `  ,@ &$ 4`  @ 4`   @  @% ,`  ` a >"@,`  (@$`!F ?  `.!F!#*@!D.!D/ M   ` "9 ?`0`A 9 ?=   0`0 ($`4$`0 $*` $`@$`@ ,`H@e`< `< 0`@`0"  !B!`.!B `*  " !B`N!BJ  @$ !E`C.!E  @$ !E`.!E 4 2`4 㿘     > r# 0  D> r `# `a@  @  @  2> r> r##` > r` #` @c"  @ > r# > s 2> s> r ؐ#> sՐ 㿘` ``?` ?`@&`!E .!E`?&`!E?.!E? X` V `$ + ` `("  @ &`$&` &`(``   @ @@3 @/@hk?- ` &`  `.2 *  `@.2  .6```ܐ ?6 ` " @Ԑ. `@ . !F 0?. `  `` < `&`@2( ``4$ `&` .2`*`  .2  .&`!F ? .!F !#* !D`.!D  (> b ' H /d4 * % !D!#!C!B y)!E!y% H 0@ ZВ #\> s  @Τ > s H`!H7> Ǣ?)> s   P - ?> sڐ X`)> s  @Ґ P @- @e ? > sƐ   %> s  2  ,  @@ @2   3 #\0`#`Ь  `40 !H7> > r"О H /d * %     `  @" ?` ?"`  @ ` " ?4` > s v  ? d H 0Đ*T@ " > ss 㿈 ` {'>!t*` €     Q Ѱ  ͑* R  ư     ` 6?`!?> *` € ` @ш `倢   * @ %6   @n `倢 2   0 ~ @_ `倢 x  2r   @aĖ ``  v @a۔0X `БH /d * %  #``ؐU#\`,`0 *  * @ `.  . !E? `,!E!E !B!`,!B `*  "  !B`2!B   vPH 0 @a >* > s > s > s!> s! > s!8> s!P> s!`> s!x> s!> s!> s!> s!> s!> s|"> sy" > sv"@> ss"`> sp"> sm"> sj"> sg"> sd"> sa#> s^#0> s[#@> sX#X> sU#h> sR#> sO#> sL#> sI#> sF#> sC#> s@#> t= > t: > t7 8> t4 P> t1 `> t. x> t+ > t( > t% > t" > t!> t!@> t!p> t!> t!> t!> t !> t "> t"(> t"P> t"`㿘\ `& & 0& & & & & $& (& & & & ,"|"""""""""""""""""""" ""$"0"<"H"T"`"l""x""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""p"d㿘 <""> > t"a"u H 0"& 0 0 & 0㿘`> "!""(`?*   *  `>`̒b0@a > t"w`+ `6"@`4`> tg"`> t`F"`6 *2\4``Ȱ  64` F4` 3,` / w,`4`"$ (㿘``@˨ 2 2   u ? А@db@ @  p  0@3 & &`h> #d*` &`t> t"&`x&` `p"??ܔ  H@^ #?ܒ H @  'ؒܔ  @^ H H@_ؐ H  @> t"`0@ʟ H&`&`  6  &`|> tP# @ʏ `   +  ` `|@ " ``4  * ` @  *@ `  * `@ ` *``  @*`@ `  *`ڑ+ `|&```h 0&`&` 0 #\#`   @ ` ``2  ` " ` ` > t@ > ṫ#0> t̄#80i> t̀#```"> t> ty#x> tv#`" `h`@ А> t#k0P ` >> t`b#> t_#> u\ 0A#&`0&`4`0 R` " @^> 8''쀦'?2 '`@2' @` '`  ``'@^C" @L >c$ > !ē* @ `    㿐`0@ɼ >  d`&`&`\  a&a6`6`&`&a,&a* *  | * @&` l&` * "`$ H /d4`֐* %`ր  !> u`֒  ( g >`ր ``> u 8Ò``آ 6`#\#`   @    "   > u˩ H;6`"@ > u; `> u˜ x<#alan6`6`6`6`.`.`  }2 2  &`ܐ &``܀  `#` #\ @  2`  "  2`܀ " `ܐ@ɠ`> u d6`> u_ `0.`ǐ  `> u` N ``u`u &`"`> u`: #\ :> u +``䀢``逢"``܀@2` 連  䀤@ 耤   `> uɈ!H``$ݑ+` u??,`2uu`ئ#\#`  @>   "   "`@M> u-!` ```u| uxut`ؘ#\#`  @   "` ` " @!> u!ʼN6`?#`    2 "``@`~`2  `逢 `~``}`~> u!ʓH 00)adr"  @  > t"x@ޒ ` @"$ @^6`  `֑H 0? 0 >  P2 * " ` `` ( ("` ( ("`` `"`㿘?2 >   P` 2    P*  > u!В`'a 㿘? 2 >  P`2   P* @  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@u 0}| H /d4 * % !dq"H 0e  Ȓq!_  Ȓ & ȓ*`` &!  @^ M ր I G4 E  "  Ԑ 4 ?# @4 Ԁ2 3  @^ , ր   4 ֒@?`4# @ `*  *  > Ȓa @^$   @ $  @E㿀?2 >   P` 2  6M  P* @"G ր  آ'  @[=" ?'Д9@[Z"ր  )  `6! . @ ` "   *@$ *@$  $㿘>>=!ܘ l 㿘>>=!ܘ l  㿘?2 >  P` 2  60?P* @    *@2  Ȑ r " ?,` `?( sf2` 2  d ?㿀 D? @2 >  `@ P2`  P*@   T &   (@ <  K& 4ր  آ'  @Z" ?'Д|@Z"ր  "  < D  " < %& 4 %Ȗ @]̀ $ u  C ` *  r"@> u"$ ǝ . l   $ $ $ $ $$ ($ $ ,$ $ $ $ V$ 0@G 㿘`쀦> u"D T`ȕ*    H @YM< 2<> u ^"0! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   `0 㿘 h  5P v " @0T> u0&> u0# `2g`1> u "P  @ `  Y` А @b@ > u> u{"X"x t"@F 2  h#P"< > uf"@* h2 *` h2 * h2 *@ h * "@0> u0P> u `2`1> u "P b @ `   `@d/"Ё㿘 @j ` |x 0 ` 3`"h`"  & @ ` *`>@ @2 &   ?, *@ |*`  !  *  ,` "@ `  *" @@ ` *2    ` @ Ѡ` @㿘@ `4  hBa     ? @ '   ?  @ 2@ @@ ` 2@@@ `" h`@ 㿀  n3   @ *  2`  *   `*` ߐ * ` *`   * `   `@*  h *` h2 * h2 *` h2 * h*`  hq ? $   h `  ` " h `@0 > uː h b@ 2 > u2# *` mӔ 㿘` > u# Ű  h ܒb@  ?      |` ``0` `2M4"H4&`   *  2`  *` `` 0`0`"`004"*`,4 "`4`00("0`$`0*` " @`0`,<@X(H`0`$`"! |@`0`0 0< @# >`0&`d` ? @&`4`? 4@ 㿘`  l, @" "   `2    ,  P㿘 h `  > u#0 ? X > u#H> uw#` ` @ @*` `  *`  ``  @" @  "   2`  $`$` @ " ` " `` @ `B2A` < `$` `(`"$` $`($`0$`$, $`$`  ,    `*`  , `&$`4 ` @` 4 ` @` `@0 , ` ` a >"@, `(2 `4 4 < ` ` ". ?`0`0 + ?,  `0 0 ($ 4$ 0`$*` $ @$ @`, H@W+ <` $"a` < 0 @ 0"  $`=   @$`h  @$`  - @`2S` 㿘     > u8# 0  D> u `#.`a`  `  `  2> u> u##`> u`#`@rc"  @j > u# > t 2> t> u #> t#㿘`@``` ?`@&`` ?0&` R` P  `$ + ` `("  @ &`$&` &`(`` !d @0 @+@\ @X@Z?' ` &`  `. 2  `@. .6 ``` ?6` " @.`@, .0'`  ``` F ``&``@ `` `&` .2 `@ . .&`㿘 H /d * %     | `  @" ` ?"`  |@ ` " 4  > u ?# ?  H 0> !ē*@ 㿈  ' 6  0z&  u q  i  0c a  ]*  Y  S   @T `  i @T0= БH /d * %  #` #\ 2    . . "    iH 0@T [>0* > vU > vR (> vO 8> vL P> vI h> vF x> vC > v@ > v= > v: > v7 > v4!> v1!0> v.!P> v+!p> v(!> v%!> v"!> v!> v!> v!> v"> v"> v" > v "0> v "P> v"`> v"x> v" "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,㿘``@E 2E > !`2@  ?2 &   24 > v@-b 2- > `2 & > v@b 2 > `2   i ?2` > v@ b 2    i(?  㿘` `   2> >  t p&e   (@(O ,> > >>>>>` |ؖ@ $aT  6`6&`L&`D6`:&`&`&`&`&`&`&`&`&`&`&`&`&`P&```'> v>>>e"c&`&`&`Ѐ&`>>"tb&`&`>>>>>!#Ȓc&`&`&`&`&`&`"e &`ܐ &`e  `ܐ &`ܐ &`&e!@&e wj  &e> v"Т`0  e" &e>"&e&e&e  "    e @"`  e  ` !@&e > v"e> v> v#ݒ`>  h`> v#(Ԓ>  l `>@ @r6`><q!4 >@% > ?  `@2 @ؐ >Ӓ-  @ϒ 㿘  h`> v#H@W& <}㿘% %  `` "> v #` > v@ y#x` # 쀊  & ! # (  > ve#> `h @W{㿘>  h`%> vS#%耤``2"  4 ki 4 ke 4 4 4 4 4 %4 4   $ kW$ $  $ kQ  $  㿘  > v#% ? `  > v#034%> w ~   @  `> wo ( &  $ $ $ /@   &   @QӔ  $  > w  H&$ 㿘 ` 2 > wG x "> wA " $`   @R $$ $` 㿘  '%0#cP+> jՐ d%耢 `` `h> w  `$`h > w 㿘@%  4 %? 0%?`#2``#2``2`` 2`2`2` 2` 2`2` 2`㿘 `  %> w!Ғ>   h `&%> w!(R ? @4   4 `    4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  "  > w!!P@V<   *@  *@  *   *  @*  * *@  4   h` & > w!㿘   %> w!0 ?& `?# @4``" `> wא! ", `u&  쀊 o``%  & '> h "> w!4  > w" `O& 쀤 $ > w"("@h& 􀊠& > w"H :` 5> w "h`` `'?`  @0`? 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` `* *㿘@ %  $ % %   㿘 `  %> w!>   h `&%> w!(     ?%   `h  > w"  <$ % $% `` *  > w"    @ *  *   *@`  > w"Жђ   *@  * *@  %  `h` & > w!㿘   ` `%> w!0 &   ?$  @ "  > w"@ ", `;&  쀊 W)>  h  $@ > w"H4  > w# `C& 쀤$ > w"("& &  5 `   "> )`&>  ?2 + 2+` >  @ 2`+` " > 2`+ 2 +`` " > 2 +`"` "`$ $  * *@ h > w"H-㿘`` @ > @"p > @|" > @v" > @p" ` `2  > #L  d& 48@  㿘4` > "0> "> &c&c&c&c  &c&c&c&c&c  &c$$&c((&c, 2&b80 @# &b> &b @bД ! А@b@6c.8 *>  <@%>  @@ > > "@ " > "@ " > "@ "  > "@ 2>  > @"p > @" 2ad&c(ad @ca &aH&ad.a^ &aL@  >Œb "$c6c26c4&bb `6c66c06c8@g&bad? 0 &adc`  &ah&adH /d * % a  &a&aH 0 a`i&aa2   "a^a?`Z&aa&aH 0 0P  aH` 0aH   ma2   `pa?`1&aa&aH 0 0' > "d  @  ja2   `N` @  a?` &aa&aH 0 㿐V#0> "` ?` 7  7 !^  ` `7 7`  6@*` 6#2* ": * 6 2` #0R ` "2` #0P ` " 0 㿘!䀢 2E !\ , qŒ &!@"!\ , q @&#  ##@M> &!>  #0! q  &!>   #X@M( &! >  #6 㿘!`$* `!ܘ ` d6> !  `  @M 2&`,f e` #<?* `"`> #}  /  !ܒ `2* @ 6>  #` ` @M`$ &`,< f #<?* "`h   @`6   @6&$@&  ,`,@`$ `$` `$`,`,`,@,``$ &$& 6..  g. ...b͔ @㿘`(>!H`$`(` " .6#<?`6> #  ?> Ǒ6?"a  `$@MS` 㿐!xB!H >Ő#*` €>   :`2> >  (!`>  !' (`` % > w H> t X!7 4>  `p 4>  }' ? N&`>   > X  @B'> > !`a,``@2`> 2` ??̀ > A Р'@- " `  > 0> 0 ?*  ' U `'  L ` ``@Ǒ,`&`㿈@> 6` a `J6`6` 8 ? ` <` &  `4& >Ő#4,` €, ,  , * ,%  %  @@ِ @ ,@ @ ,@ 0`& 0@i @ ,@ݔ@\ @Ք ,@Д@vO @Ȕ ,@Ö@   @ ,@@      p. % W "S% O  @@ ,@ 6` 6` 6`  @ `@i  >  `  > !@J p. @ %  *% , %*   %* %*`%  㿘  ,@,``2   @@_ ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  @2    $`  @$`   $`  B #@$` @n``9$`?  @    @  b #   `?$`$@  @> ` `"  $`@ @ @ b@ #$`$`$`$`@` ` `,`,` #`< 2"7 2 - ) &`` b`     `   `( #`㿘  `,, `,@80`2  @@p   $ ,  " 2  " "        @`    " $     ?" $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1     $ $ 㿘`   &  & & & @z&  㿘?.@6`2 `*  ?  & & & & @c&  `2  2&  & & &  ?& & & & &  㿘?.@*26`6.g<  & & & & @2&  g 2&  & & &  ?|& & & & &  㿘?#@#@66/ *6`..7  @ ?#  & & & & & @ @ ?2&  & & &  ? @ & & & & &  㿘.2`&`&` > 0 > 0=Ks  !2 &@` 2&@  &`& ?&@㿘/ /` (`67`7 @20`0+#" "   &  &2&  @@@&&&& &&&&  0    `?㿘@ ` "`` 4` r"@@ڐ "`` $``  2 0`1 ? #$`㿘@`* @ [N E2`M`4 Y Z"@@Z  `@2 9   @& `,@`@2> Ԑ!8 @`@"` ` & u "11 #`,`1?*@㿘@`* @Z >M'@2`&J  ="@@E  `@2 @ 5&  @& ! @* <ܒ `@"' ` &  ?1@&1 & 4@`, &`1?@*㿘@`*  @Qc@2`&<#@  "@@ @`@2 %@   @& $ } `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@ 㿘 > > & &&x&Đ! 㿐   ,@ ,   @ 2`@`  " 2` $`  ` ` ` `'``  (`) , 30`1  @ 4 @D    (`) , 30`1  @ 4 @D `  (`) , 30`1  @ 4 @D   (`) , 30`1  @ 4 @D( # (`) , 30`1  @  4 @ $`$`$` $`$`$`$`㿘 `   `@Q       B : "! 1 B  (" @ B 0!    b`    B @ b`(  @@ B 0@!    b`  ` B  b`(  @ B 0!    b B `&    b`(  @ B 0  ! ! 㿘`  &> D!0`r   > 6!H# ####1 `_      `?    `$`   ` "(+@+(03@3  @ 0##### 㿘` ?    ?`8#  ?@ 7`@  6`@  .//@67@/`@ .`@  670@./@(@!#####?   LL     #b,#b,#a#a#b,#b,   9F (fɀ  ( 4("@`> a ) !> ""T@!> !ؠ"T(> $ H,"$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ`>А" "@>@!x!> $ H   \ d@&d `@IAb v > @!`  !> @4@ƒ!p 2> %!@N!p 2> !  > !$?> "  )> '> #?P,  p҂@` ` X@`? @ ,  p҂@` ` `> "@s?pZ ?p "> @"蔒  @@t" 2> Ӑ#@" 2> ː#0> !?* > !"""b  > '#t=@`?P ?P*㿘!> "#\@!> #` #\`@ @@*# @ L -#> ] `AL @` '> # L` @ / 2*@*@L @%? `L , : ے`L :d L?$`L  / d L  /2 d$`d $d c\L / c\@,@# @ ` .L - #>  L c"b d a"b4b  L sb  $b $b$$b@G L $bx> "> Ǩa ' 2N`> #`"' (''ؒe`J@ ,!`]ܒJ@ ,!`U! N@ x>@N` d2> > cpcx@4 > #d?& & & `"d  N`>  @ ؒ?d& & &  $dN`> N@  v @ & d& & $  i l'`sN` e#`s>  @c!> # d?& & &  $ dN`> N@  K@  d& & `& $ d2"N` d t r2"> ">   >F & A>> cx@ !> # d?& & &   $ d> #c> c@ !> # d?& & &   $ d> c> c@ !> # d?& & &   $ d> c@  d& ؒ`& & $ d  > #> !`LJ 1ܤ :  : N`> N@ ϐ@d d& & & ~  f@N` d`l> cؔ @Q> # dؐ & & & h# d`l!`sN` e`s> c@: !> # d?& & &   $ d> c@,  d& ؒ`& & F$ d2E"N` d t r="> c@ !> # d?& & &   $ d> c@  d& ؒ`& & $ dN` r  >  \ N@>  Sܐ@ d& &  & $d" > #㿘>  N`> %> #> !>  2   `  ``a 0 N 2 > ސ 8>  㿘> !`,> #`'> "bP@ "> @   >  @ `"?@` &` &@L *?Ѐ &@ $L 0` &@㿘#> a܀ !> >  p!$ $aܒ!$. @@H > "d> > !+> `)>-> /> [1> > Ț"` `=>  !<`/`$` *> @$ @`$``$R > > "bđ*: * @*` " R    2`2 >  ' > cL' l'> ! "c>    @> @`Р> @t` >  { c@}c! x"@'' 2> e! W{  Ws H o@@a@%ἡH/ /!@(@7H 0㿘> 8!0㿘@'#@$#1> '>  H!H@M#耢 "!H#@!H!H@ "@H .,@!H㿘`>  !P 4  0 "> > !p!x>  4!` 㿘> !x 2 &!x@ 2&!x> !㿘 " !> !@F@Ғ @m ! 㾐> "'@ !> a@!?#> @`Ѐ  `@> @a " @  > > !Ȓ3   > > !' & &@ &  ,U6> b  @ ? &   > > "( <  & (>  bX@ @?" 9 %> @` 0 c@  +`@4  > !> > a!  *@ 4 " * @" # , dӒ    > > "p <  &!0> >  , ! 2? " ? @ b " > "ȁ㿘`@`?P> !` > !> #>  h  > > @La!> # h@ >  m h 7 @!D>  '#>ҐbD ݒ@ !D> "> #\c'''bDΖ  >  > "Ѐ "''D  2'0> > #" )@# 9> "-> 1> 77> ">  )> '>Ғ @@|  @ƒ!D''''D @    9> "-> 1> 7> "@!D>  >''D''n ` `LJ`> > #" `` @ > #"``@Ӑ_#8 &P> A (#\'L &)> '>ҐL  @,'T  D/ 2L `Q > >  А@  @i> @` 9> a@_ @ 2 '  > ``@Ր> `h@ѐ > a "aa  >ґH 0+>ҒD'ז @X `> !`& "<  "<@ > "8>  ''' p> #L ' 'q耢 "!;!? 3> @!` > c >  @ #> `@? > b @ ( @~`h >   ^8> !`> 0 > !$> !$$ А r > #  " & 4%> !`0$" >  % 耢M O>  $$  @ >  `> !0 Ȳ @> cP > !P> 0> !x> !  )`@@V   >   $$   > Ґ!^!㿘> !`> !R > #` €>  0!9 㿘> #`€㿘!> !X˖ ?" !X.㿀!> "'  " > " 㿘> #`€㿘> #@€㿘k > `> @L!  ސ > > O"0!'> %> @9 #>  А@; @+Ḁ  @$H ǒ 2 ے 㿘!> #` > "P `@ #@ 㿘> #`€8@ 㿘> #  8 |@ǐ |€0@(> b>  #'` `  @ >  d >  d&@&  @ b b > W"㿘> a? >  x"@ t@㿘> a? >  x"@`d€> # 㿘> #`l€㿘>  "  @@X@ ``?>       㿘@%  > #h> c$ > 5> 3>   xؒ  2 cђ   2> ʐ 8㿘`A @@? , : .@2&> #$ -?#%>   @   2  *   `*` @*@ & 2  @  Ԑ?  2.@> # d> ? 'h'> "*#<@  > "4%"4? @2  `2` `p] `4 >    > # 'h1> -> U> "0`>  " "b0> 1#Ȁ> > `# a " > #p@   @@W ?L@ *  ,@ l l l >  1>  G-> '>  h @ :?8'hܐ > `#ؒ  bΐ#@Ȓ ߒݐ`>ΐ 0*` €?'hl? @2  `@?`n# @* ` * 'hlh%4&"8 >%< 21 "?, # ` ** ? 2`   2 *+  > 'h%4""8> ?'h "b8h> ""<  `b>  g aYb  > >"Ȕ> %b0K"`4? 2  >la2 > %b0  a `F4 <B 4b?<?$2 @2  2`  2 2  2 @2 2`  2 2 b<#b<"?"8b<&"8b >  @㿘 '> B "+  @   #@ @"   #  @ @ې8, >  H?Ҥ0Ҥΐ80> > > Ő P0Ő X,p> b> #$' > H @@ >  `  @m@ ```@ 2` >  㿘> !<x> #" @>   > # "` Т@ Њ@@ Ъ@@ >"> \ 㿘> > cP?* > #> #"`" Ԃ Ң  Ң Ң> > " 8"㿘!> @ Ģ @ ܖ*> #P* > #" > #" ւ   Ң  Ԣ   Ң  Ԣ Ң>T "`"  pК@ `к@>  "">  㿘>   @> #P?*@ > #> #> " ""c!#>  @   ֢A@ ֢AЂA   @O :>! `!$ >` "`> -   `㿘!> @ Ģ @ ܖ*> #P* > #" > #" ԂԢ>`Ā` >  @ 6>ТA@ @ > ܀  @   آA@ آAЂA    >"`t㿘> > #P> #*@ > #" " ւ  >  @6 آA@ آAЂA    ֢ >"`G㿘%>@@*> #P* > #" > #" Ԃ̘ !>  @ 6>ТA@ @> ܄  @   ֢A@ ֢AЂA    Ģ&҂@@" >   >"` > # >ਆ  > cLࠅ: cL Т0 ࠅ8 ଐ Т> #``> "`* * :`>8  Ģ@@ > #> "* *`* *`:>਀> cLࠅ: cL Т0 ࠅ8 ଐ Т> #>ਆ ` Ģ0 > L఑:? ଆ Ƣ?㿘%> <)> #L> #@`4 "@#L  .? ##L Ҧ?0" ,?  Ҧ?0#@4  6 6 | `?0:> #> ఖ  ࠄଓ:@  "  Ģ` > #``> "`* * :`>8  ĢB@@ > #> "* *`* *`:>8  Ģ  > L> #>`:`? " Ģ? 㿘㿘> cL> #  %> cL@ @"46.$,? " ԢB?@0#@4  ?6 6  `?0#@4  x6 0a  Ơ  Ơ Р㿘PMZ>>ࠇ8   > က2>  င o ??  Ģ> 2`  ? @0 `( > 2`  ? @0 ` `?> *  㿘@2  ?`" ` @|&M&` <* & 2` x> "`'Iϔ  ! 2` 2b2`>  ?b  @`bI2   '耢 4`H*   '* ?@ I b2` *`: '2`  ` '䀢 4`H*   '* ?@ I   b4   '>! > !XK!X쀤`2 !X * >'ؐ* 9$  2  '؀ 4`H*   'ؑ* ?@I?  b`` 2    $  4`H*   $ * ?@ I!  sb`  If`ؒI   ]b T @?77ؒH Kb쀤`2 !X |ؖ "2   * !X"@K~!X4b 2  ؀ * * ؐ " `H  Hѐ b` 2    * *   " `H  H  b > !@㿈H  2 2  2z H2   ' 4`H*   '* ?@ H~ ^ 2` *`: '2` `  '쀢 4`H*   '* ?@ HY   `5 2  ?`; *> H€& # A쒒  2   * *  " `H  H) `    `? @   "@ 2     * `??'  $(,048< ?ݔ@         2  * ` `2j `? 2 * ?2   8"  x> "'`    ?'/?7 ` ' `'    &  (  ?# ` "@  & 6     . ??'     $ (, 04 8<  ?ݔ@             6   .  2h ?#6  . ?#6   8& ␰  > !P㿘 >  >  !`a> > xᄐ"  > a   "a> !x > ""㿘> #` ? L 5 Ho o> # " H 0 , C> @_Z@K. 1 J` *` 㿐!>!8''€ 2  H> >  L!+3  H  ?p> > "!8> "㿘> #` !> : " > b #P> "  :" > b #P> #( > :"  b#P 㿈> "\*> "V &``&` > P`` H/` /> a: > !.   @  > #1   > > !`5> a0. !`>"!X>"!" ?.)  :  @? (R@"> ?).   (R#\#`#d > #8 > . #@@0020"&`0H 0x> a0. !6` cH/` /> a:   > #.   > ǑH 0U !`2>">"!X!"# )@  ;  @?(R@ q8?).   (R#\#`#d> #p>  ! .   " '''#  N@@)j` a *@ $aH 0 㿈> a0> Ǒ. !`>"!X>"!" ; ?).   (R?'H/` /> a:   H 00  . L@)"  `a *@* > !%a"H 0㿘H /:`@ =H 0.  㿘!4 `2 > #>  * > `+ " & & " "@㿘!4> 2 8 2 > ߐ#> `"  +` "&   * ( ##(#(#(#(###(#(#(#(#(#(#(##(#(#(#(#(#(#(#㿀> a  > "c  ?H@ > !`?H?L> !> > "bp& > > # cL > * #@ > t@  *@ l > ~#@ې""> > u #> *  * #` `t#\#da ?ؗ? "> ] @> 'c#@J@@ :@  Gv> "c>  #@7@f1> #.5> #`,L@  GV #)> ''> #\     Q 2 4p #tL@# `t P' #\ > a > "c؀??& ?0&`t  T?#`"  #\#d ?  >   > '#Ҧ > `"#> Ԑ   ѕ"  @> ǐ > !#\  > > # "`> !L> !8@*@ > LF#> 7!P㿘> b4> b4"!`  `> `"̑* *@ > "!ܓ*` > +  > "aؑ*   > #> #F@o d$> c  䀢 &# &##  &## ̓*`#3@(#$3&##> cL* @N䀢@@H$#> * &. . "b㿘;!T!P "!P`@K " ?   ? !\   $`!\ ?&!\!X  `#>aD$aS *&!X@[ P$a$= ?c$$$,$ 4 `$$$H&㿘`(  >    -0 -03> cpc쀤 c쀢  > a,0!> !#pː> #$T  `H`@'@`@ *@   $  @'H'L> !\?P@ ? 'P'L'T@'X'\'`` 'd`*'h@'l`'p`0't @   0'L'DxjIDB ?@( HA  ?@A  i 4 *@L$``$`H$`$`xA@(͐ h @A "+ !T$ < @ * ## # # # 0# H؀  $a  a ?"a ?" @&!(?㿘> !`") (> B> "">  > c쀢 > ! "c+"(> f!H/` /!> @h> ֐"Xj ` "> > {!@{8r> !> q!> n!/> i"  >  s*`  @ d*@  -**@ *"㿘> "8"2 > * L"@*` `@ @$> cT> # *@  * $ $> > "`">   㿘> Aa@> b8?> #`%>  > "8? 2 2 > ` "> b8> 2  *L"@ *`` > "H?> > "P08`2` `*`" * > ސ"h@$[@$>>  cL`> * ϐp> #a> '? F"l`D`` cL< > "x? .#-> 5> "@ 8cL  4@ @> 8> '#@@`2 4  ڨ `>#d-` €> z"0> v"0> r"0 > n"0 > j"0> "e㿈?> ["> X#`'> %>  0  <  $ ( ,#\ 4#` 8#d 8D#h 8 L 4@ 4 @ " 0㿘>  > ?x" > #L 8  `> #h @ ? " > # L > ǒ@ @  *@ . 3> 'ct` L&㿘@X  㿈> #쀢`"> > `4#!> #!> #L >  ##\ #>    ?> ѐ# >  ,  ʒL  * @>  0`( <  $ ( ,#\ 4#` 8#d 8#h 8 2L>  `㿘N@  t> 0``> 0>   x>  0  0 0 㿘> !`>   H/` /> c쀢`> !aP` @g$` H p@㿘!T@x P 㿘!X>   ,>! 2!XA !X@e! 㿘!T<`` *  @U P@<!T "  `   2 !T !T 㿘!X !>! *Nh &!X!>!2!XAX!X$!!X@"! !P#|#4##########0#T? 0        㿘? @2  `@- > b  #> ""`$"!a tb " "!> #  `$> `t> L$  2`> $! ` `   ?` ?&@ &`> ! @2 ` > *` €` @5 > #L#> #`, > #   ̔ !> '`#@ ` L `"@ @8` fݔ`L#@|@ g`` ?G#@> #L?H@ @   8 %> '"D@ `> '"\@  2   "@ @8  @ 8  @?  E (` > &`; > !`" K` #> #`  '> L Md L@$` L@8`fu `  "Q@? @2  !> " "u $"? ->    㿘> # `"  @ " @  㿘#  M  &=, ?㿐#@2> ""P &`> b@ > ""P@ > H/` /H p@  $> #0`''@İ   #@P@ 0c@c@p 0؀` Ho o €H 0 @` &  L 'Ho o  H 0Wp`r\  U |Ho o  H 0 @2b aC`E/ 2VHo o €H 0@! @ $&  <4"> Ho o €H 0> `& " Ho o €H 0> ""& "M  M #`#`#@# #L#,#4#㿘> !\@㿘> `t> (!> #L  #L>!`@#Lސ#L` @h: 㿘> > `tL`㿘 `#҂@   ? . %$Ң` ` `? 1?` `?1?** ` `> ?.  !`  2( $(@2  ?(:  㿘> '#0 Ҧ`z> (   >+              " "  " "   㿘 @*`   `  6"@ @:"@  *=8$ @$> #> #""@㿘> #!> '"!  鹐"l> #""lˤ "l  > !> #@ "> #L > '  bp  ,` ` 2 @   @> '> #Lbl* @  2@2頖 `@ 㿐> #@ ? > T1> 6@ `! > `6`@8@. (@ 6` &' 6`@8`6`? (3>  `(`.@( 8  㿘> !  > '%?> '/?"bD""\2 > '%?> '/?"bD""\K> '#1> #4*` $* a`⌀`@Д`> `( @&> \?  +> #)> #a? 4#a@2 4  ,  2 @ *` Ġ? > #LЄ Ф? *4&'㿘!Ђ* >`<  `T    ҢЂ ```> 0 > 0> p> "@!> !@>" `< `T  㿘?. # , `$* @҆ ` (  .  )> ? @ ` `*@*    * ` `+` {?  ?*  @   "P Ǒ, 㿘?.  @,  ҆ `   #  >  ? @ ` `*   `+  z?  @    t" ?$@㿘?.  > > ֆ     + `@`.`z TRb  ? 㿈> #!! :'P ` "`" "@# #  "@& # ` # `"&`> #",> '"d",0 "04 "4.`$*  P*  @ 2`P# 3 /3 > #!耤 !> # 2> '> #0#2> #P` "`" "@$ $  "@> '"d & > #" 4 0`" 0" 4 * @$*` `2 > А#p* @'@`1 > Ɛ#@ (`@>99> a 2"Ң>Ю@>!P € >    (* # (* 8> 9> a   "Ң> Ю@>    Ҫ`  Ҳ` > #?? ĸc> P ,.*`''7> -> # #  @`>   ! >  `2: *"@ *`@ @ 2 @#@   2: 2?  *`" **@  * @`8>  @" $@L  > a    * *`:  Ԫ`  *`*   *`* :`@Բ@` 2 ` "` $  "@ ꪀ@$ `$ `"@&``$@*  @ 2`P$ 4 4 㿐> '.`X"* @`*  $* `> !``** @** >`@> !`` Ҫ`  Ҳ` > # > c ,'> %> #/> #†@#@ >>  @! >   2: *"@ *` 2    2: 2?  *`" **  * @`88` @" L`@``` "` & ` `"@2> #> S#Ȑ!` *`> ' #2`@`"``"`> '""h`@"@0?"0@`"``"`> #"!`@"@4?"4#`#@#`"@"`, "`,㿘 0 6`+   $* @6`` ?*@@> > #!  `6 І@ "1?0/?@H /f * ' > # ! > !`Ԯ@`> #Զ@`> #> #L`Ц@`@ H 0 㿘> !` 0 4H /f>* '>x`  t @#@ "x+<`|@\@"|??""|`> ""|>`|`t,` "a  @ `   `0&`44#@& F&  @>!X@> !  $  > DŽ ! ?> #`   Ъ`  в``? 2 > ǀ,,: $*` *  ӰH 00 !>!`@ ,,` p:   z"@>!X@ "Ң`H 0㿘#> >  #a &"#>a` "aX6w"aX "Ң` Ԣ/>% @>! `  "!X6^a ">@>!X@  Ԫ@>>6Ia   "Ң>Ь@>`x$"`x㿘66H /f4 * '    H 00 @  +> Ǩ 2> #4 *` $* 4   `?>  *` > #!`@  2a> z 8 2< <  | *d$ % >   x * | S2 ?#?#(H Ҫ@>!L@` @a > `Э`a`е`a> `#T<  < ?,`6@ <` @& @,@ a 2< <  | "@    $ " ?$ 2n @H 0㿘5xH /f4* '   H 0b  @ S> ??#Lc  4`*` $* 4` `?> ɐ X*  > #a"3 Э@@@@>!L@@@> a  Ԭ`Դ` <`  `<` `?,@ @ 6<   @2%  @H 0㿘  > z x- *> #b   "> #& ! &   & &    )& *  "&  " &  ?@& !> #> #"`  "` > ?  2  2 "      > #     2 "`"`  & V㿘 ` ` > #b` "` & & D& A& > # b` "` #> #"  ! #" `& # a> #` "a "!a 2>  """ " " &㿘41H /f4 * '    H 00[" O??#c``>    >   x ` |*/@`((@"Ԣ>aL€ 0Ң`  :>  b @& *|``  $` "@` ?$` @`2`"H 0㿘3H /f4* '   H 0B " 3 3>  2a " Т@ pꢀ`  2 `<    @>!L@ p` ?|2% "H 0㿘  > ߐ x- *> #b   "> #& ! &   & &    & *  "&  " &  ?@& !> #> #"`  "` >   2  2 "e      > #     2 "`"`  &  㿘 ` ` > #b` "` & & D& A& > #! 2> #> S!0" `"  ` 2" `  #" `&   > #` "" 2 $$ $  $ $ &㿘2 8H /f4 * ' * > a  "" @"' %>  a ХLЬ@L@  2 a  "0@H 0㿘> !(!> $#LN#L>  a: > #"`@Ğ@㿈> !'D'H`'L`2 L> # " > `> # "`L> "`(> `3> '&b8#> a> '"ct%>> #"a'>> '"b`)> !> #"a+>b> #"`->> '"b<> #L"`> '> > > > > !> > '?"c da܄<ᄞ, 5> '7> #9> #;> #> ' > #> #?&P&' '` cx! " " 'L " "> $> #Dc"8`k*+> #-> #/> '3> #"$ ,` ,`@ *`  ?2 ,` HL> !> ( aL> '*" * "bX@l!>$ t> '"a" %a" %d" %d> cL  ,  '> L&`ܢ`"`r> #"`> #?> '" % \  @  $ x  % \`@ & > #%>?"> !c "|?@ !@'6`<  <  ? > '> #`Đ $> ' bd'>   `? D4   D @  `'D`@$$"@&$$ "@&> #`0> ' "`0$44``? ?%@4* @ 2` > #  *  `- > cL > # ē* L   > #L"  Ҥ@ >> #> #!b4$$"@",L ", > \ @ 60 > #  + @@ > #> a !` <   '8   ?Ь` д`  怠 @  Ԫ@> > ǖa!0+  c> #L Є Ф 㿐> '#> a$> 1> '&"P /> '%8> 5> #c > &7> ##X&> `9> '> '#x;> #!L->'`h> #> > #> %> '> )> +>"`> #> '〞 "> ' > #> '> #a⠪b> '3> ##`#"<&a ct!! ` "# !> $#" +"$","(@ `> #"8@> #+8  7> ')> #;> #5> '* * * @ #$a ?"?*> !> ( a#>`\$`t* &%@ѐ> #L$`\-> # " , @3$`p1 %!%@ '`خ%@ &| @%- '!> '"b@ $(: $,``pz(  $``ؓ-@-*``$k`(-@ 2 @ cz@% @ 2 -> !> #- 8@$@-  , - |a 2 ,@  z@$@?a`> cL> #"ܠ"`m> #"`?> #" >&\  "x  &\ & &>?!>"`>"`|> '> #a4 * `$@*` 4  ! >`*2 ` > #a > 'b@ > ǔ> !0  > ǔ> !`<  |< z> L ˑ4 !>!  > #a> #> '"@ "@-㿘 "Ң!,   $Ң` p2  ?!Т@ $Ԣ`㿘> !`  > ( >+ +0$ 2   #  0 ! 2   @ 0! 2  ,"@  & & p㿐> #> ! a#\  }J > !`!>  > > "8a$$  }:#\> > #\#a!! }0 㿘> !`> #! Ԃ@`>!`  > '"@> T"@ 2@ @ 㿘> @ #L#> 'ct@@ 㿘  "=ؐ @@6 @  "=ѐ++/& > ! & & $&  & & >  ~"8& ( ( & ,   z@`> c @z` & 4㿘   ? & @?O "㿘H /f * ' > a    "> !Ȁ    > !~H 0 "a? "a   >   > r!a>  (:"8& ,& (  " 㿘 V> '#> '"<-> # > a  "0 @H /f@* '@' !6` ?`6` * ** :`* @ **  $* @ ` @@ !H 0!  "0@㿘> !> '`#"0 @H /f* ') !6  ?`6  * ** :`* @`@** $* @ ` > '"<@ !H 0!  "0@㿐. $* @@ / ` `  Ԫ@>  cL`&2  >!P €@>a  @ @r>  ,@ cLh@_ 2> >!L@>  ?, ! >  2: *"@ *` @ 2@ @#@   2: 2?  *`" **  * @`8<  @" H /f * '  H 0 Ц@cL@ @ `',> !`../ / >`@> \ > !> #a Ԫ@@Ю@`ж@` ?- 㿐. $* @@ / `   "Ԣ>  cL`&2  >a   aP€@a  @ @l>  , >`  ?* `cL[@<?Lp>!L@>  ?6 !p>  2: *"@ *` @ 2 @#@   2: 2?  *`" **  * @`8 > @"  ` ?* zcL@ @ >` ,㿐. $*  `  /`> E" u > #> 9"(a2> !`2>` >`  | @b>  ,c@ T`N>  ! >  2: *"@ *` @ 2 @#@   2: 2?  *`" **  * @`8 H  *  VH 0$@> cL@@ -<_ "% ` ? -` @ L`&2  >!P €>a  @  Ԫ@> a  `> `> > L` >`  `>` `?,@{ @ t> a  2> >!L@>  ?, ! >  2: *"@ *` @ 2 @#@   2: 2?  *`* " > *, * @`8<  @" H /f * '  H 0 Ф@> !`2<` <`  | "> cL@@@ 9-> !`./`./`>`@  >  > #> #aЮ@`ж@`; "% ` ? -` @;x "%@> a   0@"& 0 4"& 4㿐'P.$*  Ϻ / > " ` 2> "( "Т@> > #T'@2@ ` PP€@  @m` >`  ?*   ]5> <N  >!L@>  4  !5> >  2: *"@ *` @ 2@ @#@   2: 2?  *`* " > *, * @`8 <  @"  Q p` `?* zL@@ >` `3.> !`/ /  P* ! Ң`/   z!> #zْ& ? ,  " Ң`P(*@z@: "#z$㿈`  8)h` +0H /f4'* ''    H 0 0Ԋ@' ?'9>   4- $* @ 4` ?> "@@* @  2?> "`> # ,@  ! @<  |< "@:- "$@ ? - @:$ "%@    Ԫ@>aL€0 Ҫ@! >  Ъ`a в`a> `#T< `< `?.@ֆ@>  "W: @' Ԧ@`T! 2>` >`  | @J"> '#2> \ > !> #a Ԫ@@Ь`д`H ?)-  ! aЮ@`ж@`9 "3$ ? - 9 "%!   0@"$ 0 4"$ 4> #!y 2/ && & Ҫ@H 0 㿐 v0(O Ҋ@'H /f@* '@ 9> +> Ǯ -/6`+ @  $*`a6`  ?`+ + `:`* @ > "8 "o+` ` 2`f> #a a  >`  |>` @U>  "L@ @J@ "  Ҫ@@A@> #"'%@`$ @ $`$`(>aL $`(€Ц@#L@@퀦@0%@a`+`2 Э`> 2 е`> acL `>`  `>` `?@ *@ > #LЂ@ Т@@ @@ @ t6`H 0 Ҫ@㿘'> #L > 'c .@  !!`  @6`6` `?H /f * ' +   $*  `2  > " H 00 > #> #r H 00x +` " > #a   > !` >`  |>` @ @Q*@F&@@@   Ъ@@@ @= 2+>!L@%Ъ@@> a    Ҫ`L  Ҳ`L` >` `>` `?.@@ @.@ @H 00  `" H 0㿐` 8&`  0H /f4'* ''   "H 0 0҂'u    6`- $*  6`` ?> ~)#(,@ ` 2?> ~#H,`` " Ԣ>aL€p`>` @   ":> ~#h @@ z@ `0> '#+ -, !`, z#> cw %@ ? ,  " ("` (-@z@7r "&wc> #!w`2 ` ?& &&"ҢH 0 㿘> 'P0#> (` ` `&!@"H /f@* '@g > #"> Ǚ6`a+   $* 6`@ ?+ + :`* @> }x"8 ` *@ `2: " Ң> cL`@$&:@ %$*+> > #" >`  ?@*  @ cL( $(` <2p>!L@p` ?@*  zcL@@ޑ>` @ > ǑH 0"㿘%.> #P> 'c> ( .@  > #` "`H /f * ' y " Ң<  2p>!L@p Ң`"⢀  ?` "`|H 0㿐> # `>`  v (  A> cL>   6  '> '! >  `2: *"@ *`@ @ 2 @#@   2: 2?? * > "@+ *`  * 8 %> '> ' L ?6 *@   @   @@Қ` > |W#@㿐6`, $* @6`@ `?6,` H /f * ' > # ! f@6c #@  H 00Q >  ?. 􀢠! >  2: *"@ *` @ 2 @#@   2: 2?? * > "@*`+   * 8 ^   Ԫ@>aL€  ,  @ ﻔ@a  (> 'q"d >4  > ǐ - \ a?Ԫ@` Ю@`ж@`> #L?> # Đ@  Ң @H 0 㿐$ 66`+   $* 6`@ ?H /f * ' > a   0 4" 2  :  & & 4    & 0 2" "39   "H 0 $/> #%-  ?4, @@> # Ē "*3   H 0 $Ɛ$@ , /> # - > #!   a 2>` >`  | &    Ҫ@@>a  @   Ъ@@a2 ֪`> ֲ`> a`#T>`  >` ?* 6i #@  H 0 < ?& <T >  ?, 􀢠! >  2: *"@ *` @ 2@ @#@   2: 2?? * > "@*`+   * 8    >!L@  , < & < @ f@!a   Ҫ@0  Ъ@@a2 ֪`> ֲ`> a`#T>` `>` `?.@@a 2>` >`  | $H 0 㿐`+`(@@@?> cL>   6@  ! > '>   2: *"@ *` 2@    2: 2?? * > "@+ *`  * 8 >  > 'cL?6@* @ ! @# @㿐@?x*  `@`<@C> cL>   6  '> (.%> '! >   2: *"@ *` 2@    2: 2?? * > "@*`+   * 8 )> '> (.%> ' #L`6* @  @"@@  @#@`  > ya#    $ "  $ "㿐=6#@> #yF6`* @ $*` 6` !H /f * ' >`  ?*  `2_  @<H 00gNp>  2` 􀢠! >  2: *"@ *` @ 2 @#@   2: 2?? * > "@*`+   * 8   "Ԣ>aL€ p ,   7`O /@ Ҧ` ?*  zH 0 㿐!*6`,  $6* 6`@ ?H /f4* '  " "0q   H 0 """$, $ 2"> #p  , H 0Ѱ $   ? z@`䤐  (2   z@- @)@> #p 2 $@H 0  , -  , >`    ? z@`y 2   z@v >` ?*` `e ?@<H 0 < ?s& <S >  2`􀢠! >  2: *"@ *` @ 2@ @#@   2: 2?? * > "@*`+   * 8   >!L@  , < & <  7` E/@ " Ңp Т` ?*  zH 0 㿐`x* `  ``> #T> 6@  + @ 􀢠! >  2: *"@ *`  2 #   2: 2?? * > "@+ *`  * 8"> '# "@> #  㿘 p6`* @ $*` 6`g ?*  > #! @ B# @@  > !`2  "Ң0Ь@@؆@' 1> !   "Ң!Ь@@!   Ҫ`! Ҳ`!> `#T>`  `>` `?*@؂@ @  > !`2>` >`  | @  > #L ? + + @ @ &     $ 3 ((  3 ;  >  T> 2*@?+ /@" 㿘 8饐 & `㿘 8  闐  㿘 8鍐 & `㿘 8    㿘 80 & `㿘 8  "  㿘 8 & `㿘 8     㿘& 4> #T?4 , <> #`@> #LА Ф@㿘)>!  4 `4 > #L`#4 ! (`> #4 < Ф@cL>!L@ Ф Ҥ@㿘> "$ 4` %> > # > '# c$ $$!>! > ̐> #L !4@ *    0Ԣ`$z@!> " m#L"  0Ԣ`> b$ z㿘> "( 4)> `4`-> +> !> # #> '%"0 'c &(c !%b4%,#>a > 느> #L 4 a ,   ~ a4*` "0 0Ԣ`(z@b4 0Ԣ`,z@> "4!> L"0>!L@"0"0 0Ԣ`> b( z> b4 0Ԣ`> b, z㿐> !`r " Ң h>  ,> '#ɒ@  "> > uK  4  0!'> >  2: *"@ *` @ 2@ @#@   2: 2?  *`" ** @ * @`8`   X  S " ?  Ф`|@<2L>!L@L`"0l@@ Ъ@@ e>  , &> > t @ ?,  !'> >  2: *"@ *` @ 2@ @#@   2: 2?  *`" ** @ * @`8`    ,2L>!L@L` @> '2$$  ` *` (`"8> #@:88> #" "@㿘> !  >Ғ 0 >Ң㿘 H /f * ' > #쀦  >e0!`@> !` "Ң0 Ҫ@H 0㿘> #!> a * > #a> # ' * > #L  > 㽀> !`  "Ң"  Ҫ@"#ʠ'> cL`> #* > a?$  ' # # > #!`  * # # > #"8#'> $  8" ``4  ?'> ' @$  `8" `4@  ?2' (> > '"l/>    ?? @$  `8" Y`4@ > a A> #! 1> a  `> #`> # Į7> Є' @$  `8" &`4@> cL? a> > a a Ҫ` Ҳ`> b8"㿘H /f * ' > #P>. H > a  " @  "Ң Ҫ@ > '#R   H 00/ 0Ң`{. 0Ң`{ 8>ք H 00Ф.֤>!H €  "0@H 0 㿐>  cL``@ 3"`  J @ L   @ 2 > !`"`&&> > #`(s > !4.  >  Xrd> #쀤 2 > !  $!T "!P#  "t' e 0; q  05 "' ܀ 逦 0+ $ * 0% ,>   >    0   0 0  0(??"u` 8 4> #Ԁ`> > #s`('   4> !7s 8' ޖ @2̒ #> 1> ѧ ؐ'  ̖   ǖ !X  > ! * )!> `,p!$!X> !#`2 '    u#>a !XLaP$a "aP &@ A8 #> > ` > q hH`  @ A$ ` "$`> q x@  H` ݔ @ A  `X``Ԕ @ A ` ?> qf k$`!\  "Q'  C #>a> qN $!X$a!XN#>   / > rS '  & '     `'&&  r7 > r2  `'&&  >A#> !\ $!\`&&r  `'&&  >*#> 1> 3> ?! `  ,(!(@ ?0  !5,!4c؀`   ,@ $cؐ*@ $ ,Аv ! " ,W ! ?! `  ,(!(@ ?  ,  >  Ր"v !4.c >!@*&㿘!P` ` 2 x  x @ 2??  @$` 㿘!P" 㿐> #L> #` "> !  > # `>  f @ @   @.1 2!PH/` /> > !qӖ(> pB!h ">  >( @C> !`2@!P=# > `t^ 1!P$!T  @  @ &!HE `   m "   @ , !P   ``H/` /> > !xqp!(> oߐ!h'`n'`@'    =􀤠a#> %> '> >! `  ,(!(@ >  !5,!4c؀`   ,@ $cؐ*@ $ ,Аu  " ,Vg ! >! `  ,(!(@ =א  ,  >  "uZ !4,@ >!@*'@㿐> #L > ``" > ! `耦 + `` `>!t @ @`  `@  ` `  q @ L> c܀h @"cܐ$Ђ`  a#Ђ `@.  @`  @2RaP3 2aPH/` /> > !p> o!h ">  >( @0> !`2-aP=# > `t aP$aT`     8 "  ("'aP   ``H/` /> > "pA!> n!h&j&  ;֘􀤠a!> %> '> =a ` `,(a(@ <ڐ  a5,a4#؀`  `,@ $#ؐ*@`$`,АtX  "`,U< a =ma ` `,(a(@ < `,  > `"t/ a4, >!@*&p> cL`>  "`@ @> n4!> !!P "> n+"(#@"!> n#"@$!T, `0  3   0`0`4  > Ӑ!  `8  . !`* )T2؀$`H> m"X"-`@  \O*    @`2O!ThH!*f   @`2`4TU`4'' ,@]Ш??, 2!Ѐ&`0 &`4  `    @*@`&@&`! `- @`@@&@&`&`0&`#> %> '> <! `  ,(!(@ ;  !5,!4c؀`   ,@ $cؐ*@ $ ,Аs<  " ,T  !   c"s !4, ` 2@В@>!@*&@㿘!T" 0*  " 4"!> #> '> <! `  ,(!(@ ;G !5.!4#؀`   ,@ $#ؐ*@ & ,АrŔ a " ,S ! ;! `  ,(!(@ ;  ,  > # r!4, `   ,   B  㿐)> #!> '> '#> '%>  Ԑc #Ll甐t #L@㿘> `t@F 㿘> #L` . $X  > !"`2&@`6  &@> `t @% %  㿘> #L`@ .@ @> !"``6@  %ߒ 㿀> #`)> #L###L @@8 < @ H/` / #> #?`@##\ #`#`@#d?0#> #`?`@##\ #`#`#d@ \H 0`; ??-'> #%> #9> 7> 5> 'Ԓ #Lkא > * `'~[  ̔ @ ?#L? 'ܲ@ >a 2aH€㿘> #P.  > ǰ! . ~O0> '#<H/` /> #`] > m"H 0>a aH€㿐 0@2 ,> ko"> `  H#L> & L 8 $@ t@  @`#& H+> #)> #1> !> '`Ԑ >kH"!`  ' ̒# @ L @ @ 㿘 0@2> > k*##P>  H8 " @  `tɔ  L>& H& L   @ <H"@ 㿘> #!P aPH $`> ! " > j#" !X>!  *Ɛ  * "ʐ!&aX!X!%&aX% @ &aT~ P& H $"  &   `& & 0& 4& P$  " >( $ $ $$ 㿘!X  #>a2$a$I *6"!G 8 !\&66&(!T P<!P!X`'>! 2!Xc !X+!@iÒ!"(H ''   '#\#`#d#h#l  !\ #\ #`#d#l#h   &㿘  ?`> #0@nl   > #8@ne  0> !`$```N` s! 4@!  ! 2 4N` s24 4*,   "$`㿘(!"&(< 2 #&< 6    " "    2#@ #" #@ @& c&"(' D' T' @( ' 0' <@ 2 Hv" ' 0 >1> C#@!`@2 7ߐ "2 6"@2@@ג' !W@@Uڐ 1> #X<! ֔  f @hȒ"1> #p 㿘`8 "; `( !25 @, !W@2- ` 2) U "  `* @ .*  @   2  @    ?! 㿘@ v( Hٔ"$ D$ T$ @($ <$ 0@@㿘D< *  @`8 *:` `( 74 T @`2 0@22 $$44 !@ < $@.  $4$<`(   2` T`8@kJ$@0?($0㿘"  @`@ *  1> #!W&`&@"&`  &` &`  &`(&`$!&`,!&`0!&`4!!&`8!&`<!6`B! &`D!> 6`H!6`J6`&`&`!`$ @ $ ,  , (  $ , 4 ` a " "*   gG#ꀢ@216`   @  @`@  2#6`> #  a?$  $,  @ `, (  $ , 4   6`Tv6` 㿘 ("2  , "  0 x  &@ &` &` $&`  H6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`66aa `@k O@jn$@$`6"6a    `     `@ @ "4(&`gG#&`! ` @jې @j8$@$` ```Ȗ @ b@`@ &` b``  " "  &` @ 6a@`@ 6a **`@ @   }4??(@  ?`   * 㿘`=> #a :NW.   㿘> !` > "`@> h֐ Ȓ@?㿘? #> (> #\` 3 > !4* > h > a8 #> (> uZ #> (`` PÐ`H`P `!> ! `$!ے  !`H$! ` P 㿘n㿘> t!㿐N `?#> (  @ <=#: 86> ! +>    "'a( #>  %> )> .``a0`.`8 !H  <=# 8є$et$cH$cX$c|$c$e<$e<$d$d$eP$f$f$f$f$f$f$f$e$e$e$e$e$e$f$f$$f$f$f$f$f$f$f$fL$f$f$f$f`$f$f$ft$f$f$f$f$f$f$f$f$f$f$f$f$cl$c$f$f$f$c$c$f$c$d$d8$d|$d$d$e$dX$dl$d㿘> # q @ > gʐ c ` , 0~#0p70~@2 8   2  2 @  @ 2 @ 2 ? 42 @ @  2` @" ` ` 2@2`> - > g `L .L@ ,2&`!/-> +)> '> L a p "gt gn!gj*LL@ ؀ ,> g]!L` Б* : `Eܓ*`>   €> 4 !> !*> 4 !4 > ! 4 > ! g7 `¤?> !(g0, > !(g* '?4 , > @ g !(??,* >x , >x > g!04 > !84 > !Hf `> ܑ* 4 | > f!XL`72x4 > !hf `q> 4 ܐ |?> !pfڔ, L`82c> fӐ!^> fΐ!Y4  ` >  fŐ!P> 4 #`- > 4 # | > f!A> 4 "\> 4 > !f, 4> !(f .> !(f ?(> 4 "\> 4 "ܔ | > f!> f!> f!> f! > f{!> fv!ФL > fo!L  > !fg㿘   㿐>  @k 2$  b >  &a4&   /$h<$hD$hL$hT$h\$hd$hl$ht$h|$h|$h|$h|$h|$h|$hd$s$p$p$p$p$q$s$s$q$rP$rP > *            ? ` ` ` ``  @2 `@2 `2 @2 a2"b2$d2(h2  ` `2 @2 2!2"2$ 2(R "  "2@?? 2@ 2` "` "` "` "`S  " 2 ??2  2 2  ::  :: "R "  "2@?? 2@ 2` "` 2` "` 2`S  " 2 ??2  2 2  ::  ::S " ` 2T J  (< 2 0A  $ 0`@   2/ 0V     $ 0    0  B@ B  B 2?@ (?  0' 0 ,?`$ 0C 0㿀@jQ!'`" '> @@i  `> @@i} `@'' / @2+ !H `2%  , 2! n  2`0  &`0V` `2 `0` `a `0`,?`&`0B`0 㿘㿀@i!'@> @i. `&@''']㿘㿀``  8`  @ @ '?'*㿈@i!'@> @h `@''h㿀` ``: @'?''a㿀```@'?''R㿀` ``: @'?''㿀```@'?''~@`' ` '> #*` €`''`':  & '*4 4` `@'44'''4` 1@i''00@i& `   |P   r @?'谒 h |  b`0 @h',,@h `' f $ L b  Bǒ谒 <쀢 9 M  3` $ I*`   N0"`@'|'xxP | &P` ' $  8@ N㿐  `b{&& bbb 09 4 b~0b| - @ &*@ @ ?!*@   2 "| "{   Ԕ  㿘` @ "S   ?M # @b +> ""> ;<#> 49   03" "> !> +( 2$ > =  " "##d!  0 $ 0`@ 0 ,?`$ 0@ 0$x$x$x$xd$x$xH$x$y,$y $x$$$H$H$H$H$H$$$p "`"` "`  "@ "` "` 2` "` "@ "`"` "`  "` "`㿘 &`, 6`0 $&`4 (&`8 ,&`< 0&`@㿘Β ,&` 06`  4&`$ 8&`( <&`, @&`0@g!` 'D``` 'r'> "d*` €` `"b'``]`XU'` "O'` "H'` "A' ' D@geD"@_耢 9H@ D̒ 20`ǔ T& ''D@gB D"` T 2H D 2 ( 㿈` `'`''C㿈` `'`''㿘@ 0  0 W 㿘 &`, &`0 $&`4 (&`8 ,&`< 0&`@ 4&`D 8&`H <&`L @&`P D&`T H&`X L&`\ P6`` R6`b㿘 ,&` 0&`  4&`$ 8&`( <&`, @&`0 D&`4 H&`8 L&`< P&`@ T&`D X&`H \&`L `6`P b6`R㿈``'`'` ''I㿀``'`'` '`'']㿐``''㾰@fs!`'`'' `@fn`` *'C` ` 2@  '~耢 7̔ ` 2/xe` ǔ p%`  x' p`  px' 2n ` 2 ~ 㿘@ 0 o z 㿘+ 6`4&`, &`8 $&`< 8&`0V (&`D&`@ ,&`L&`H 0&`T&`P 4&`\&`X㿘 ,&` 8&`  <&`$ 0&`8 B6`( H&`, P&`0 X&`4㿈` `'`''㿐`'㿈` `'`''|@e!`'4` &' <@e4`` '`` 4`` &`8`  p 2R < "`E'`?` >> "*` € '耢 0` * ؔ < #8[` Ӕ p '쀢" ' "'  2  'ђ 㿘@ N0   N0Y b gp㿈 "``h耢 //77y  $$ $$($8$H$d$X$$d$p$p$$$$$$|$$$$$$$$$$$$$$$$$($x$$$$<㿀@'` '@d!'@dĒ ''?' + 㿀@d!'@> @c `@'''㿀@d!@'> @cњ `'`@''Β㿐z@`  &㽀`֤$>  "`  ?'6@ `''7@a͔"@є  @ `@"$`$@ > B"`x`Ƥ$>  "`  ?'6@ `  ??7@a"@  @ `@"$`$@ > BƐ"x㿈 @ > !`` ''t @fɘ`0?"`0`,  <`0 ` " &㿈 @ > !`` ''@ @f`0?"`0`,  <`0 ` " &x`2) `2`#  `  `: ( @> P?'''''`@*@ `@ *'ؐ4ذx`?2' ``2` ! >   `( `@'#P'''?'`@*@  *'ؐذ㿐 !s @@ : (``<`   @ @   0" 0`, ;`00襐` "$` "$`  0" 0`,  ;א`0 x!@c'L'> LܔL@bO < @ L'''0''W㿘`?* `@֒㿘` 2`# @ `+  * ``Ò @!<> d( 6"> 2"> ."„*"> L&" #" < " "> 8"> "> ,""  "> X"> `"  㿐@   2@ &@@ 2` &@`@''@kB㿐@   2@ &@@ 2` &@`@''@kH㿀>  cL`@   ܄(   >` 'L$@( 7  `* `  * `'##`#\#d ?r? > "\M0``@ ̑: @ 5``@ ̑: "@$ ̰ (@b!'@b H''"ؔ [k H T#> '+aĠa@X@@X'aĠa@X@@X?''" 2C H ,aĠa@Xʐ@@X'aĠa@X@@X'w6aĠa@X@@X&@ x@    0?2 8 0:   *2 @ 3&@a!'ܒ @a`*   :? ?  2 ''    `&   $`ܐ &  `&㿘 >  \ "   4  2 4 㿈@`B> "*` €'' "&!H3` "!H "* !H   `4#&S ` " !H 2!H !H`  &``''O 㿀` "`   N0!2  NА"@&  ` v^`@'''I  N㿘@ 0   0 N> "p'@X  'p 'xN 1 4`'|!d  ''``>`  ''t 2 > >`> ` #@'     *` `'  't b > ? "㿘@ " !H  " T ? ` &`&` T ^ `" L 1 4  !H @ 2N LL 1 + 1` '&!`` 2g` 2c  X " t H t $ t@ 8 & t4!` !d!  H ]0H*`:  2 L , 2 L(` ` " L`2& $ ,&!`*``I`+ 2`2` # @2&> !  7 " T$ X&q 8  ` "  㿘  D&@ &` `$&`  &`  &` &` &` &` l&` &`4  &`4  `4 &`4&`8`<Z `\@W @㿘  D&@ &` `<  >`    >`  :>`   >`   >`(   >`0 1&`8&`L  &`L  `L &`L&`P`T `t@W @8> "!'@_T'@_S!@>  @^@'' H! 2 m` b > =ߐ"Ё8> "!'@_'!@_@'' H! 2 ;`z b > =" > "!'@^'!@^@'' HM! 2 8`H b > ={#p@^!'Ԑ@^ @^ @'''''  2'ܐ''9      ' &㿐@   t @ 㿘"` N 0  0`  㿘 㿈`'`@''㿈@'''& 2 Ɣ  㿘㿘 0  '$x$h$$$$$$$X$H$h$$$ 㿈\ ?^  2`  ?倢` > '!*` €                   7 - 06찒  0! 2` 2 >  l""`(@#&\, ?",`0?"`0`,  6j`0 㿘 (@H W 1u\㿘  R` "`(0 >  l"` 1   ?`" "" $ 㿘@UԒ >  ! ?: *` + +@   `+@@ &@ ?㿘@U >    ?+ +@@   :` `* +@ @  &@ ?㿘 `&@ &`  &`  ` &` "` &`@"` &`@@"` &` "` &` ` @&`㿘`&` &@   &@   @ &@  " @ &@  " @ &@  @ &@  @@ &@  @@ &@"@ "`"`  "` `"`"@ "`"`  "` `"`P@ P @\!`` '@\  @\ آ 25ȐD "@( @> a* @''' 2 Ȑݔ ؐWؔ  h@\P!`@ '̐@\K  `@\C  2/ؐe "'" 'А'!)Ѐ 2ؐ W  H@\!@ ` '! ?& > ,`! b"P  h`a"`~ NUdEu N@"h!(p N   *@':'@[ϒ @[˒ `'А'''@T 'ؐ8 2N ۔ ?&D ! = а 9&*@'' *@ '' )@[  ''''@Sݒ ' 2      *@* ' 㿀`  a(`ڔ  :` 4 Ȕ  .̒H/` /@`"a(``  ?a(b  $a(*@$a(?" @$a(H o@㿀@   0'` 2!(" !  '`@S[   : * +@& `p x@ a  eܐ'㿐``> !*` @''   &@   N $a !( @b`0!x`$!x "@㿐!('E$x$$$$$㿘`(>    > #"#"` ""> #Ԁ " >  2 | t2 | x2  |   "& S8&   2 㿘`(>   > #"#"` "#Ԁ#2| 2||`"`"|"@   02㿐>    > #"#"` "     h$ x$ t$$  =  ƒ 0 , , > #Ԗ#Ԁ`$ | |"` |"$ "԰ 㿘`?`> *#ؓ*` € &`  &`  &` &` &` % 2 2 2  2 @2 @2 2!2" 2(@> " 0'  H&!W  R0!J >  '  `2` `` 2 '  2*В @V@ W7 ה  2 @   > 8#X$8$@$H$P$X$`$h$p$x$$$㿘@Q ?  2   *`@&@ <&` 0  ? &` > &` `X&` ch&`     3`  *   &`$ <&`0 &`8 $&`< (&`@ ,&`D 0&`H 4&`L H&`P D@Vn&`T㿘@QI ?  2`   *&@ < >` 0 @ ? &` > &` `h&`  ch&`$    3`  *   &`( 8>`8 &`@ $&`D (&`H ,&`L 0&`P 4&`T H&`X @@V%>``㿈` @'''@㿈` @'''@X㿈` @'''@㾈> "!'@X}'@X| p`> '` @W`'_ 2!۔ p 2h!< 0 2```˔  b > 6#p㾈> "!'@X6'@X5 p`> '` @Wm`'< 2! p 2hڒ< 0 2``ؔ`  b > 6#㾈> "!'@W`''@W p'( U p 2h`P  b > 6#x> "!'@W@''@W p' 2!! p 2X< 0 2`@e`  b > 6A#x> "!'@W|@''@Wy p' 2! p 2Xo< 0 2`@&`Ҕ  b > 6#x> "!'@W=@''@W: p'v  p 2X0`  b > 5ΐ#ȁ㿀@Od `   㿘  %@OR%> `!@Tl> a!@Tg!> ` !@Tb"> J $# > J(2  J$ J* ) * JJ#2 J J* : * a0*@T)!@%- ^ 㿈@ 2`! "'>   +  N0l"!> 4> > "; ! "> !!Z N"> C" N0R> 7!5 3 1!0> .#> + ) `> &!8$#| 28` '#\  #G ,k 2'` '#\  #6 @S/ `&  `/   `㿐` N@' `@'' Np@V !'Ԑ@V '> @Ԕ@U@ `@`'ؐ l  ''''e  "0'ܐn؁㿐@U!'@>  @U\? > ,(             ?㿐@U!'@>  @T`?&` & & Ȕ㿘`?&` & & $h$ʀ$ʘ$$$$$$ʰ$$$$$$$$$$$Ӵ$Ӽ$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$@Tr!'t@Q\ t@Tn't@Tj p' "#sp 2 x̔ p 2 <  2 2  'qp    `2`2`" ` ` 2 (*  2 㿘` @@Lo .`. `6 `& 㿘` i@@L^ j` `. @* *``2@".㿘T  (&@R@ "      &`   &` &`&` &`&`&`h  0   ; 2(˒Ȁ   N '؀ 'ܐ  '' @''' ' ''''㿈   㾈 "8    2.  ( ''쀢 " &  '   N  ( ''x'|'t  h ,0    , 2)L耢    N ''̀'Ȑ '' 'В @''''' ''' ,㿈     2'3㿘?"@` &> 0 p*` €"ՔZI  hȐ@K& ,,8(  @ "  2   ?  ?'' ,''''&'''''' ,  > "' "`  p   2Vp "P   K Nx 2 _0xp ) jfOr #`r 20'@Rc'\\@Rbٔ 2 '`'d'h`ՔX `2 @J!  't'x  'p   > 0 㿘``  `` Fs > "'k ` 'h@   N'H j'Hp@Qa'LH@QLL@Q Hg  2k`"'P`" 'P_ N`` NW␐'T'XP HK'T'XP H@> . 28D'  1DH@`*   #@   N`[D 'd`]pD 'dhhD   > 0/ 㿐 b'    &&ٔ ` 2 % ?   $ 2 ''̒Ԕ 2 'c 2?& & 㿈''胒㿐'L㿈   2%?c @ @    0 Ȕ m 㿀? `]&> 0 *` €gQJ ' '߰䀢 2?` @ ?'@ ` ''ߚ 2)`  `4''ߍ  &Ag j 㽰> "`'@ 2`0  $`0`  P 2}`0`?'T` `ڔ 2p`00?'d TPb Xǒ 2]`0  V NT 2S`0" T XE&    2 jp j@P$a'@P# 2*`0P %   N!`0@'D'@'H@` d h'(','@' '$''0'8 &`0`,?`$`0(`0 > . 8㽠> "0'@H,!@$ 2 0s  % 0`  0= 2a 0`?'4'0` @/ 2S 00?'D'@ 0G ?@?A N@  ; p j@O'@O@O '  2% 0``"@4 ``0  @ R @D0   ? '4'D''0'4$`'h'`'d` 2 0ϔ 2 0     '0'<'8'@'D@  2 N'4 ('4p (?0'4'D'$`   ?'0'4'D''4$`@'X'P'TPݔ 2 0$` 2 0   ( '0'8'D'4'<'@@  2 NŒ'4 '4=6@" 'D'H'4'4'@ (?'4'D`'_$`0 $4 #! $'44!!'48N4 2r 0@  k NHpH@ '''' @''' '( 2O 0$ 2H 0 '0@  2? N'4d '4fp0 N'0'D$`)$`` "`48 2 0`0 2 0``@ 2  0` `  2 0& 0 ,?`% 0' 0 > - H$@$H$P$X$`$h$p$x$߀$߈$ߐ$ߘ$ߠ$$߬$߸$$$$$$$$$$$$$$$!,"^ ! n"Z  2"V  S`Q K< L` "H  5 C` 2 >`)`": $"6 "X' 1`'$ ,` "&  `% `           * `2`` 2``2  (> 7(# ! 2 K n   !,"X$' )` "#%" !㿘  " .`  " .`  " .`  " .` !   " .`  " .`.`  .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&`  `  ?&` В `&`( |&`  0 " a  0c b&`  @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` ~&`$ `  ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` !"   ` 2.`.`  ` 2.`.`.` !.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&`  ` `*@&``  ?&` (`@ &`  #!" ` "#`0 ` &` $` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&``*@&` $X`@&` `   ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&`  "@ `"`  ("` "` * $   2@ ` 2`  2` *`2` * $ > " '  "      gp , hx `@ @A $ޒ   { $v  `@ 2m` %```  $ 2X   2N] C Ē?#`> 7!4*` €      @&x`h@ 곔 ꧔  2 `g@ > 'А X$$$$|$|$|$|$|$|$$$|$0$p$$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$|$$X$|$|$|$|$|$|$$$$ *@ *` *` *` *` *` *@ *` *` *` *` *` *@ *` *` *` 2` *@ *` *` *`R "` *@ *` *` *` *` *` *@ *` *` *` *` *`  ?`#`w&> <!*` €`w@ 2Ͱ鴔  2ư駔  2 `v`c@ `@ n ؐ{  2|     }`@ xȐTC P  2h7 `Y`t@ T` ,  2DC `u5@ 2 +   2$ ~ " 8  }    }   ~@ $D$L$T$$$p$d$$$$$ $$$$P$d$x$$$$ $ȝ㿘!T`(`'L͐  @?!x?&`( $` L$` `$`  $` $` $` $` $$`  ($`$ ,$`( 0$`, 4$`0 8$`4 <$`8 @$`< D$`@ H$`D L $`H&`$$ &@㿐 $`(!蠢`ω  @ 6!T   "`(? < @ * # #  #  #  #  #  #  #  # $ $# ( (# , ,# 0 0# 4 4# 8 8# < <# @ @# D D# H H# L@ @  `C?" @&!(?> *` "@"` "`"`@"`> >*5 "` . "`  0%   0 "`"`> >(   "` "`    "`"`㽀> b> #'`$ aTa aH @'䀤 a*@ " aa#a  p= ?p! ''''d'α ?穔"  ?碔  "aL˒ aL$H$$$" > $ʐ h㿈> a @aT5 ?``81 > > ē*` €> @# x" > @  $ 0> @  [o$ 0*`" *  * $ 4[c$ 0$ 4  `$ $ 㿘@> @o  㿘s㿘` ` $  ` "`0!" ! ! 0  X ے V > !\&a4%%%%<%<%<%%%%       @  !$ ( "@  2"` 0"! @0 0 @0 "# @2 2!"$(  @ > ("`"`$"`( *     2 @2 2 !"2@$2 2  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " ` *`"  `*`   `*`!㿘       @     &@  &`  !"   0 "#0   02@2222 2@ &` 2  2 2@&2@2 22 &`  (> wa & ` &`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`.`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  " `   .`! !2.` .` !.`.`㿘 6@  6` ` 6`  6` D.`㿘&@  &` `&`  &`  3.`> " 'Ѿ@ 20ɰ  $0`2 )  `!" -!!"C`d`a "` a_k P`$`d"` !M x ":`l  -e% %"Ӡ# %  "~`  !0GNe"`!wC=` `&13!0!(h.!,( -!" !!!)!( `  ` !2!1  -0 !%0"   .A"`PӐݒjג/ -ĐȒ0 !0!! &``Dؔ  20D "'DD  @D@Ô <'<Ô  '8 `b@8`h@ 20`㤔  20g77@w`h@x 2o0xp'pz`'t㋔ dv\&``w@4 `W(`"U0`< 2Q0` `"K J0`4j C<&`?  `@ 2607` @2 `:`H !C $`6  20P `@ 2 0( '`` @` $ 20``  @0  20f@00`,  20`_@,0`ޔ 20@ 20`Ք `Ȕ 20@ 20`⿔ p`Ⲕ 20!@`⤔ 20~@ 2{0`⛔ t0`⎔ 2m0#@ 2e0`⅔ ^`x 2W0!@O`j 2I0@ 2A0`a :`U 240!@,`F 2%0@ 20`= `0 20!@`"  20@ 20` a@࢒ 20 'X'\'`'d'h'l't'x'|'''' '$'(''H','4''8<'@''`XL'p'//'''''''ϔ `HÔ 20H?L'P'T'X'\'`'d'h'l'p't'x'|'''' ''T''D''' 'H'$'(',x'L`'0'4'8'< `/2   /` `/82   /80"aП@ 2>0K"a@ 4` '((S ,`` '$``"'$ 2 '$ `@$   '  - b}@ Kt0,?`$0\0 > R!R "  "2@?? 2@ 2` "` "` 2`2` S  " 2 ??2  2 2  ::  ::S "X`?` O> ?#*` €> #` 0 @ ?*@ @9&`@?='`@''@?8 `'Ȓ৔  :Аࣔ  0 *Ā '  !}`  -``> # 0  ?. %*%*%*%*%*%*%*%*؝㿘@ ?"@@㿀@>!'@> @> `&@'''D㿐@>!'@>  @=o㿐@>!'@>  @=@Bf㿐@>!'@>  @=ٔ@B|㿀@>!@'> @=ǚ `'`@''Ē㿀@>t!'@> @= `@'''ڭ㿐@''9> "`'@>N! ',    ` @@&`@ ^ 2}> b@;k  > ,@>-  &@> " ߢ  "dfb(@;U  [` ߌ 8 2X߄  2PД  /А,@> X&`  '0 @=,  > cИ  ?8'4'@'D'H`p'L L 'L'PL`'T@'L'X'\'`4'tH  2` 0A X 2ʔ > m"0㿐 ''B㿐!(!   @'㾀Ԥ$> `"`  ?'6@ '7`'7@:!@  @ `@"$`$@ > #"@㿈  @ %( <`  `> G`' ' @@  0" 0`,  `0 ` " &x`?2* ` ` $ @*@'䀊`'؀  > cP ܒ@*@ *'`` `:'`?''ذ㿘`  㿐 @> I`2` ؐ   "$ (`) 2 ``>  H*` &``  `   `  =` "`: $ `(`` 0" 0`, e`0㿐  @@G : (`D`<`   @ @D   0" 0`, 2`00` "$` h$`  0" 0`,  `0  (#> b'@4 e>    > ! > /  > ےbX@9 > !0 @ݵ eb > "`㿘`  @ 4]0p㿐@<!'> @@;N `    K`2`2` 2`&`o 2. 2+!H `2% , 2!2  2`0  &`0V` `2 `0` `a `0`,?`&`0`0 N㿀@4 `5    㿘!H  ` ` `|`x  Ŕ i   " & z   "& &  X @@3ې $ ' ' ' ' '  @' ''В'H@;i!'@>  @:@ @''''' L X  H    @>*@$ H`㿐 @ !`( X  H``0?"`0`,  ܐ`0  > @*@$ H` 㿐@;!'> @@:J `< @@ 0X@> Ft("> " <" ">  " "„"  㿘@   "@@C㿘@   "@@C㿈@>  6 >  \* " ` '`'`''N 㿘 > ` @  `@@"```@ @b 㿈@`> $` ;`"B ` ',`  '@ $ $  !* 2$ ! "!  $ ! "   $  * `$  2` ۱ " ?!   $  㿐9 @''@H % * @,`@@1,`@*` ,  ', @1 '`H* , `H`@0, '`* , `  @0, @'] 㿘!?΀@.`  && "@*`" * *   2 @@5@ ,`h H( h(  *H 㿘> "p`" @2  @ `> "'>  `ǖ '" > , "p` @2w@ 2`@`@2q 2`@` 2>  4> > Ӓ`@6C`'Ē`ض`'  > %> ,9> N;> RL  -`*` :`*  L?Ѐ  3ڐ`3א&``&`0`4 &`4 ` &`t` &`x`  &`|`6J`4 @ K ~`$+  + 4 &@ @ $ @   `@$ @ *@@̒    @Ȑ  `@  *"@ *`" *  *  &!: !@/#,` " ``4 2` * $ ``$`4 `8`+   "`4"  aؐ ߖ > L#&`&`?`> N`l&`&` W > " > Y Ё㿘0    4 g@ ` `d `t %3 *` *  4 `??P `? b?*`?"@" 2  8"*` *  4@ @  b? ? `$ `  `* `b* " 2 ?"  " `  "$  `*@ `! | 2`*` *  4 `m    "" "  `*@  x `(2`* *  4`  c *@  "`b"  ] *   T"* *  4@ 8@   c*  *    ?#     c*  *  ` ?#  ,` 4 , c (   # ,`# (`*`* ,` $ ( , "  "     *   ? #  `*@  > !` ̒ 0ۥ 㿘  u 0q > ײ ,*  4 `p _  $@)> ת )>      @    $ @    0 `h*`@ €  $@ݔ Ho o ?$ H 0   `h*`@ €   > `0v   `H (`Pvu" `p `h *$`p @ 0,$ 0 4  "0Ho o ?$ H 0  "0 0 P > N쀢    `? 㿘 &   , > Q> Q b`4 4$ `" l$ " " $ $ 睔  $ $`$ `` ?@"  ޠ 0&`0> "> !(> !1+㿘? @2  `>  `2  ` *@` `0, *  4@` p b$ l"$ pd#  c$ $ $ `  $ ` @  $ `   $  !%$ $ $ `$`$$` H /e * & @ h `,`*  @   @  *@@Cj  * ` `2 p`  p &$ p ?#$ p$`I H /e `H 0 p =8$ p* & ``   p " #> $ p !a0k   p "H 0 h> א ؓ*` €㿘>  !  *6 .  *  4@ >  h ؓ*`  €H /e * &  @ p  @9 H 0Z 㿘  > ! 6 . *@ *`@`<> hؓ*` 㿘  > ! 6 . *@ *`@`<> hؓ*`   >   2 * *` (<㿘> !   *6 .  @*  4 > `h ؓ*`  @ h^< ` ]@ P `y@3`x@0O `z@!`{@" F  k@ "+  j@*\@07 l@m@".    $ ( 0$    @ 0@ 0@ 0 @} &  &Ԓ "  $ l>  0*`( (4H4p(p 2 "p " H 㿘 l>  `! `2`**`  *  4H /e4 p* & p V  H   & p  HB  H   sx H$ , P$ ( p & p H 0 H(  h(";`"' 0TDQ l2 m2`@2` 2` "a`@6 "2`@00@22` m*2` l(0! @ ` m *` l *0` @ ` m(` l(H  㿈 l>  a 2 * *@ *``4`(       2 `$   ז耢  H /e * & `(    S`(`  v r* * `$   | x* * @G   @D `@ @ @ @ "`$2 #!"  " "" *@`@  " *@  * @    @  N *@ *`@@2  "`` *@ * ! * H 0 > R؀    `? 㿘 &   ! `l`T `4-> T+> T  4$ ${a   P P` P &`0> "> !(> !8-|㿘?2  > 4`2 _ 4*@`"Z `06V . *  4@H /e4 * &    H 0;  & H 0$& @A?& @>  && H /e * &  h*@@F   @C   * H 0 &   > 4 2 * *` ( < 㿘@h㿘@b㿘>  !4 *`6 .  * ` 4@ #  @&=   @28 #83  &/ $$ + @$ @$$  &@ &@ &H /e * &  h@* @ o&H 0 㿘@㿘?2  @> !4 2`.  `*``*   4   @ 8   ǐ  `$ $ Y  T @@` 2   QL  H  $%`H /e * &   8 $ > H!  H 0 "` 2 `% ` @8` u   2`H /e4 * &      ?$     8  ?$ H 0`  %` &`ߒ 㿘   & 㿘   & 㿘& & H /e * & 3>  h*@ r * @Œ   @”   * aX! (  h*@ *@   @ @   @ H 0 &㿐& & H /e * & /3>  h*@ aѐ" | x*   * *@ @d   @a H@Z   @W   * ah!   h*@ *@>   @; H 0 &㿘  . "* > ǐ@'d* 㿘  1> Ր!@'X#耢 !@'S#㿘@   `@  ( 㿘``@)6 > @)0!   㿐4`> *!0􀢠> !* 080 y &a> &` a &``> a &`쀢 2%&%"%&`a  &`&` k &`*@a@(a`x```@``0 h@  hk  *pa *hqa *(aa *hba*(ca*h@a*(Aa*hBa*(C|`` `#\> *Y"> V` Ԗ > [a Ζ > [bX&`x&`|?O> Z"(&`@&`D?F> Z#0&` &`= \> V `?㿘  @!&!> Y> X!ȤaL`4, 0! $*d" " $$ $ $ Y   $ $$  `@  4`&`0> "P> "X> "@)㿘? 2  > `2  > a\  6 ᄕ*a\ @ 0+   *  *  4 p W$ l"$ p]#  c$ $ $ `$  $ `$ @  $ `$   $  !%$ $ $ ` $`$`H /e * &  ` *d@( `  *d@bɐ P*`$`2 p`(  p %$ p ?"$ p$`H H /e `H 0 p =7$ p* & `   p " #> $ p !b`c   p "H 0 h> א ؓ*` €㿘  , > a* 6 . *  4@@ h> א ؓ*`  `€H /e * &  @  p   @ *hd*(H 0S 㿘  * > a* 6 .  *  4@@ `h> א ؓ*`   @ lW8 d ]@ T `y@7`x@4S `z@!`{@" ,J  k@ "+  j@*\@4; l@m@"$2   , $ , *(d  *0$  @ 0@ 0 @ &@ 0  $ &̒ "  $ $ H( (d"5``0O?LK 0  (2a@2`@ 2` 29`07  + 0 ( `+ 0  (`#("`+ 0 (`@ (` + 0 (`(((H  㿐 l>  ` `* ᄑ* 2`*`  *  4`(    @ 2 `$   @  H /e * & `(    X!  *hd`@ @ @ @ "`$2 #!"  " !""! B*(!@(`@@  "! D*(!@(! *h! H@(! *( ! *h ! *( ! G*h ! @*!*(!*h!*(`(`!*h9!*:`$ " !!*h1!*2! @(! h( @$ (H 0 㿘  *@ > !*`6 . @ *``4 > hؓ*` 㿘  *@ > !*`6 . @ *``4 > hؓ*`   (> a(2 * (4@l> * a(0((4@H4p(p 2`,"p`, "`,H 㿘 l>  ` `* ᄑ* 2`*`  *  4 H /e4 p* & p" V  H   & p H:1  H  k  H$  P$  p & p *(d  *H 0! A0((!( z4*!x*" 2 ! ",",! ("@" a A0(((a46a*azx*" 2  ",",a ( "@" ! (A0((!(4, .  *({! *({, ",, !({!({,",? `" "!({!({ $ "!, " !!  (*(,߆",#@! ( A0(( (4 @ , " ,"@ ((㿐'  ! ,w ```P@2?@?<! ! lv  2?o@?!  lu  2?@?<!  > !`  0 㿘a   0 > ׮ ,* *  4`p` o  @!> פ     @ $  $  @  `h *` €  @ Ho o , $ ,H 0  H /e * & a*(da (H 0  `@$ ( `h* € > bh #  `H `Pi" `p `h $`p*@ @  0,㿘.`@%. 2?#@2..  > [ `?㿘  @&!`&`0> "P> "X> $"   㿘@ 㿘@ 㿘8  㿘a"  ``> $t". 㿘> @"Вb`?㿘8 0, &`@@ `@< @ @ (@> 0 > $O"0> $K"0$H"@2㿐 @'  V  @`@'   > "$$ !` @ "< @@ ?"@ @ ( @ *`㿘?> ԑ2 `  6 ԑ. @ 2N <  2  $& 4 . <& 0 㿘?2 >  Ա. @ 0 @Ɛ d  d 4 , <㿘 0 "B   @ `  ` ِ#   @ ` 2-  ` " 8'   & 8*` @ ` *` @ `2  @λ#  $ @ @ ` "  `` *`2 0? & 0㿘?2 >  Ա. @ H $ 8$ 0 ` 0@&` $ 0`$8$ 2 4  㿘> @!# 2 V@@ P> c y> #A(> c8y> @!cH 0> #4#P0   &`P<   &`TH   &`XT   &`\`   &``l  ۖ &`dx  Ֆ &`h  ϖ &`l  ɖ &`p  Ö &`t   &`x   &`|   &`a4 " '> @!Cc 2'8 '> ?c`x@`P* `&`@&`< "`<@`P`8*  " d@`0Ut> "#p˔!D8 `'` ''> ]\ ' 㿘 @#> xkcx   & L> # "05 @#n& H Lcx @x/ H (`< * *    L`8  @2 `   " `8 L@ ` "   H&`<㿘`>  "U# 㿘> @  `?㿘4`> "C 0 > !":08  0&`0> "/!8> #>  haH@ &`t 2`0`t &`t`0.`  `# `8``  * > ^`0  > ^"&`8&`<?> _a@`p>> >  "  aX -> )`@$0@@$- P`!ߐ` `2 > !א!h@$ X> !ΐ!p@$@$> @!x6Ԥ`> !!` @}  @ `0 D*@@&`x㿘  0 ` *`   ? 0 ? @  *@    t " |  R @/  | "  > ? 1> : >  a  0 !!l  0>  & ?& &   @ & |& x !!T >  !!O & & x& |  *@   & & |& x" |!<  0 | 2 t x  t t `  & t& x "   0 `"* 0   :r 0 n & @  2 | ` & | .  0 @ *@V 0 2S 0  . M& |㿘> 8@  > @@ h#> b C '//ɒː/   ''@0b > ߐ"Hh> "   /'''@ݑ,  `  @W > "X      ܀@> "p  @K   ܀@ p  > "> ">  "@4   @  @@} @b p  > "> ">  k" "b p € `b > q"h!> "   /'''@ݓ*`@& p" > U#h!> " #  /'''//ʐ@Ȁ`& & " > 6# h!> " $  /'''//ʐ@nȀ`. . " > #0h> " p ' @ t @ `? !   ///'؀` '쀤   5N a"@8 t`  ba"  5; b > ڐ#Hh!> >`>  `"   //˒'/''/@ /" > #X㿘 xʾ  x H/` / t`& t`ǥ  & x`$`& `& & & א |` & x ǎ 0`$@$H 0 0 c 0" 0(㿘 0a b   p   0 `  * h> > bd"bd'""` ""   /''ؐ " > 7#h㿘> "d`"d   @` `  > d d 2 㿘> "d`"d  @`  ``p @*` > d d  2 @ 㿘> "d`"d   @p `""㿘> "d`"d  @ *`  ࡐ   `` *ࡐ @֒?h> > bd"bd'"< ` "8  ?2 #@ @ 7 6` /'/'/ʐ$ d ."@C d  ! 6  0  ///''  > ]#> dd  "( ?" 0 2 `" ܀   "܄ `" "܁> d` d" @`?  0    ``܄"`ܐ h> > bd"bd'  ` " `  { !@ "!@ q!@. !@ e b -` "^ "`"`S " ` 0*@K$`0*  0* @ A$`@`p /  Ȕ /''܀   . z  /''ېܒ `8. .`  .`?`e?. ..?&`p` .. > i#㿘 ܀ >  cܖ ؔ  "c??*c* @     <؀  `2``"`` ""  > d d"    R`  > x"`8"`<"` ؐ 㿘> @_#`? 4 0 #> cr@ǒ 4> # 0dc r x`@``0?   ? " > d#&`@&`D}є?> #Ov>  #> d"D&`W> "&`x ,`* *  @ ,``* ,@*`&  ` 0&` 4 & & & [,   "@    & &,&&@`͑,`㿀> c' x> c'''' & @g0# ? ?(? c ?ߐ c 2 (2 `   ,   @& 00 & 0㿘 > ,;   #  # # # #  #   # #@  "> P @*@" """ # ` *`  # # \#@   ?`((2` 0㿘   2 " , u2`   ?Ϡ 2  @ 2@ 2@"  a0(2 %`  d `   ` >  `  ,`00 @L  )  2 2@㿘`> d> "H`| >  P㿘%> Ho o  Ŧ  *@ , H 0x     0& H 0* *  *  ՠ  `   0 ̔  ,$ 0@ 0 0  ? ,$ 0 @ 0㿐    @ "  2@4   `" @  4㿘H   *@& H 0 ' 㿘  ( 0`  ,ߐ 0!  , * @`2 $>   0`@ (" (" $`>  >  " $" (㿘 >  Ԑ  㿘 @ *` `? c *2`  > ` > b& 4> e#& <R  @$ $@`` 8㿀@ @ @ > a' 4''> ed''  Q&    *  2  *`` 2   ??@*    2 ?? *`  `2  c *  @  0  2   *` ` ? c *2`    &   `@& 㿘`> f>  D`8ė > !㿘?#%> Ho o < 6 H 0 < @  0 * ,&  %!P 8 " 8> #d`>  ${sax @  8?< 㿘`c deZ4%Z@i#Ü!@"@ @]"@ @Y"@&`d  &㿐!,ؖ* *` @ #` `"   @ .`  *    ?# 2 + @ 2   *`@  `!2  (""" ""  (`# ` ,*` # # # \#@   (# 4 # #  (# 4 #  #@㿘   *`& `2 @" !   @*   "82 @"  @*    '2  *` `  ? c *2`    ` *`  ` ?# 2 *@ 3 U   *` `  ? c *2`     ? *      * 2`  3@@"  ?#c  *` `  @ `*`2@     9  ` !`4 `$/   *` `  ? c *2`    @n 2 ? ?   *`  ` ?# 2 , @2   ?& 㿘  *` `  ? c *2`       *` ` ?# 2 *@ 3@  $*` `2 @#" " " $" " `> !> !㿐> ! @Jb@> !`'> €0  㿘> @!`?㿘0 &`4`&`8&`0&`4 &`8&`&`&`P&`0&`x&`@&``44> 2!0Q` > ,!0K> (" 0G `Ȩ?`h0``  }   `ꀤ``&`T&`4%@$&`h&`` ` `I> f" &a&a`a?x> "@> fc\&`&``ؖw?> "H 0 D 0 2`@8 (D0 (㿘`@(`?㿘> "X> i&`0"&`4 &ah&a`F&al㿘aX@   "  $     2 㿈 0&!X ,@ 4@  0 0@ 4@ +!T 2T !X > N #H`"!X@Ӑ!X 2!X d ̼  2> ֐"`@ d ?$ `$ $$  $ $ !\ "&!\!X   $ $ $$ ($ T$ X  2$ !X  8)> j'> j!P!P'!R77'耢 $ $`  2!P`?㿘!X #>   "  $ " ƒ   $bx  $ $  2 㿘!X   "   $ " S  2 㿘`   "@ @`㿘 ` -> S 8!@ +> > "'> `Ⱂb,``Ɛ`,```b?#@*`%`"> > "> "@"2> > ""> "?#@"> > "> #`> "> # `  +> > " %> !> `# o``  `eb !X" 2 `  (  㿘 ` "& (> #(㿐 ( 2 > #Xad  "ad `0,€`4 `   & ,0& 0@& @D  " & DH& H2 ` !X` " D "@  @@(,2`2$   ,0 4 2c   H 0 #\  4 D  "   0 4L  (aX ? `@   T ``   (  @? `     !X " `   OՒ  Nђ  M͒  Lɒ  P L Ô"  `#`& `  ad? "ad `00€`4 㿘 ( 2 `> #X 6  ?'& ` & `aX` " D"@ @ *@`@8 `0`4  H  , 0€ 4 ad? "ad `00€`4㿘 0 4 " : !X "6   "2    P  & L L*& L P@( O& P O@  N<  M8  L4  P L ."  % '  㿘` !X`"` `  `T  2`\`\ 4``2`T+@ ` !``> H#H /e * & ` $`T$`X$`\ 0> m  4ğ` "a`H 0H` 1` !``> #H /e * & ` 0 $`4` $`T$`X$`\ 0> m  4ğ` "a`H 0` H /e * & $`T$`X$`\H 0` !`       0 `  0  4㿘 !Xy "v   @"``T  2`\`\4``@2 \ !``2 0> #$€ 4B ?D  & T& XK"!`/ !``> ~ (H /e * &  0 $`4 > m 0  4ğ  "a`& X& TH 00H /e * & & X& TH 00 0 $4㿘 0 (4㿘!X "  T "   ֒  "  T@ X  " Ȑ ?ʒ   2 T%%%%%%%%%%%%X%X%%%%%%%%$%8%L%`%t%%%( 83!  ??<" 8# 3!?????????????'#!#! #!#!3!#! !X#!$'> q`L@ ?a 2a㽸'D 0D$ 4'H'L '$D>  P,#\ Ԑ  $  €D>  %?0  ,€'$w  'ؐ '''(    А# 'Ȓ @ 'Ԑ 'Ԁ  LH€ Ԑ '` `'> m"`*` €̀ -Ȗ Ԑ Ѐ'(`?`jܒ` e `* _ `* Y *`  '(̀ L` @G` @ԕ*Р ?` @:` @ԕ*В`2@ ܡ,  @< Ԥ cА@#ݔ   @ @ @ @D>  v̀ Đ?@  ` @*`  2Դ`"2L4 В`@ ` `?%?В`@ܒ` @ߐ `*@ ؐ `*` @ѐ `*` %֨ LH { €,( `"-`  ,#\ $Ԁ`ԑ2 'Ԁ`  ''( + WU/ 0@ 4* "@   ,#\ $@`2@ԑ2 '@   'и Аn `'Ȓ`f `'^` @ ԀCВ`T `I2 `M `S2 ̐  ' €$㿘>   8  8`  >    >   $> > ! |!( >  w!H @ 5>  '> %> `"iXf```  `\h> !pV `",@> M!`` H> m"*` €> @!C> > ;!>> > 6!9> > 1!4> > ,!/> > '"*> > ""%> > "  > > "0> > "P> > "`> >  "x > > "> > " > ` "`` "`> @"   " >  > > #  4# 4ܐ#  4> ؐ#8 `!->  > А#H  @ 6 8> #` '> %>   px`  @   8 "1 T> # 8 @ 6) T> #'>  <   > #px D   ?> #x@ 8`@    T`> }#{ `> u#  > o#  > i#  > c#  > ]   > W   @> Q   > K  !> E 0 "> ? @ $> 9 P (> 3 `1h X 2;> ``2@>  h"㿀 "B  "1  + 0 " 0 !"~  "V 0 ` `h! " `h   2 `h"! `ha "a$&@ &`&`l&`    |`  @ `h"  r`  @`h" ` *  `h ,`!"  ` `h  e  `T@  @`2`h0Y W  G`  @  A`  `h*` 2!  7`  @  1`  `h*` 62! 3`l  ?2&`l`l 2&  d Δ  &`l>   @ ' d@?`l"``l&@"`l" `l"`l"``h`l!$"`l`h "a$  `  @`l"    `  @ < 4`2@  `l 2(  d Ċ  &`l>   @  d@?`l"``l&@"`l" `l"`l"``h`l!$"`l`h "a$`l"   `  @``l"`l"   `@ ,   `l*@   " `l " `  `@ ,   `l*@ `  "> ct \&`d    o` `d @ ? s @ \   2`d>  1 Ҕ \%X`lX`"`l"`` % &`d` ` \&`d"   ;`    %`% @  %  %  % %   `@ ` @ ' ' ' `' #' @ @ `` 5  `@ ```5 @* @  ``  2`  2`  ג@Ȑ`  π %`% @  %  %  `@ ` @   ?%  @ 0  "  B 0" <   `@ ` 1%  @   ~ `*`@  % `@s ` @m `*@ f `*` @_ `*` % "  @"  B >@ `G@ ` @3%  @<   6 `*`@ !%  `@* ` @$ `*@  `*` @ `*` %@` "@ @ h *@%% %쀢 9   `@ `  ~? %`@% @  % !%   `ג@  @  `В@ ` *` 54 * 54耢  耢  @ %8  `@  @  `@ ` *` , %<%@~%D2,  %8  `@  @  `@ ` *` , %<  `@  @  `@ ` *` , %DR%@ `s@ ` @   %8`ha r2a  ` 66 28`ha 2a8 @. \ <  `G@  *`N%  `:@  @  `3@  *`8 2   `'@  @  ` @  @ *`  @  *`  `@  ` @ `* @ `*` @ , %@<" `ha 2a\ @  `@  *`N%  `Ӓ@  @  `̒@  *`8 2   `@  @  `@  @ *`  @  *`  `@ ` @ `* @ `*` @ , %@@" \  D  `@  *`N%    `t@  @  `m@  *`8 2   `a@  @  `Z@  @ *`  Q@  *`  `@G ` @A `* @: `*` @3 , %@D"8`@خ 䀢 / +  `@ `  q %b%  $% (%   %T    @  ` 㿘9>  P    ` !P2!R@2?#@`!P?2!@`@ 2!D "@ 2|`@ P> #H`!!X>    ؒ!@@ +>  '> %> `"  ``  ` a!X"&!\`" `X  2`X  2&!\&!X  P d \ 0  3 \$`X`X"$$    #ޔ d$$ \   ` \А$`X`X"$$!\"&!\ \ >    @@  `2   `  㿘! @ 㿘 ">Ԓ  & 0@ > ! p 㿘") " aR%b 5 = |  { 㿘" 0@㿘"㿐 &b ΐ "8>  3!88`" >  ,!X `>  &!%b ahal  2  b0 4@ 2  >  !0f  b0 4@ > !bb&b`&bd     bb > !0B> b"b%b %t%V .b  > wc|| 2 .b 2 > .">&bԒ `b &`0J@ "> > "0> "8 Ԕ㿘 "  `0`4""" 0 €4㿘 LH /f`* '` `"T01""> q & 00 @2R" 0"H 0 㿘 2     @ `@  @.@  `ؒ@ ` @`,   㿘?# #>  !@b@@ b@   ""b@`& "#" "@j 2@c 2b@ @2  Q  $ 㿐&c4  .%> '>  ``     " ϐ Xː X   `0c `4@   > "H X 2 2c> "h%?c&c &c&bL&bP[c > " c &bԠc   Oc0 > "0   Ac, > "c4> c #x  QV ,?c* %> !@@@ @   "!@`"`" "  " @ 2 @   @`  `"``@  R0 @bQ $R > #xc4"` `@  `@  `@Q` "bP@_ 2^c4>>>>>>"b,Pd!Pa &c&c&b&b&b&c&cbP *bP ` P2c ` p2c>>>>ː#c|X&c&c&b&bc? >>>>>> `$Hd#@c&c&c&b&b&b&cc4>ǔ `c4 &c8J@ > #@: c4 `0`4c,c4 `0`4c0c4 0 €4?&c0㿘#0? < #4  `0`4#,#4 `0`4#0#4# 0 €4㿘 8H /f`* '` `"T0#4#4>ǖ N LK0 @2RL#8`#4#4H 0 㿘 #4>ǔ + #4> #H 㿘#4#8#4p` B #4   0  4 > #p 1#4  0 #\   4؟ > # #4 ؒ @. `#4 `0`4 #4 0 €4#      # *@ #  "# p#4  0  4 > # 0/#4   0##\   4؟ > #~ #4 ##* #  2 *#4` 04 #4 0 €4㿘>  {#>  ! "  `" @ 2  ! "   `" @ "" * >  ?# " 2   @ "  @2    㿘@ 㿘%`&@Đ̐  > #0` 0@  4 @ @@  > #Pm@    @  > #p]@@ > ڐ#@ @+k&kc@ "@`&k&k &k&k&k2d2k@ `4`hk  ?<#2`> @c`&@> #@J "> > #Ȓ#> #> ϒb "b@ !#;@&@ ` `0 `4@  ` 0b @ €4㿘 0%!""$   0 €4" 0 €40 㿘 0H /f`* '` `"T0-#b>@ 1 c& Eb@0 @2R% +# &+b  b H 0 㿘> @`#؀`?㿘0i&i4&i 8&`4&i  8 j &`  >> ܐ#0! X&h&hhЖ`dޔ?> ϐ > |> |a"&h&h> `Y &i@ &`&hA㿘)     㿘)     Ő     d @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   &    "  $*0 ` + +    "* 2"* @(*`  *02 @"@ @b 㿐   `  ` @  `?> ǁ b    2  *2@ 2  &  4 @     `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘   `  `  @  ` " @ ` ?  2   8㿘 '> >%    &&@"  @ @Ő.$>  ?٤!>  ?0Р @> > >  (0Ő 0. J@   J@J`  ?*  8 B  *@  2@* *@ @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  'D'H'L'P'T'X2J  J@ `2J 㿐@"  `  ?2  㿘@  H 'T> "(@Z T :8?T2 7耦(7耢 2: , 4`444`4`4`ؑ45 'ē45 5 5  `B'? 8' `@$`@`*  @@`*  @@`*  @T  -`@T :-`-2 ,`- ֓2`    `" ` '``? '8  đ. ?2@ Đ"  * c'Ā@ '.` @ '   @ @?  7 / @   7@', @@8 '*N2 . 2, @ ( ?#   ?;@#..  ?2$$6`6'@  @"6``4@  *. ?  @26`@4@2@ / T$   . " @?* 2@ @2. 4@*  *`@ T:@̑* Τ Г*`@  +    ?( 0 2 + ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  ?* 㿘  `"@ J@  "@ 2N@@  @ *@`N &*@ J "  * 4: : *2@ :    4  * *  @    2J@ "J`  2J@   88 @@ @  "`"  *@  2@* *@    (+  2 2 " 2+J " ? J(8  J  J  (8 " J  + @ @ ` ``z  @Z( 2 "" 2 @  &㿘  `  `  @/# @*   & &@&&`-)`"   ` 㿘?#@6 6`  ` : & $ @$@&@ 2   *  , " 4  "@ ,  4 `@ -` 5``@`  H/ /!(?"@!( "!(H  H/ /!(?"@"!(H  㿐 $!'! ` `'Δ  @    !  $!$!$!! @$! 㿈@` $` `2`C  .,`  '@ $ $  !* 2$ ! "!  $ ! " ,  $  , "   $  * `$ y 2` j "  `$ y 㿘``@S  㿀@!'?'''@Β '' 9 0  $'*`  , `*` ,@$@$` "  xL@ /s `@?L /2? @ ''', '' ] /3, @ ''''' N''l'h''h A 7x /@ `@`$ `'@ $@=  ' ? 'ޒ #` x0xϒ    @ 2  *@  22" =!` = 8 "(> " t'@ ݔ )c@ "O |  b@ ":  @"? O?@ "" hJ?@ .!>  |@ ??@ :? ` @` @5 `@"  )`@&`}@*&? `@y`u@"?  3~!Ȁ?" . 3r!Ȁ?" .`.`@ .6  ' ' ' ' ' ' ' ' ' N'䀢'耢> "`* 'N4 '耢> "`* '/@/V?c?  & t@@  @     . . . . . . ** * * . *N  * * * **** . . . . . z. ' ' ' ' ' ' ' ' ' '@n'  ~@ "8  }@ @ ?# *` * * *& t@9 `#@B: &> ",`0> "X ,  %& '`& `b' &     2 4b&? b > :"㿘` @ ````  "  @ ! 2  $2 "   " `t # ` 2@@` 2 `2, @ @  @(0(0>  b, > " t@``` ` `" ? `"  l" `@ @** ߀` * , :`$ >! `@"    * * @?  @#  @" <" @ "`"@"`"`  t@`` ` " "*@*" " @2 wh @@` (0*   `  @`*  `` ` @@"`"@"`"` 'H`@ 'd'\'` `(<  > c `h @8@*  c` \c \''''''''耢?  '\`ؖd`N\ o%@`k \R` N 4I`@D`$@`;'``7  42`2@뀤`0+2=    D  "!  ` ` ? '` D$@` ` `@̀ ` d "zc쀦 \H:\ c! c *  2@ "` 2` 2`  2`  2` 2` 8? <"`"` "` ("`  0"`( H"`0 D"`4 L"`8 P"`<㾠@ D'(''$'',{ . = 2'ؠH` @㾠@ '(''$'',{[   2'ؠH`q @`=@ 2 0%  $ 0 ` 0 ,?`$ 0ԏ 0  2'ؠHe`B @㿈`@: '?B㿈`@: '?x``@: '?'&㿈`&@''' N8`   '@ ` 2`(v < r `` ''`'''''' ?X`D 'ؐ  =: `%@8؄????'''  ,'    : Ȕ$  *   &ذ’ ˒  `  `"@& 0" 0`, ӯ`0h@``` 0& 0#``'`'` ''ے` `'`'' ` `'`''`@``` 0-`  0(` `'`''` `'`''.`'h ` `'`''XX@``` 05`$ 00` `'`''&``''``'`'` '' ``'`'` '`''"㿈@ '''Y㿈` @'''Cߒ> L "x`> #@ `J `@'` ''''`  '`   '` ! '` ( '``: '?B؁&1P&1P&1d&1d&1d&1P&1d&1P&1P㿈`'`@''㿈`'`@''8` = \ `&@&`&`&` &` D&`6`n8`2   ' ' ' ' 7  D'U7 \㿘`> @> `#%cXD  @ `&@&`&`&` &`̔ (&`6`%ЁXD2   ' ' ' ' 7  ('̒ 7ʐɔ @㿈`?`  > "x*` €`   > `>  (#\#`@M`<  8 `&@&`&`&` &`Ԕ &`6`Đ؁`<2   ' ' ' ' 7  'Ԓ7Ґh 8㿘`> @> `!{b(㿈` ''@#\  Ž 㿈ߒ   ` '@#\ ū > "P'> ` %> ap  > `  > J ϖ > J(2  J J* ) * JJ#2 J J* :  cH* @ " > #P㿀> "'Z ` ”  " `7   " > #h㿀> "'_ `  2 `7   " > Ɛ#㿀> "'_ `q  2 `7n   " > ֞#p` ` `'''@''Ԙ'''] 㿘`  "` \8` 2  7#3 (`*`  ` @'* `@\'쀢`   `` 5 p`` ` ''@''Ԙ''''[a؁8` ܔ  (#$ (`*` M ŕ*  ` '@[5' 㿐@`(  *`  '#'@ * @` '#'` 㿀`    : :`?@?"@ "` 2` 2`  "`  "` "` "` $"` ("`  ,"`$ 0"`( 4"`, 8:`0 @:`8 H"`@ L"`D P"`H㾀@ D''''' v ఒ ˔| ڒ 2'ؠ(`6 `㾀@ ''''' uఒ |g  2'ؠ(` `Ȣ`@ 2 0%  $ 0 ` 0 ,?`$ 0, 0  2'ؠ(e`ߔ `㾘> "'l -␠@Ŕ  %y 2  F` ذ ␢`7{  ␠-` ` > ڐ# > 8" > ܐ "㿈` ''@#\   p` p  @?# @"?`"` + -0% -0"4`, -07!? -0 ``2`  ''''#\' ܘ : s` ` `` ?'#\  `  '#\ ܘ ; V` '#\ ܘ † J%> ( `> (!p P `P& > `$@m  `& $> ` $@b $ `$> $@a0V `$` `' ܀8'ܐ֔ ܀ ````̔?  &`` 㿘S @> ""ܰ 㿈F   ` '@#\  vm_map_lock_read: intrsafe mapirqfunctionsocketcontrollerdrivevectmuxconsoleoffsetslotluntargetphychannelleveladdrpppoetrunkvlantunslppploopgregifcarpbridgebpfiltersystraceksymsccdvndtbptyencsppppfsyncpflogpfPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sTarget %d Loop ID 0x%x (Port 0x%x) => Loop 0x%x (Port 0x%x)Target %d duplicates Target %d- killing off bothRetaining Loop ID 0x%x for Target %d (Port 0x%x)Retained login of Target %d (Loop ID 0x%x) Port 0x%xLogging out Target %d at Loop ID 0x%x (Port 0x%x)Command Error in PLOGI for Port 0x%x (0x%x)Could not get PDB for Device @ Port 0x%xPDB Loop ID info for Device @ Port 0x%x does not match up (0x%x)PDB Port info for Device @ Port 0x%x does not match up (0x%x)Target %d (Loop ID 0x%x) Port 0x%x dumped after login info mismatchNot RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %dHBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dLoop ID %d, AL_PA 0x%x, Port ID 0x%x, Loop State 0x%x, Topology '%s'Fabric Nameserver rejected %s (Reason=0x%x Expl=0x%x) for Port ID 0x%x(%d.%d.%d): FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%x%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%x%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedNVRAMbad underrun for %d.%d (count %d, resid %d, status %s)????21002200230023121240bus %d is in %s Mode128010801016012160LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode Capablechip reset timed outMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)F/W download failed at word %dRam Checksum Failureskipping f/w downloadBoard Type %s, Chip Revision 0x%x, %s F/W Revision %d.%d.%dloadedresidentFirmware Attributes = 0x%xInstalled in 64-Bit PCI slotLast F/W revision was %d.%d.%d%d max I/O commands supportedCannot setup DMAfailed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)Initiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%xbad frame length (%d) from NVRAM- using %dbad maximum allocation (%d)- using 16bad execution throttle of %d- using 16Setting ICB Node 0x%08x%08x Port 0x%08x%08xNot using any WWNsisp_fibre_init: fwopt 0x%x xfwopt 0x%x zfwopt 0x%xisp_fibre_initF Port (no FLOGI_ACC response)F PortN-Port to N-PortFL PortPrivate LoopFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08x2Gb link speed/sisp_fclink_testConfig WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating?????isp_pdb_syncgiving up on synchronizing the port databaseRemap Overflowisp_scan_loopNo LoopFailed to allocate IOCB bufferFailed to allocate XCB buffertimeout or transmit failedno fabric loopremote device not a target%xSNS Failed- %sisp_fabric_mbox_cmdGID_FTGPN_IDGNN_IDfabric too big for scratch areaisp_scan_fabricRegister FC4 types succeededisp_register_fc4_typeAdapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)Target %d does not have target serviceRequest Queue OverflowRequest Queue Overflow+out of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ldisp_startUnknown Control Opcode 0x%xdriver initiated bus reset of bus %dTarget %d on Bus %d Reset Succeededcannot find handle for command to abortMbox Command Async (0x%x) with no waitersinterrupt (ISR=%x SEMA=%x) when not readyoptr %x soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xQueue Entrycontinuation segmentinternal queues fullbad header flagbad request packetunknown flags (0x%x) in responsebad request handle %d (type 0x%x, flags 0x%x)cannot find handle 0x%x (type 0x%x)cannot find handle 0x%x (status 0x%x)asked for %ld got resid %ldRequest Queue Entry bounced backunhandled response queue type 0x%xisp_intrAsync Mbox 0x%xRequest Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xFast Posting CTIO doneLIP destroyed %d active commandsPoint-to-Point modePoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)Unknown Async Code 0x%xfast post completion of %uIgnored Continuation ResponseUnhandled Response Type 0x%xSelection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xDMA error for command on %d.%d.%dstates=>%s GOT_BUS%s GOT_TGT%s SENT_CDB%s XFRD_DATA%s GOT_STS%s GOT_SNS%s XFR_CMPLT%s status=>%s Disconnect%s Sync_xfr%s Parity%s Bus_Reset%s Device_Reset%s Aborted%s Timeout%s Negotiation%stransport error for %d.%d.%d: %sbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%dcommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freemarkednot markedInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dport unavailable for target %dport logout for target %dport changed for target %dport busy for target %dUnknown Completion Status 0x%xisp_parse_statusCommand for fast post handle 0x%x not found?????OOOO?GET NOST DATASET HOST DATAGET DATA OVERRUN RECOVERY MODESET DATA OVERRUN RECOVERY MODEGET TARGET MODE STATEENABLE TARGET MODEEXECUTE IOCB A64INITIALIZE RESPONSE QUEUE A64INITIALIZE REQUEST QUEUE A64DUMP RAM A64LOAD RAM A64GET FIRMWARE FEATURESSET FIRMWARE FEATURESSET SCAM CONFIGURATIONGET SCAM CONFIGURATIONGET SYSTEM PARAMETERSET SYSTEM PARAMETEREXEC BIOS IOCBWRITE FOUR RAM WORDSRETURN BIOS BLOCK ADDRSET RESET DELAY PARAMSSET DEV QUEUE PARAMSSET TARGET PARAMSSET PCI CONTROL PARAMSSET ASYNC DATA SETUP TIMESET ACT NEG STATESET CLOCK RATESET TAG AGE LIMITSET RETRY COUNTSET SELECT TIMEOUTSET INIT SCSI IDGET RESET DELAY PARAMSGET DEV QUEUE PARAMSGET TARGET PARAMSGET PCI PARAMSGET ASYNC DATA SETUP TIMEGET ACT NEG STATEGET CLOCK RATEGET TAG AGE LIMITGET RETRY COUNTGET SELECT TIMEOUTGET INIT SCSI IDGET FIRMWARE STATUSGET DEV QUEUE STATUSABORT QUEUESINGLE STEP QUEUESTART QUEUESTOP QUEUEBUS RESETABORT TARGETABORT DEVICEABORTSTOP FIRMWAREWAKE UPEXECUTE IOCBINIT RESULT QUEUEINIT REQUEST QUEUECHECK FIRMWAREABOUT FIRMWAREVERIFY CHECKSUMMAILBOX REG TESTREAD RAM WORDWRITE RAM WORDDUMP RAMEXEC FIRMWARELOAD RAMNO-OPO/!OO1OOLun RESETSEND LFAGet ID ListINITIALIZE IP MAILBOXSET VENDOR IDGET PORT/NODE NAME LISTLOGIN LOOP PORTINIT LIP LOGINFABRIC LOGOUTSEND CHANGE REQUESTFABRIC LOGINSEND SNSINIT LIP RESETGET LINK STATUSGET PORT NAMEGET FW STATEABORT TASK SETCLEAR TASK SETTARGET RESETCLEAR ACAGET PORT DATABASEGET FC-AL POSITION MAPINIT LIPINIT FIRMWAREGET/SET DATA RATEDRIVER HEARTBEATGET PORT DATABASE,, ENHANCEDREQUEST NON PARTICIPATING MODEGET RESOURCE COUNTSLOOP PORT ENABLELOOP PORT BYPASSSET PORT QUEUE PARAMSSET FIRMWARE OPTIONSGET PORT QUEUE PARAMSGET FIRMWARE OPTIONSGET LOOP IDREAD RAM WORD EXTENDEDUnknown Command 0x%xno parameters for 0x%xopcode %xINVALID COMMANDHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USETIMEOUTerror 0x%xMailbox Command '%s' failed (%s)isp_mboxcmdskipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xUsing Node WWN 0x%08x%08xUsing Port WWN 0x%08x%08xisp_reinit cannot reset cardisp_reinit cannot restart cardinvalid NVRAM header%x %x %xinvalid NVRAM checksumversion %d NVRAM not understoodisp_read_nvramNVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xNVRAM: maxfrmlen %d execthrottle %d fwoptions 0x%x loopid %xPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sispadded to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%dfinished command on borrowed timerestarting blocked queuewatchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no commandisp_wdogrestarted command for %d.%dblocked cmd again%s for %d.%dCMD_EAGAINCMD_RQLATERrequeued %d commands, 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing Enabled Bus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPTarget %d (Loop 0x%x) Port ID 0x%x role %s %s Port WWN 0x%08x%08x Node WWN 0x%08x%08xTarget/InitiatorInitiatorTargetNoArrivedDepartedName Server Database Changed N_Port NL_PortF/NL_Port Nx_Port F_port FL_Port E_port%s Fabric Device @ PortID 0x%xout of space for fabric devicesInternal Firmware Error on bus %d @ RISC Address 0x%x%s: espFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus [NCR_INIT(%d) %d] ncr53c9x_ecbregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_scsi_cmd] [0x%x, %d]->%d [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure%d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%lu sense=0x%02x error=%d ncr53c9x_dequeue: lun %qx for ecb %p does not existncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p[flushfifo] ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] [wrfifo(%d):%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %d ncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled &# &%&&$&& &'@@&&&(100-T4mii100-FX100-TXbncreservedauiutp#%$&'&(ep address %s , wrote %x to TX_AVAIL_THRESH, read back %x. Interface disabled warning: unknown chipset, possibly 3c515? /%s (default %s) (unknown/impossible media) default %s%s/autoselect%s: media_status on unknown chipset 0x%x epstart: no header mbuf%s: device timeout %s: eeprom failed to come ready %s: erase pencil mark, or disable PnP mode! wi&&&p&X&@&(&&&& & & &x &x &x&x&h&h&h&H&H&H&H&(&(&(&(&&&&&h&h &h!&"&#&$&%&&&'&PRISM3 (USB)PRISM3 ISL37300P(PCI)PRISM3 ISL37300PPRISM2.5 ISL3874A(PCI-bridge)PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 USBPRISM2.5 ISL3873PRISM2 HFA3842(EVAL)PRISM2 HWB3163(EVB2) SST-flashPRISM2 HWB3163 SST-flashPRISM1 HWB1153PRISM2 HFA3842(EVB3)PRISM2 HWB3163 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3763 rev.BPRISM2 HFA3841(EVB2)Lucent Embedded WaveLAN/IEEESony WaveLAN/IEEELucent WaveLAN/IEEE: unable to read station address address %sWaveLAN/IEEE nodeIBSS wi_attach%s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. %s: wi_cmd failed with %d %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wi_ioctl%s: tx buffer allocation failed %s: mgmt. buffer allocation failed w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-wi_do_hostencrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x wi_do_hostdecrypt%s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), Symbol %s: %u (%d dBm) put_rateswihap_init: sc=0x%x whi=0x%x Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: sc=0x%x whi=0x%x wihap_shutdown: FREE(sta=0x%x) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x wihap_assoc_reqwihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook%s: controller failed to initialize %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: device timeout missing buffer, no_td = %d, last_td = %d ne: where did the card go? : setup failed ne2000_attachne2000_detectne2000_write_mbuf: negative lenne2000_write_mbuf: data != lim%s: remote transmit DMA failed to complete x܈@x܈@ xވvm_map_lock_read: intrsafe mapcomcomprmcomstart%s: %d silo overflow%s, %d ibuf overflow%s s: unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: probed fifo depth: %d bytes /dev/ksyms: Symbol table not valid. ELFfailed to allocate memory for /dev/ksyms pf_find_state_recursepf_find_state_allpf_src_connlimit: blocking address , %u states killed pf_src_connlimitpf: src_tree insert failed: pf_insert_src_nodepf: state insert failed: tree_lan_ext lan: gwy: ext: (from sync)pf: state insert failed: tree_ext_gwypf: state insert failed: id: %016llx creatorid: %08xpftmdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/pf.cstate->timeout != PFTM_UNLINKEDstate->timeout < PFTM_MAXcur->timeout == PFTM_UNLINKED%u.%u.%u.%u:%u:%x[%u]TCP UDP ICMP ICMPV6 %u [lo=%u high=%u win=%u modulator=%u wscale=%u] %u:%uFSRPAUEWinvalid address type: %d pf_change_appf_change_a6pf_change_icmppf_modulate_sackpf_send_tcppf_step_into_anchor: stack overflow pf_map_addr: src tracking maps to pf_map_addr: selected address pf_map_addrpf_get_sportpf: NAT proxy port allocation (%u-%u) failed pf_get_wscalepf_get_msspf_calc_msspf_normalize_tcp_stateful failed on first pktpf: loose state match: seq=%u ack=%u len=%u ackskew=%d pkts=%llu:%llu pf: BAD state: seq=%u ack=%u len=%u ackskew=%d pkts=%llu:%llu dir=%s,%s inoutfwdrevpf: State failure on: %c %c %c %c | %c %c pf_test_state_tcppf_test_state_udppf: ICMP error message too short (ip) pf: ICMP error message too short (ip6) pf: ICMPv6 short opt pf: ICMP error message too short (tcp) pf: BAD ICMP %d:%d -> state: seq=%u pf: ICMP error message too short (udp) pf: ICMP error message too short i(icmp) pf: ICMP error message too short (icmp6) pf_test_state_icmppf_test_state_otherpf_routablepf_rtlabel_matchpf_route: invalid parameterspf_route: m0->m_len < sizeof(struct ip) pf_route: TAILQ_EMPTY(&r->rpool.list) pf_routepf_route6: invalid parameterspf_route6: m0->m_len < sizeof(struct ip6_hdr) pf_route6: TAILQ_EMPTY(&r->rpool.list) pf_route6pf_test: pf_get_mtag returned NULL pf_test: kif == NULL, if_xname %s non-M_PKTHDR is passed to pf_testpf: dropping packet with ip options pf_testpf_test6: pf_get_mtag returned NULL pf_test6: kif == NULL, if_xname %s non-M_PKTHDR is passed to pf_test6pf: IPv6 short opt pf_test6pffrentpffragpffrcachepffrcentpfstscrdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/pf_norm.cBUFFER_FRAGMENTS(frag)%s: pf_purge_expired_fragmentsexpiring %d(%p) !BUFFER_FRAGMENTS(frag)TAILQ_EMPTY(&pf_cachequeue) || TAILQ_LAST(&pf_cachequeue, pf_cachequeue) != fragpf_flush_fragmentstrying to free > %d frents trying to free > %d cache entries LIST_EMPTY(&frag->fr_cache) || LIST_FIRST(&frag->fr_cache)->fr_off > frcache->fr_end*frag == NULL || BUFFER_FRAGMENTS(*frag)frep != NULL || frea != NULLpf_reassembleoverlap -%d adjust overlap %d missing fragment at %d, next %d, max %d %d < %d? frent != NULLdrop: too big: %d complete: %p(%d) *frag == NULL || !BUFFER_FRAGMENTS(*frag)pf_fragcachefragcache[%d]: new %d-%d frp != NULL || fra != NULLfragcache[%d]: dead (%d-%d) %d-%d fragcache[%d]: adjacent (%d-%d) %d-%d fragcache[%d]: chop %d (%d-%d) %d-%d (*m0)->m_next == NULL(int)m->m_len == ntohs(h->ip_len) - precutfragcache[%d]: gap %d (%d-%d) %d-%d fragcache[%d]: adjacent %d-%d (%d-%d) fragcache[%d]: chop %d %d-%d (%d-%d) (int)m->m_len == ntohs(h->ip_len) - aftercutfragcache[%d]: gap %d %d-%d (%d-%d) fragcache[%d]: adjacent(merge %d-%d) %d-%d (%d-%d) cur == NULLfragcache[%d]: done 0-%d fragcache[%d]: dropping overall fragment pf_normalize_ipIP_DF mff and %d max packet %d reass frag %d @ %d-%d dropping bad fragment src->scrub == NULLpf_normalize_tcp_initsrc->scrub || dst->scrubpf_normalize_tcp_statefulmultiple TS?? src idled out of PAWS dst idled out of PAWS Timestamp failed %c%c%c%c tsval: %lu tsecr: %lu +ticks: %lu idle: %lus %lums src->tsval: %lu tsecr: %lu dst->tsval: %lu tsecr: %lu tsval0: %lu Did not receive expected RFC1323 timestamp Broken RFC1323 stack did not timestamp data packet. Disabled PAWS security. pf_normalize_tcp_statefulpfruleplpfsrctrplpfstateplpfaltqplpfpooladdrplpfpurgepfpurge thread/pf_find_or_create_ruleset: RB_INSERT1 '%s' '%s' collides with '%s' '%s' pf_find_or_create_ruleset: RB_INSERT2 '%s' '%s' collides with '%s' '%s' pf_anchor_setup: .. beyond root /*pf_anchor_setup: ruleset ../pf_anchor_copyout: '%s' '%s' *pf_anchor_remove: broken refcount ?pf_setup_pfsync_matchingpf: started pf: stopped altq: started altq: stopped pfioctlpfrktablepfrkentrypfrkentry2pfr_clr_addrs: corruption detected (%d). pfr_add_addrspfr_del_addrspfr_set_addrspfr_tst_addrspfr_get_addrs: corruption detected (%d). pfr_get_astats: corruption detected (%d). pfr_clr_astatspfr_enqueue_addrs: IPv4 walktree failed. pfr_enqueue_addrs: IPv6 walktree failed. pfr_mark_addrs: IPv4 walktree failed. pfr_mark_addrs: IPv6 walktree failed. pfr_lookup_addrpfr_insert_kentries: cannot route entry (code=%d). pfr_reset_feedbackpfr_route_kentrypfr_unroute_kentry: delete failed. pfr_unroute_kentrypfr_walktree_pfpfr_add_tablespfr_del_tablespfr_get_tables: corruption detected (%d). pfr_get_tstats: corruption detected (%d). pfr_clr_tstatspfr_set_tflagspfr_ina_definepfr_commit_ktablepfr_update_stats: assertion failed. pfr_attach_tablepfr_detach_table: refcount = %d. pfr_pool_getpf_osfp_fingerprintfingerprinted %s:%d %d:%d:%d:%d:%llx (%d) (TS=%s,M=%s%d,W=%s%d) 0*%osfp no match against %x osfp matched %s %s %s %x==%x fingerprint 0x%x didn't match pfosfpenpfosfpadding osfp %s %s %s = %s%d:%d:%d:%s%d:0x%llx %d (TS=%s,M=%s%d,W=%s%d) %x TSFound "%s %s %s" instead of "%s %s %s" Couldn't find "%s %s %s" pfiaddrplallpfi_kif_get for pfi_all failedpfi_kif_getpfi_kif_ref with unknown typepfi_kif_unref: rules refcount <= 0 pfi_kif_unref: state refcount <= 0 pfi_kif_unref with unknown typepfi_kif_get failedpfi_attach_ifnet: cannot allocate '%s' address hookself:network:broadcast:peer:0/%d_pfpfi_dynaddr_setuppfi_dynaddr_updatepfi_table_update: cannot set %d new addresses into table %s: %d pfi_address_add: address buffer full (%d/%d) pfi_address_add: no memory to grow buffer (%d/%d) pfi_fill_oldstatuspflog%dpflog_packetpfsync0pfsync_insert_net_state: invalid creator id: %08x pfsync_insert_net_state: unknown interface: %s pfsync_insert: PFSYNC_ACT_INS: invalid value pfsync_insert: PFSYNC_ACT_UPD: invalid value pfsync: %s stale update (%d) id: %016llx creatorid: %08x ignoringpartialpfsync_insert: PFSYNC_ACT_UPD_C: invalid value pfsync: ignoring stale update (%d) id: %016llx creatorid: %08x pfsync: received bulk update request pfsync: received bulk update start pfsync: received valid bulk update end pfsync: received invalid bulk update end: bad timestamp pfsync_inputpfsync: requesting bulk update pfsyncioctlpfsync: bulk update complete pfsync: cannot allocate mbufs for bulk update pfsync: failed to receive bulk update status pfsync_sendout_mbufpfsync_insert: PFSYNC_ACT_TDB_UPD: invalid value pppoepppoe%dpppoe: alien host unique tag, no session found %s: host unique tag found, but it belongs to a connection in state %d %s: wrong interface, not accepting host unique pppoeintrpppoe: packet too short: %d pppoe: could not get PPPoE header pppoe: unknown version/type packet: 0x%x pppoe: packet content does not fit: data available = %d, packet size = %u %s: parse error pppoe: tag 0x%x len 0x%x is too long TAG HUNIQUE ERRORTAG ACCOOKIE ERRORSERVICE NAME ERRORAC SYSTEM ERRORGENERIC ERROR%s: %s: %*s pppoe*pppoe: received PADO but could not find request for it %s: received unexpected PADO %s: failed to send PADR, error=%d %s: session 0x%x connected %s: session 0x%x terminated, received PADT %s: unknown code (0x%04x) session = 0x%04x diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/if_pppoe.cm->m_flags & M_PKTHDRpppoe (data): dropping too short packet: %d bytes pppoe (data): could not get PPPoE header pppoe (data): unknown version/type packet: 0x%x %s (%x) state=%d, session=0x%x output -> %s, len=%d pppoe_outputpppoe_send_padi in state %d%s: timeout %s: failed to transmit PADI, error=%d %s: failed to send PADI, error=%d %s: disconnecting %s: could not establish connection pppoe_send_padtaltq assertion "%s" failed: file "%s", line %d altq assertiontbr_set: no cpu clock available! altq_add: no cpu clockinit_machclkread_machclkinvalid weight value %d for red! use %d wtab_alloc: malloc failed!cbq_add_queue: no parent class! cbq_add_class: borrow class != parent altq: packet for %s does not have pkthdr rmc_init: root class not allocated _rmc_wrr_dequeue_next_rmc_prr_dequeue_nextrmc_root_overlimitaltq: packet for %s does not have pkthdr hfsc_dequeue:altq: packet for %s does not have pkthdr All breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d * %-12s? No such command Ambiguous Bad modifier Count missing db_commandMalloc debugging not enabled. %s the kernel did not panic calloutprocswatchesuvmexpregistersprocpoolpanicpageobjectmapmallocextentsbreaksallpoweroffreboothaltdumpcrashsyncdmesghangmanhelpbootshowpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintmachine ddb> %sBad function Too many arguments Argument missing %#n ELF[ %s symbol table has bad start address %p ] ELFbad magicbad e_machine.strtab.symtabsymtab unalignedsymtab corrupted[ using %lu bytes of %s ELF symbol table ] [ %s ELF symbol table not valid: %s ] : = 0x%lx %-*lr%-*lx%-*lz%-*ld%-*lu%-*lo%c\%03o%*r%*x%*z%*d%*u%*o Bad modifier bhlAddress missing Value missing Count missing Symbol not found Syntax error Divide by 0 Negative shift amount ^R Bad character in number Bad escape String too long Bad character --db_more--  -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*luFaulted in traceback, aborting... Starting stack trace... End of stack trace. %-12s%#*ln %s+%#lr [after %6d] bsd[ %s symbol table has bad start address %p ] [ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s%s %s Sifting table %s: %s+%s [%s:%d]db_printsymAfter %d instructions (%d loads, %d stores), Breakpoint at Watchpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! linestabstopsmaxwidthmaxoffradixUnknown variable No value ? All watchpoints used. No map. Already set. Too many watchpoints. Not set. No watchpoints set Map Address Size %s%p %8lx %lx * Unknown size %#8n = %#8n Nothing written. 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| () Score: %lu/%lu db_hangmanvm_map_lock_read: intrsafe mapcdlinemicheadphonesspeakeraudio audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer recordmonitorsourceoutputmasteraudioattachauddetaudiodetach: %s didn't detach au_portofaudio_attach_mi: NULL oplmpuaudioprint: unknown type %d%s at %saudio_open: 0 precision audio_drain: copying in progress!?! aud_draud_hraud_rdaudio_silence_copyoutaud_wraudio_write: cc == 0, swcode=%p, factor=%d au_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfovm_map_lock_read: intrsafe mapccdattach: count <= 0WARNING: no memory for concatenated disks ccdbufplccd%dccdinit: device name too long. ccdinitccdbufferccdintrccdiodone (mirror)%s: error %d on component %d%s ccdiodone: countccdioctlccdfictitiousdefault labelccdlckvm_map_lock_read: intrsafe mapcnopen: recursiveMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUTncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finishncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad statencr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... , address %s %s: device timeout dp8390_initdp8390_xmit: desync, next_tx=%d inuse=%d cnt=%d new=%ddp8390_xmit: no packets to xmitdp8390_start: no header mbuf%s: length does not match next packet pointer %s: len %04x nlen %04x start %02x first %02x curr %02x next %02x stop %02x %s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed  "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80(   !"#$%&'()*+,-./02468:<>AEIMS[gjkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗vm_map_lock_read: intrsafe mapsystrrd%s: attach to %u: %d systracef_ioctlstrprocplstrpolplsystracesystrace_forkdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/systrace.cstrp->proc == p%s: %u: policy %d systrace_answer%s: new, ents %d systrace_policy%s: %d -> pid %d %s: %d: code %d -> policy %d %s: %d systrace_getcwd%s: %u: %p(%lu) systrace_io%s: Trying to detach from %d systrace_detach%s: allocating %d -> %lu systrace_newpolicysystrmsg%s: %p: pid %d -> pid %d systrace_msg_child%s: free %d systrace_msg_policyfreevm_map_lock_read: intrsafe mapvndencryptWARNING: no memory for vnode disks vndbufplvnd devicefictitiousvndiodonevnd%dVNDIOCSET: device name too long vndioctlvndioctl: null vpvndlckvm_map_lock_read: intrsafe maparc4_stirarc4maybeinit: premature;n vAMaX ֣d° xextract_entropyrndrdvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapcd9660_inactive: pushing activecd9660_reclaim: pushing activevm_map_lock_read: intrsafe mapRRIP without PX field? ..RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_1282IEEE_P1282RRIP_1991ASPvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapp<D d ;cd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] vm_map_lock_read: intrsafe map..cd9660_strategy: spectag VT_ISOFS, isofs vnode vm_map_lock_read: intrsafe mapudf_disklabelspoofvm_map_lock_read: intrsafe mapߜߤ PԄltudftrpludfndpludfdspludf_mount: enforcing read-only mode udfCan't read sector %d of VDS FSD does not lie within the partition! Cannot read sector %d of FSD Couldn't find the fsd Cannot read sector %d Invalid root file entry! Invalid file entry! Cannot allocate file entry block Error from udf_allocv unodeInvalid partition map found *UDF Sparable PartitionUnsupported partition map: %s Failed to read Sparing Table at sector %d Invalid sparing table found udf_find_partmapsvm_map_lock_read: intrsafe maphash entry is NULL, node->hash_id= %dudf_allocv: failed to allocate new vnode udf_transname(): name too long udf_transname(): Unicode translation failed udf: invalid FID fragment udf: invalid FID Invalid FID tag uiomove returned %d udf_readdirtag VT_UDF, hash id %u udf_lookup: Invalid tag warning: udf_readlblks returned error %d Cannot deal with strategy4096 yet! Unknown strategy type %d File offset out of bounds Unsupported allocation descriptor %d vm_map_lock_read: intrsafe mapexec: a VTEXT vnode has writecount != 0vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapelf32_load_fileexec: a VTEXT vnode has writecount != 0OpenBSDvm_map_lock_read: intrsafe map#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dvm_map_lock_read: intrsafe mapvmcmdset_extend: not necessarydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/exec_subr.cocnt > 0exec_process_vmcmds: RELATIVE no basevm_map_lock_read: intrsafe mapCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2006 OpenBSD. All rights reserved. http://www.OpenBSD.org %s swapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedcryptocrypto thread/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initvm_map_lock_read: intrsafe mapacct_processacctAccounting resumed Accounting suspended acct_threadvm_map_lock_read: intrsafe mapfileplfdescplfd_unused: fd_lastfile inconsistentdup2: fdallocfileclosef: count < 0closefclosef: count: %d/%dkqeueplknoteplkqreaddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0kn->kn_status & KN_QUEUEDvm_map_lock_read: intrsafe mapexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != ikernel mapping failed %d user mapping failed vm_map_lock_read: intrsafe mapinit died (signal %d, exit %d)reaperwaitvm_map_lock_read: intrsafe mapprocppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qvm_map_lock_read: intrsafe mapktrsyscallktrsysretktrnameiktremulktrgenioktrpsigktrcswktrace write failed, errno %d, tracing stopped lockmgr: sleep/spin mismatchlockmgr: process context requiredlockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your minddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_lock.c( lkp->lk_flags & (0x00004000 | 0x00002000 | 0x00001000)) == 0lockmgr: not holding exclusive locklockmgr: upgrade exclusive lock( lkp->lk_sharecount) == 0lockmgr: non-zero exclusive countlockmgr: locking against myself( lkp->lk_flags & (0x00004000 | 0x00002000)) == 0( lkp->lk_sharecount != 0 || (lkp->lk_flags & 0x00001000)) == 0lockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: release of unlocked lock!lockmgr: draining against myself( ((lkp->lk_flags & (0x00004000 | 0x00002000 | 0x00001000)) || lkp->lk_sharecount != 0 || lkp->lk_waitcount != 0)) == 0lockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by processor %lupid %d not locked with %d pendingvm_map_lock_read: intrsafe maplkmopnlkmlookupDDB symbols added: %ld bytes UDF file idUDF file entryUDF mountbwmeterbluetoothkqueueNTFS vrunNTFS decompNTFS resident data NTFS file attrNTFS hash tablesNTFS dirNTFS fnodeNTFS nodeNTFS mounttemprp_addrip6rrNDPip6_optionsemuldata1394data1394ctlpacket tagsIPsec credscrypto datamemdescUSB HCUSB deviceUSBUVM aobjUVM amapRAIDframe dataVM swapindirdepnewblkinodedeppagedepxform_datatdbpfkey dataadosfs bitmapadosfs anodeadosfs mountmiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostMFS nodeVFS clustersubprocprocfile descfileVM pmapdirhashsemVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqmountiovioctlopssysctlsooptsifaddrfragtblroutetblpcbdebugdevbufmbuffree??malloc - bogus typemalloc: allocation too largemalloc: out of space in kmem_map???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost datafree: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple freeskmeminit: minbucket too small/struct freelist too big%d,%s, $ rw_enter: locking against myselfrw_enter: upgraded lock write lockedrw_enter: not holderrw_enter: unknown op 0x%xrw_exit: no waiterrwlockphysbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenputphysbuf: private buf B_WANTEDprocinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curproc'P'H'@'8'0'(' onprocdeadzombiestopsleeprunidle%dPROC (%s) pid=%d stat=%s flags=%b ADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCFSTRACESSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCK pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-9s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-9.9s %-16s %-16s %-8s %18p %s plimitplsensorssensors kthreadtimeoutvm_map_lock_read: intrsafe mapsigaplpausepsignal signal numberProcess (pid %d) got signal %d issignal postsigpostsig actionpid %d was killed: %s sorry, pid %d was killed: %s %s.corecoredumpuiomove: modeuiomove: procureadc: zero residureadc: non-positive iovcnthashinit: bad cnthook_disestablish: hook not establishedpowerhook_disestablish: hook not establishedvm_map_lock_read: intrsafe mapsysctlsysctl_disklocksysctl_kmemlockkern_sysctl%s,tsleep: no identtsleep: not SONPROCtsleep: p_back not NULLltsleepwakeup: p_back not NULLwakeup: p_stat is %dvm_map_lock_read: intrsafe mapdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeptimeout_add: not initializedtimeout_add: to_ticks (%d) < 0?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %sdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/sched_bsd.cphzupdatepripreempt: cpu_preempt not yet implementedmi_switchsetrunnableresetpriority>>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe unsupported not configured root device %s not configured %s (root)%s at %sconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %sconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureconfig_pending_decr: config_pending == 0config_activate_children: shouldn't get hereevcnt_attach%s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs dk_mountrootbufq_default_alloc: no memoryintrextent_register: already registeredextentplextent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%lxextent_create: storage provided for non-fixedextent_destroy: NULL extentextent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extntextent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignmentextent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not foundextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx vm_map_lock_read: intrsafe mapklogmtx_enter: ipl not implementedmutex %p held in %smtx_entermutex %p not held in %smtx_leavevm_map_lock_read: intrsafe mappr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentpool_init: pool item size (%lu) too largepool_init: too much uptimediagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/subr_pool.cpp->pr_itemsperpage != 0phpoolpcgpoolpool_destroy: pool busy: still out: %uLIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)pool_set_drain_hook(%s): already setpool_getpool_get: %s:must have NOWAITpool_get: %s: crossed hard limit%s pool_get: %s: curpage NULL, nitems %u pool_get: nitems inconsistentpool_get: %s: page emptypool_get: %s: items on itemlist, nitems %u pool_get(%s): free list modified: magic=%x; page %p; item addr %ppool_get: nidle inconsistentpool_get: %s: nmissing inconsistentpool %s: putting with none out pool_putpool_put: %s: page header missingpool_prime_page: %s: unaligned page((((vaddr_t)pi) + ioff) & (align - 1)) == 0ph->ph_nmissing == 0pool %s is locked; try again later page %p, nmissing %d, time %lu,%lu item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p no log cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: magic=%x; page %p; item ordinal %d; addr %p (p %p) poolpool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pcg->pcg_avail <= PCG_NOBJECTSpcg->pcg_avail != 0pcg->pcg_objects[idx] != NULLpcg->pcg_avail < PCG_NOBJECTSpcg->pcg_objects[idx] == NULLpool_page_alloc_oldnointrpool_page_free_oldnointrvm_map_lock_read: intrsafe mapkernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %s%dlogpri%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad basekprintf?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisableDddbcchangebbaseaadd--- more --- %d%d0%o0x%x%s*FOUND***UNKNOWN*%3d free slot (for add) %3d %s count %d (pseudo device) Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x %s [] ? Unknown argument change (y/n) ? out of memory. flags changed %3d can't change free slot count%3d %s changed Error unknown state already disabled %3d can't disable free slot %3d %s can't disable pseudo device enabled %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know%s Unknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command User Kernel Config UKC> Continuing... sys_ioctlselectpollpipelkpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrpipeclpipepldiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/sys_process.c(p->p_flag & P_SYSTEM) == 0ptrace: impossiblevm_map_lock_read: intrsafe mapmsginfo.msgssz %d not a small power of 2msginfo.msgseg %d > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULLmsghdr->msg_spot out of rangemsghdr->msg_spot != -1sys_msgctl: msg_cbytes is screwed upsys_msgctl: msg_qnum is screwed upmsgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segmentsmsg_first/last screwed up #1msg_first/last screwed up #2msg_first/last screwed up #3next too low #3next out of range #3semaplsemuplsemwaitsemop - can't undo undossemexit - semid not allocatedsemexit - semnum out of rangeshmseg free count inconsistentshmplvm_map_lock_read: intrsafe map@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ /dev/consolettnreadttrstrtttypendttyunblockttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunnablerunning%ld.%02ldu %ld.%02lds %d%% %ldk ttyfree: tty_count < 0vm_map_lock_read: intrsafe map/dev/XtyXXpqrstuvwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZptydevnameptyptcreadptcwriteptmattach: Can't find pty slave in cdevswputc: required clalloc b_to_q: required clalloc  ('8x'8p ('8h'8`'8X'8P T !'8H'8@ @ '8h'88'8X'8P X'8h'88'8X'8P @ '80'8( X'80'8(PTCLPTRTCN46vm_map_lock_read: intrsafe mapWARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0 overrunm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_zero: M_READONLYm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm == NULL in m_pulldown()unixsockplsofreesoclose: NOFDREFsoabortsoaccept: !NOFDREFreceive 1diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1aso->so_rcv.sb_mb == mreceive 3netconnetclsnetionetlcksonewconnsoqinsquediagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/uipc_socket2.csb->sb_mb == sb->sb_lastrecordsbappendaddrsbappendcontrolsemi-panic: sbcompress(sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsbdropsbcreatecontrol: message too large %d acceptvm_map_lock_read: intrsafe mapuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectvm_map_lock_read: intrsafe mapbremfree: lost tailbufplbuf_dirtybuf_undirtygetblkallocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsizegetnewbufDirty buffer on BQ_CLEANBQ_CLEAN has buffer with dependenciescleanerClean buffer on BQ_DIRTYbiowaitbiodonebiodone alreadyvm_map_lock_read: intrsafe mapcache_revlookup: found entry for .cache_revlookup: found entry for ..nchplvm_map_lock_read: intrsafe mapcluster_read: size = 0cluster_read: DONE bpcluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memorycluster_callbackcluster_callback: too little memorycluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvop_generic_revokevop_generic_revokeallvm_map_lock_read: intrsafe mapoperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameivm_map_lock_read: intrsafe maplockfpllf_findoverlap: defaultvm_map_lock_read: intrsafe mapnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsleaf should be emptyrelookup: null namerelookup: lookup on dot-dotrelookup: symlink found.vm_map_lock_read: intrsafe mapvnodesvfslock%s_mountroot failed: %d vnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svgetvref used where vget requiredUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vrele: cannot lockvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevmissing aliasvgonel: not cleanVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %u, writecount %u, holdcount %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBIOWAIT|VBIOONFREELIST|VBIOONSYNCLIST|VALIASED flags (%s) vprintkinfo: vp changed unmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done softdep %d vwaitforiovwakeupvwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufvflushbuf: dirtybgetvpbgetvp: not freebrelvpbrelvp: NULLbrelvp: holdcntbuf_replacevnodereassignbufvfs_register called with vfc_refcount > 0 vm_map_lock_read: intrsafe mapfsync failedmounted on: %s sched_sync: fsync failedsyncersyncer vnode vm_map_lock_read: intrsafe mapvfslocksys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvm_map_lock_read: intrsafe mapvn_lockvm_map_lock_read: intrsafe mapdefaultvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritevm_map_lock_read: intrsafe mapdead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockvm_map_lock_read: intrsafe mapfiforfifowfifo_read modefifo_write modetag VT_NON , fifo with %ld readers and %ld writersfifo_badop calledvm_map_lock_read: intrsafe map  8 @ ; 4 ; ; ; ; ; ; ;vm_map_lock_read: intrsafe mapportal_closefd: error = %d portalconportal_open: %d extra fds tag VT_PORTAL, portal vnode portal: bad opvm_map_lock_read: intrsafe map(%s)vm_map_lock_read: intrsafe map'O'O'O'O'Owaitrunstepdetachattach'R'Q'Q'Q'Q'Q'Q'Q'Q'Q 'Q 'Q 'Q 'Q 'Q'Q'Q'Qx'Qp'Qh'Q`'QX'QP'QH'Q@'Q8'Q0'Q('Q 'Q'Q'Qusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfsprocfs_controlprocfs_doctlvm_map_lock_read: intrsafe map total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8lu Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB procfs_domeminfoprocfs_docpuinfovm_map_lock_read: intrsafe mapprocfs_donotevm_map_lock_read: intrsafe map %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld -1,-1 %ld,%ld %ld,%ld %snochan %u, %u,%u procfs_stat_genvm_map_lock_read: intrsafe mapprocfslprocfs_allocvpvm_map_lock_read: intrsafe mapprocfs: invalid directory entry sizeprocfs  ؄ ; ; ; ; ; @ ; ;vm_map_lock_read: intrsafe mapexecmdlinenotepgnotestatusctlmemfile...cpuinfomeminfotag VT_PROCFS, type %d, pid %d, mode %x, flags %lx %ldprocfs_getattrprocfs_getattrcurprocselfprocfs_readdirprocfs_readlinkvm_map_lock_read: intrsafe mapspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledvm_map_lock_read: intrsafe mapdos2unixtime(): month value out of range (%ld) !#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~vm_map_lock_read: intrsafe mapdenodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activevm_map_lock_read: intrsafe mapfatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmapvm_map_lock_read: intrsafe mapmsdosfs_lookup. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? vm_map_lock_read: intrsafe mapRRaArrAaUmsdosfs_sync: rofs mod AL NH NP N ; O0 P` ; Q QT  ; Qxvm_map_lock_read: intrsafe mapmsdosfs_create: no namemsdosfs_createmsdosfs_write(): bad file typemsdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_renamemsdosfs_mkdir: no namemsdosfs_mkdir...msdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %d, %d, %s (LOCKED)vm_map_lock_read: intrsafe mapbpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfwritebpf_mcopybpfattachtoo many interfacesallif_attachhead: mallocif_attach: mallocif_clone_listif_downif_upifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d d;n &0vAkkQMaXPq< D֣ad°Ԡ x      ;n C&vkkMGP&"/+Ka5 d1͆< 8O!'bXd (!#%&&<&llcp!'b((()h))-.0@0H0P0`0ipcp#'bSSA AAC CSSD pap#'c SS889:;SS;chap%s: input packet is too small, %d bytes %s: PPP packet in Cisco mode %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow %s: no memory for transmit header %s: cisco invalid packet length: %d bytes %s: cisco input: %d bytes <0x%x 0x%x 0x%x 0x%x 0x%x-0x%x> %s: cisco unknown packet type: 0x%x %s: loopback %s: up %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: %s output <%s id=0x%x len=%d> %s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: %s: ignoring RXJ (%s) for proto 0x%x, danger will robinson %s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x %s: %s up(%s) %s: %s down(%s) %s: %s open(%s) %s: %s close(%s) %s: %s TO(%s) rst_counter = %d %s: %s %s->%s %s: Up event(incoming call) %s: Down event (carrier loss), taking interface down.%s: Down event (carrier loss) %s: lcp parse opts: %s [invalid] [invalid chap len] [not configured] [rej] send conf-rej %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] max_failure (%d) exceeded, send conf-rej send conf-nak send conf-ack %s: lcp rej opts: [don't insist on auth for callout][access denied] %s: lcp nak opts: magic glitch %d sppp_lcp_scr%s: ipcp_open(): no IP interface %s: ipcp parse opts: %s: ipcp parse opt values: %s %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-ack %s: ipcp rej opts: %s: ipcp nak opts: [wantaddr %s] [agree] sppp_ipcp_scr%s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success: %s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d Failed...Welcome!%s: chap unknown input(%s) <0x%x id=0x%xh len=%dsppp_chap_input%s: chap TO(%s) rst_counter = %d %s: chap %s, reconfirmedtlunext re-challenge in %d seconds re-challenging supressed %s: chap tld %s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d%s: pap TO(%s) rst_counter = %d %s: pap peer TO %s: pap tld %s: LCP keepalive timeoutsppp_paramsconf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-req0x%xchallengeresponsesuccessfailurereqacknakmruasync-mapauth-protoqual-protomagicproto-compaddr-compaddressescompressionaddressinitialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentopenedillegaldeadestablishterminateauthenticatenetwork %02x-%02x\x%x%c%d.%d.%d.%d%s: phase %s lolo%dlooutput: no header mbuf%s: can't handle af%d lo_altqstart: can't handle af%d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedifmedia_match: multiple match for 0x%x/0x%x, selected instance %d sl%s%dsl%d: can't allocate buffer %s: af%d not supported slstartslinputppp%s%dpppdealloc%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x pppioctl%s: af%d not supported %s output: ppp_requeuepppintrif_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) %s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full %s pppdumpmvm_map_lock_read: intrsafe mappppwritepppasyncstart%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! %s input: %s pppdumpbbsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary z_compress: deflate returned %d (%s) z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) z_incomp%d: inflateIncomp returned %d (%s)       ,bH'yP,f'y'z<unknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data check??invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat #+3;CScs !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pbuffer errorinsufficient memorydata errorstream errorfile errorstream endvm_map_lock_read: intrsafe maptun%s%dtunopentunreadbridge%s%dbridge_ioctlbridge_bifconfbridge_brlconfbridge_input(): no HDRbridge_broadcastbridge_rtfindbridge_ipsecbstp_ifupdstatusvlanvlanattach: hashinit%s%d%s: initialized with non-standard mtu %lu (parent %s) %svlan_ioctlvlan_ether_purgemultirn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplrtfreertfree 2rtfree: %p not freed (neg refs) ifafreertredirectrtflushclone: called with a non-cloning routertflushclone: no rnh_walktreertrequest deletertinit: wrong ifa (%p) was (%p) diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/route.crt_init_done == 0rttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputroute_outputrt_msg1routesl_compress_tcpenc%dgre%s%dgre_ioctltrunk`%s%d%s: capabilities 0x%08x trunk_port_lladdr%s: using proto %u trunk_ioctl%s: failed to remove multicast address on all ports trunk_ether_purgemulti%s: ioctl %lu failed on %s: %d trunk_ether_cmdmulti%s trunk_media_changearp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arpintrarp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s in_arpinputarptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][%d,] ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) in_controlin_controlinvalid argument to in_lifaddr_ioctlin_lifaddr_ioctlin_ifinitin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectin_pcbnotifyallin_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d in6_pcbhashlookup: faddr= fport=%d laddr= lport=%d in_pcblookup_listen: laddr=%08x lport=%d in6_pcblookup_listen: laddr= lport=%d interneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeout: bad route to timeouticmp_mtudisc_timeouticmp_redirect_timeout: bad route to timeout %d.%d.%d.%dipqeplip_initaeshmac-sha1deflateipintr no HDRsave_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %x %x forward: src %x dst %x ttl %x redirect (%d) to %x ip_mrouter_init: so_type = %d, pr_protocol = %d ip_mrouter_init ip_mrouter_done Source routed tunnels not supported. mdecap%dadd_vif #%d, lcladdr %x, %s %x, thresh %x, rate %d rmtaddrmaskadd_vifreset_vifdel_vif %d, numvifs %d add_mfc update o %x g %x p %x add_mfc %s o %x g %x p %x dbx %p multiple kernel entriesadd_mfc o %x g %x p %x dbg %p add_mfc no upcall o %x g %x p %x add_mfcdel_mfc origin %x mcastgrp %x del_mfcip_mforward: src %x, dst %x, ifp %p ip_mforward: received source-routed packet from %x ip_mforward: no rte s %x g %x ip_mforward: ip_mrouter socket queue full expire_upcalls: expiring (%x %x) wrong if: ifp %p vifi %d vififp %p ip_mforward: no tunnel with %x phyint_send on vif %ld err %d port %x prio %d bw_upcalls_send: cannot allocate mbuf bw_upcalls_send: ip_mrouter socket queue full bw_upcalls_sendunschedule_bw_meter: bw_meter entry not foundip_output: IPv6 pcb is passedip_output no HDRip_output: tag of length %d (should be %dip_outputmalformed IPv4 option passed to ip_optcopyip_setmoptionsrip_attachrip_detachrip_usrreqm_pulldown malfunctiontcp_input: TCPS_LISTENtcp_inputtcp_dooptionstcp_sack_optiontcp_pulloutofbandsynplsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossibleinvalid sc_tp in syn_cache_cleanupsyn_cache_respondtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_outputtcp_output REXMTtcpcbpltcpqeplsackhlpltcp_inittcp_respondassumption failed in tcp6_ctlinputtcp_ctlinputtcp6_mtudisc_callbacktcp_signature:>?Atcp_timer_rexmttcp_usrreqtcp_identm_pulldown malfunctionudp_inputudp6_ctlinputIPv6 inpcb to udp_outputudp_usrreqTCP MD5 Signature Option, RFC 2385IPcompIPsec ESPIPsec AHIPv4 Simple Encapsulationgettdbbysrcdstno tdb hash table tdb cnt bucket cnt %d%c %d +%d.%d.%d.%d(unknown address family)ipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) ipsp_spd_lookupipsec policyipsec acquireipsp_spd_inpipip_input: should never reach hereipe4_input(): should never be called etherip_inputipsec_common_inputipsec_common_input_cbipsec_common_ctlinputudpencap_ctlinputah6_input: l went zero or negativeesp6_input: l went zero or negativeipcomp6_input: l went zero or negativeesp_initesp_input_cbah_initah_massage_headersah_input_cbcarpcarp_hmac_preparecarp_hmac_generatecarp_hmac_verifycarp_setroute%s: carp: packet received on non-carp interface: %s received ttl %d != %d on %spacket too short %d on %schecksum failed on %sm_pulldown malfunctionpacket size %u too smallchecksum failed, on %sinvalid version %d != %dincorrect hash%s%dip_output failed: %dip6_output failed: %dcarp_send_ad%s: master_down event in INIT state carp_join_multicast6carp_ioctlcarp_ether_purgemultiipcomp_initcc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% >>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj ggQRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHOj ggʧ;l٫Ak[~!y1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("("cryptopcryptodesccrypto_waitcryptof_ioctlcrydevcuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cui_apply: ind %d >= uio_iovcnt %d for offcui_apply: ind %d >= uio_iovcnt %d for lenswcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESAES-CTRARC4NULLHMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSaes_ctr_cryptbind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d vm_map_lock_read: intrsafe mapnfs_read modenfsbioread nfsbioread: type %x unexpected nfs_write modenfs_write procnfsvinvalProcess killed due to text file modification nfs_doio: type %x unexpected nfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS/v2, error=%d nfs_boot_getfhnfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply vm_map_lock_read: intrsafe mapnfs_hashlocknfsnodeplnfs_inactive: pushing activenfs_reclaim: pushing activevm_map_lock_read: intrsafe mapnfskqlcknfskqpwnfskqdet<nfskqpollvm_map_lock_read: intrsafe mapbuild > MLENnfsrv3_accessnfsrv_getattrnfsrv_setattrnfsrv_lookupnfsrv_readlinknfsrv_read iovnfsrv_readnfsrv_writenfsrv_write: nd_mrep not freenfsrvw_coalescenfsrv_coalesce: bad offnfsrv_createnfsrv_mknodnfsrv_removenfsrv_renamenfsrv_linknfsrv_symlinknfsrv_mkdirnfsrv_rmdirnfsrv_readdirnfsrv_readdirplusnfsrv_commitnfsrv_statfsnfsrv_fsinfonfsrv_pathconfvm_map_lock_read: intrsafe mapnfsconnfscon sotypenfs send error %d for server %s nfsd send error %d short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s nfsreply nilis alive againnqnfstrynfs_requestbuild > MLENnot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s nfs getstreamnfsd wakeupvm_map_lock_read: intrsafe mapnfsrcnfsrv cachevm_map_lock_read: intrsafe mapbuild > MLENnfsm_uiotombuf: iovcnt != 1nfs S too bignfsreqplvm_map_lock_read: intrsafe mapcld kerbnqnfstimrnfsd initnfsdmbuf siz=%d Bad nfs svc replynfsidlnfsionfsauth1nfsauth2nfs_getnickauth verf too smallvm_map_lock_read: intrsafe mapc8ifgiNphhii hibuild > MLENrootnfs_mountroot: root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapnfs_mountroot: getattr for swap swap on %s WARNING: no swap nfs_mountrootnfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfsconnfs_mountnfsdismvm_map_lock_read: intrsafe mapbuild > MLENopen eacces vtyp=%d EEK! readdirrpc resid > 0 EEK! readdirplusrpc resid > 0 nfs: sillyrename dir .nfsA%05x4.4nfs physio/asyncnfsfsyncnfs_fsync: not dirtynfs_fsynctag VT_NFS, fileid %ld fsid 0x%lx bwrite: buffer is not busy???vm_map_lock_read: intrsafe mapdev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialuid %u on %s: %s file system full %s: write failed, file system is full dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d,mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free pos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cylffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in mapdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodebsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %dffs_checkblk: partially free fragmentstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapvm_map_lock_read: intrsafe mapffs_balloc: blk too bigffs_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dvm_map_lock_read: intrsafe mapffs_update: bad link cntffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_indirtrunc: bad buffer sizevm_map_lock_read: intrsafe mapDisk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapffs_isblockffs_clrblockffs_setblockffs_isfreeblock?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@vm_map_lock_read: intrsafe maplR$.R,P02378::Rhffs_mountroot: can't setup bdevvp's ffsroot_deviceWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty2ffs_reload: dirty1 ffs_mountfs(): Sorry, no UFS2 support (yet) ffs_statfsfs = %s update: rofs modinodeffsinodino1plvm_map_lock_read: intrsafe map%s: modeffs_read%s: short symlink%s: type %dffs_write%s: nonsync dir write%s: typeffs_fsync: not dirtyffs_fsyncffs_fsync: dirtyvm_map_lock_read: intrsafe mapnewdirblkdirremmkdirdiraddfreefilefreeblksfreefragallocindirindirdepallocdirectbmsafemapnewblkinodedeppagedepsema_release: not heldsoftdep_free: unknown type %dsoftdep_freequeue_processadd_to_worklist: already on list%s_process_worklist: Unknown type %ssoftdep???softdep_move_dependencies: need merge codesoftflushpagedep_lookupinodedep_lookuppagedepplinodedepplnewblkplbmsafemapplallocdirectplindirdepplallocindirplfreefragplfreeblksplfreefilepldiraddplmkdirpldirremplnewdirblkplsoftdep_setup_inomapdep: found inodesoftdep_setup_blkmapdep: found blockbmsafemap_lookupsoftdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: Bonk art in the headsoftdep_setup_allocdirect: non-zero indirsoftdep_setup_allocdirect: lost entryallocdirect_mergeallocdirect_merge: old %d != new %d || lbn %ld >= %dallocdirect_merge: extra newdirblknewfreefrag: frag sizesoftdep_setup_allocindir_page: Bonk art in the headsetup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blknosoftdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblockssoftdep_setup_freeblocks: inode busydeallocate_dependencies: already gonedeallocate_dependencies: not indirdeallocate_dependencies: lost pagedepdeallocate_dependencies: Unexpected type %sdeallocate_dependencies: Unknown type %sfree_allocdirectfree_allocdirect: extra newdirblkfree_newdirblkcheck_inode_unwrittencheck_inode_unwritten: busy inodehandle_workitem_freeblocks: block count handle_workitem_freeblksindir_trunc: lost indirdepindir_trunc: dangling depfree_allocindirsoftdep_setup_directory_add: lost inodedepsoftdep_setup_directory_add: lost entryfree_diraddfree_diradd: unfound refnewdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %d should be %dsoftdep_change_linkcnt: bad deltahandle_workitem_remove: vgethandle_workitem_remove: lost inodedephandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncatehandle_workitem_freefilesoftdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %sinitiate_write_filepage: already started %s: dir inum %d != new %dinitiate_write_filepageinitiate_write_inodeblock: already startedinitiate_write_inodeblock: already doing I/Osoftdep_write_inodeblock: lbn order%s: direct pointer #%ld mismatch %d != %dsoftdep_write_inodeblock%s: indirect pointer #%ld mismatch %d != %dsoftdep_write_inodeblock: Unknown state 0x%xsoftdep_write_inodeblock: lost dep1softdep_write_inodeblock: lost dep2disk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %shandle_allocdirect_partdonehandle_allocdirect_partdone: dangling dephandle_allocindir_partdonehandle_allocindir_partdone: dangling dependencyhandle_written_inodeblockhandle_written_inodeblock: not startedhandle_written_inodeblock: new entry%s: %s #%ld mismatch %d != %ddirect pointer%s: %s #%ld allocated as %dindirect pointerhandle_written_inodeblock: bad sizehandle_written_inodeblock: filefreehandle_written_inodeblock: Unknown type %shandle_written_inodeblock: live inodedepdiradd_inode_writtenhandle_written_mkdirhandle_written_mkdir: bad typehandle_written_filepagehandle_written_filepage: not startedhandle_written_filepage: attachedsoftdep_update_inodeblock: bad link countsoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: update failedmerge_inode_listssoftdep_fsync: pending opssoftdep_fsync: Unexpected type %ssoftdep_fsync: dirtysoftdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdev: not dirtysoftdep_sync_metadata: Unknown type %sflush_inodedep_depsflush_pagedep_depsflush_pagedep_deps: MKDIR_PARENTflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: lost inodeflush_pagedep_deps: flush failedrequest_cleanup: unknown typesoftupdateclear_remove: vgetclear_remove: fsyncclear_inodedeps: vgetclear_inodedeps: fsync1clear_inodedeps: fsync2softdep_check_for_rollback: Unexpected type %sgetdirtybufsdsdtydrain_outputsoftdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O error%s: got error %d while accessing filesystem vm_map_lock_read: intrsafe map|.R,P2378(: mfs_mountroot: can't setup bdevvp'smfsmfs_rootmfs_mount: dup devmfsidlvm_map_lock_read: intrsafe mapmfs_open not VBLKmfs_strategy: bad devmfs_close: ref count %d > 1 mfs_close: dirty buffers mfs_closemfs_inactive: not inactive (mfs_buflist %p)tag VT_MFS, pid %d, base %p, size %ld mfs_badop calledvm_map_lock_read: intrsafe mapufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_getlbns: Invalid indirect block %d specifiedufs_getlbns: indirect block %d not foundvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../ufs/ufs/ufs_dirhash.c((((ip)->i_ump->um_fstype == 1) ? (ip)->dinode_u.ffs1_din->di_size : (ip)->dinode_u.ffs2_din->di_size) >= 512)(dh->dh_onlist)ufsdirhash_lookup: bad offset in hash array(dirblock < dh->dh_nblk && dh->dh_blkfree[dirblock] >= (((slotneeded) + (( 4) - 1)) / ( 4)))ufsdirhash_findfree: free mismatch(offset < dh->dh_dirblks * 512)(oldoff < dh->dh_dirblks * 512 && newoff < dh->dh_dirblks * 512)(offset == dh->dh_dirblks * 512)(offset <= dh->dh_dirblks * 512)ufsdirhash_dirtrunc: blocks in useufsdirhash_dirtrunc: first free corruptufsdirhash_checkblock: bad offsetufsdirhash_checkblock: bad dirufsdirhash_checkblock: bad dir endufsdirhash_checkblock: bad free countufsdirhash_checkblock: bad first-freeufsdirhash_checkblock: missing first-free entry(block < dh->dh_nblk && block < dh->dh_dirblks)(dh->dh_hused < dh->dh_hlen)ufsdirhash_findslot: '%.*s' not found(dh->dh_hused >= 0)(dh->dh_hash != 0L)dirhash((((&ufsdirhash_list)->tqh_first) == 0L))vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapffs_inactive: pushing activeufs_reclaim: pushing activevm_map_lock_read: intrsafe mapmangled entryi_ffs_size too small%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory vm_map_lock_read: intrsafe mapundefinedgroupuserchkdqufs_quota_free_blocks2: vnode is not locked %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too longchkiq %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too longchkdquot: vnode is not lockedchkdquot: missing dquotmissing dquotquotaon: mount point not busyquotaoff: mount point not busysetquotasetusedquotfree dquot isn'tdqsync: dquotdqsync: filedqsyncvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapchown: lost quotaufs_link: no nameufs_linkufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_renameufs_mkdir: no nameufs_mkdirufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld ufs_makeinode: no nameufs_makeinodevm_map_lock_read: intrsafe mapext2fs_alloc: missing credentialfile system full %s: write failed, file system is full mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free ext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloccg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in mapbad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodestart = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapuid %d on %s: %s vm_map_lock_read: intrsafe mapext2fs_balloc: ufs_getlbns returned indirect blockCould not unwind indirect block, error %dvm_map_lock_read: intrsafe mapext2fs_bmaparray: invalid argumentsext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cachevm_map_lock_read: intrsafe mapext2fs_inactive: pushing activeext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3ext2fs_indirtrunc: bad buffer sizevm_map_lock_read: intrsafe mapext2fs_readdirmangled entryi_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentrydirenter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2ext2fs_direntercheckpath: .. not a directory checkpathvm_map_lock_read: intrsafe map%s: modeext2fs_read%s: short symlink%s: type %dext2fs_write%s: nonsync dir write%s: typevm_map_lock_read: intrsafe mapDisk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapvm_map_lock_read: intrsafe mapHR$R,PP4xRhext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fsroot_device%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsfs = %s update: rofs modinodeExt2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported inode size Ext2 fs: unsupported optional feature vm_map_lock_read: intrsafe mapext2fs_link: no nameext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_mkdir: no nameext2fs_mkdir: blksizeext2fs_makeinode: no nameext2fs_reclaim: pushing activevm_map_lock_read: intrsafe map(V(V@(#)$arla: xfs_common-bsd.c,v 1.25 2002/12/18 16:32:03 lha Exp $%u/%uvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe map(Wh(Wp@(#)$arla: xfs_dev-common.c,v 1.61 2003/07/15 16:25:42 lha Exp $xfs_devclose never opened?xfsreadxfs_message_rpc: deadlock avoided pid = %u == %u NNPFS PANIC Error: Message to small to receive wakeup, opcode = %d xfsNNPFS PANIC Warning xfs_dev: Unknown message opcode == %d NNPFS PANIC Error: Could not wakeup requestor with opcode = %d properly, to small receive buffer. vm_map_lock_read: intrsafe map(Y0(Y8@(#)$arla: xfs_message.c,v 1.84 2003/06/02 18:25:20 lha Exp $NNPFS PANIC WARNING! xfs_message_installroot: called again! NNPFS PANIC WARNING! xfs_message_installnode: no parent xfs_message_installattr: tokens and no data NNPFS PANIC WARNING! xfs_message_installdata failed! Reason: lookup failed on cache file '%s', error = %d NNPFS PANIC WARNING! xfs_message_installdata failed Reason: No node to install the data into! NNPFS PANIC WARNING! xfs_message_updatefid: %d vrele: bad ref countvrele: ref cntvm_map_lock_read: intrsafe map([x([@(#)$arla: xfs_node.c,v 1.3 2003/02/06 12:56:09 lha Exp $xfs_node_purgevm_map_lock_read: intrsafe map([([@(#)$arla: xfs_node-bsd.c,v 1.70 2003/02/28 02:01:06 lha Exp $xfs_lockfailed to allocate syncer node when xfs daemon diedxfs_attr2attr: bad valuexfs_attr2vattr: bad valueNNPFS PANIC WARNING! xfs_dnlc_enter: %s already in cache vm_map_lock_read: intrsafe map(] (](@(#)$arla: xfs_syscalls-common.c,v 1.72 2003/01/19 20:53:49 lha Exp $lookup_nodegetfh_compatxfs: remote pioctl: got a negative data size: opcode: %dxfs_pioctl_call: got a humongous in packet: opcode: %dvm_map_lock_read: intrsafe map(^((^0@(#)$arla: xfs_vfsops-bsd.c,v 1.72 2002/12/19 10:30:17 lha Exp $xfs_fhopenvm_map_lock_read: intrsafe map(^(^@(#)$arla: xfs_vfsops-common.c,v 1.40 2003/06/02 18:26:40 lha Exp $xfsvm_map_lock_read: intrsafe map(_ (_(@(#)$arla: xfs_vfsops-openbsd.c,v 1.16 2003/06/02 18:26:50 lha Exp $O$JJJJJKKK KDQK<vm_map_lock_read: intrsafe map(_(_@(#)$arla: xfs_vnodeops-bsd.c,v 1.123 2003/02/15 16:40:36 lha Exp $xfs_readdir: mail arla-drinkers and tell them to bake burned cookiesxfs_lock: lock NULLxfs_unlock: lock NULLvm_map_lock_read: intrsafe map(`(`@(#)$arla: xfs_vnodeops-common.c,v 1.94 2003/01/27 11:58:50 lha Exp $NNPFS PANIC WARNING! xfs_fsync called after reclaiming! xfs_uio_end_lengthxfs_lookup_commonxfs_create_commonxfs_remove_commonxfs_rename_commonxfs_mkdir_commonxfs_rmdir_commonxfs_link_commonxfs_inactive: failed writing back data: %d xnode: fid: %d.%d.%d.%d attr: %svalid in data: %svalid flags: 0x%x offset: %d diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_amap_i.h(( offset) & (PAGE_SIZE - 1)) == 0amap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing therevm_map_lock_read: intrsafe mapamappl/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_amap.c(( sz) & (PAGE_SIZE - 1)) == 0(( padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(( entry->end - entry->start) & (PAGE_SIZE - 1)) == 0(( addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(( (entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap_wipeout: corrupt amapamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countvm_map_lock_read: intrsafe mapuvm_anon_add: can not allocate %d anons uvm_anon_adddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_anon.cpg->loan_count > 0anon_pagein: uvmfault_anonget -> %dvm_map_lock_read: intrsafe mapuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_aobj.cslot == 0uao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getpageuao_getpg->flags & PG_RELEASEDaobj->u_obj.uo_refs == 0TAILQ_EMPTY(&aobj->u_obj.memq)(pg->flags & PG_RELEASED) == 0vm_map_lock_read: intrsafe mapudv_attachdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_device.cuobj->uo_npages == 0 && TAILQ_EMPTY(&uobj->memq)udv_detachudv_faultvm_map_lock_read: intrsafe mapfltamapcopyanonget1anonget2flt_noram1diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_fault.cresult != VM_PAGER_PENDuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2uobj->pgops->pgo_releasepg != NULLflt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryva >= entry->startentry->next != &map->header && entry->next->start <= entry->endvm_map_lock_read: intrsafe mapuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedulerschedpwaitvm_map_lock_read: intrsafe mapuvm_init: page size not setvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_km.cuobj->pgops == &aobj_pagerUVM_OBJ_IS_INTRSAFE_OBJECT(uobj)(pp->flags & PG_BUSY) == 0(pp->pqflags & PQ_ACTIVE) == 0(pp->pqflags & PQ_INACTIVE) == 0vm_map_pmap(map) == pmap_kernel()km_getwait2uvm_km_alloc1: non-released pagekm_allockm_alloc1wvallocwaitkmthreadkmallocgetpagevm_map_lock_read: intrsafe mapvmmaplkvmmapbsydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.cnextuvm_rb_insert: duplicate entry?uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries uvm_mapent_allocuvm_mapent_free# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekplUVM_OBJ_IS_KERN_OBJECT(uobj)(align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= lengthvm_map_pmap(map) == pmap_kernel()!VM_MAPENT_ISWIRED(first_entry)uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5(start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0map->flags & VM_MAP_PAGEABLEvm_map_upgrade: failed to upgrade lockuvm_map_pageable: stale mapuvm_map_pageable_all: stale map(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> BUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJPAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printitvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_page_i.hpg->wire_count == 0lcv != -1/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_page.c(pg->flags & PG_TABLED) == 0pg->flags & PG_TABLEDuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d obj == NULL || anon == NULLoff == trunc_page(off)free_list >= 0 && free_list < VM_NFREELISTuvm_pagealloc_strat: bad strat %dsaved_loan_count == 0vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pager_i.hrvpg != NULLemergva/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pager.cnpages <= MAXBSIZE >> PAGE_SHIFTpager_mappppp->flags & PG_BUSY!uobj || obj_is_aliveuvm_aio_biodoneuvm_aio_aiodoneswap || pg->uobject == uobj!write || (pgs[i]->flags & PG_FAKE) == 0vm_map_lock_read: intrsafe mappagedaemon: deadlock detected! pgdaemonaiodoneddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0uobj != NULLanon->an_swslot != 0uvmexp.swpgonly <= uvmexp.swpagesuvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0(m->pqflags & (PQ_ACTIVE|PQ_INACTIVE)) == 0vm_map_lock_read: intrsafe map%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p vm_map_lock_read: intrsafe mapswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrsys_swapctlswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_swap.csdp->swd_npginuse == sdp->swd_npgbadswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filesw_reg_iodonevnx->vx_pending == 0uvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost flags & PGO_SYNCIOswapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrvm_map_lock_read: intrsafe mapswap_decrypt: key not initializedvm_map_lock_read: intrsafe mapsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?vm_map_lock_read: intrsafe mapuvm_deallocate with null mapvm_map_lock_read: intrsafe mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_deref: vnode VM object still has pages afer syncio/free flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getpageuvn_getuvn_iosyncgif%s%dgif_startgif_output: recursively called too many times NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin_gif_outputin6_gif_outputin6_pcbconnectHuh? Thought in6_pcbnotify() never got called with mapped! in6_pcbnotifyin6_ifloop_request: %s operation failed for %s (errno=%d) ADDDELETEin6_ifloop_requestprefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix in6_controlin6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifain6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia == NULL in in6_ifattach_linklocalin6_ifattach_linklocalin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_ifattach_loopbackin6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifattach%s: didn't unlink in6ifaddr from list in6_ifdetachin6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6m_pulldown malfunctionm_pulldown malfunction%s:%d: ip6q already locked /usr/src/sys/arch/sparc/compile/GENERIC/../../../../netinet6/frag6.cip6q_lock%s:%d: ip6q lock not held ip6q lock checkicmp6_mtudisc_callback_registerm_pulldown malfunctionENOBUFS in icmp6_error %d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6_notify_error: in6_embedscope failed icmp6_notify_erroricmp6_mtudisc_updateni6_inputshould not reach hereicmp6_rip6_inputsanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/arch/sparc/compile/GENERIC/../../../../netinet6/icmp6.cassumption failed in icmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d icmp6_reflect(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_inputicmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s m_pulldown malfunctionip6_inputip6_savecontrolip6_pullexthdr: invalid nxt=%d ip6_nexthdr: m == NULLip6_nexthdrOpenBSD-currentcannot forward from %s to %s nxt %d received on %s ip6_forward: tag of length %d (should be %dcannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: outgoing interface is loopback. src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forwardip6_mrouter_doneregister_mifadd_m6ifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fccannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full ip6_mforwardip6_mdqregister_sendm_pulldown malfunctionip6_output: IPv4 pcb is passedip6_output: tag of length %d (should be %dassumption failed: hdr not splitip6_outputip6_ctloutputip6_setmoptionsip6_setpktoptionsm_pulldown malfunctionip6_rthdr0m_pulldown malfunctionnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookup: failed to lookup %s (if = %s) unspecnd6_lookupnd6_freend6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_rtrequestdefault router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_ioctlifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) m_pulldown malfunctionnd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_inputnd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_ns_outputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_inputnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_na_outputnd6_dad_start: called with non-tentative address %s(%s) ???nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_na_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s m_pulldown malfunctionnd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_inputdefrouter_addreqdr == NULL in defrouter_delreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlinknd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlinkin6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifaddin6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_detachrip6_usrreqrip6_usrrequdp6_outputPF_KEY @@@@@(@(@PP   pfkeyv2_policyipsec policypfkeyv2_sendaesaesctr3desdesblowfishskipjackcast128deflatelzshmac-sha1hmac-ripemd160hmac-md5hmac-sha2-256hmac-sha2-384hmac-sha2-512pfkeyv2_parsemessagevm_map_lock_read: intrsafe mapiommu%s at %s unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB nameobiovmelvmesvme%s at %s addr %p vec 0x%x((((interruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsvmesattach: can't allocate intrhandvmelattach: can't allocate intrhandvme: PROM ranges too large: %d: version 0x%x vmebus: no rangesvme: spurious interruptvme: spurious interrupt vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqauxregauxiliary-ioauxioauxio2Tadpole no aux registeroclockeepromclocktimer delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d mk48t02modelno prop: %s (eeprom) mk48t08counter-timercounterdelay calibration delay constant %d oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz oldclk statintr;Zx0NWARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained%s -- CHECK AND RESET THE DATE! power ledleds sun4cpumidsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s cpu_attach%s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dmmu-npmgmmu-nctxclock-frequencyvac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typecache chip bug - trap page uncachedcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache [viking: PCR_TC is off][viking: turn on PCR_TC]UnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUsB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%xmemregmemory-errormemregattach %ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorHyperSPARC async cache memory failure at phys 0x%x%x store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. zsslavezsattach: expected 1 interrupt, got %d pri %d, softpri %d serialkeyboardmousebroken zs interrupt schemepwr-on-auxio2%s: channel %dzs_set_speedttydttycttybttyakeyboard/displaystdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. device_typestdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. consinitfdc1.2MB/NEC360KB/x720KB1.44MBfdSUNW,fdtwo drive %d pri %d, softpri %d: unable to register fast trap handler %s: no drives attached CFGLOCK: unexpected responsechip 8207%c : %s %d cyl, %d head, %d sec : density unknown fdstrategy: controller inactive fdcresult: overrun fdcresult: timeout fdcstart: not idle %s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d %s: timeout but no I/O pending: statu %d, istatus=%d fdc: ierror status: state %d fdc: spurious interrupt: state %d fdcintr: block %d != blkno %d timeoutsoft errorstray interruptfdcintr: impossible%s: read-only medium %s: no medium? hard errorcontroller statusfloppy diskfictitious%s: %s sbusslave-only"%s" at %sdevice_type class %s %s slot %d offset 0x%x unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnamerelative sbus addressing not supportedsbus_establish: can't find sbus parent for %sreset %s:%s: dma card found in non-dma sbus slot %d: not supported %s: reset: invalid keyboard type 0x%02x  '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ]}&12 "3!'4"(5#6$7%!8&9\'0()~)-_#**|6a7z@A`$@M qVmMW%X[{dwj,?k;.l:/m=+w |<> &12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@()])=+}*6a7z@A$M qVmW%X*dwj,?k;.l:/m!|<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)|*'*`@AC LVWXk,;l.:m-_w|<>\ 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)|**`@AVWX\*`k,;l.:m-_|<>\ ]} 2" 3#6&$7/%8(`&9)''0=|(?\)*#^@;z@A+~LVWX[{dyjmMk,;l.:m-_w|<> 2" 3#6&$7/{%8([&9)]'0=}(?\)*^6qQ@;z@A+~VWX#'`dyjmMk,;l.:m-_|<>| ]}2" 3#6&$7/%8(&9)\'0=|('?`)^*@A+*~LV@W#X[{k,;l.:m-_w|<> 2" 3#6&$7/%8({&9)}'0=('?`)^*\|@[A+*]V@W#X~k,;l.:m-_|<> \|1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?) *<>@A*~NsSV+WX@dzZexXfcCjmMk,;l.:m-=w }][ 1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?\) *@@A*|~NsSV+WX<>^dzZexXfcCjmMk,;l.:m-=}][ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)\*'*`@ALVWX|k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)\*|@AVWX'*`k,;l.:m-_}<> ]}2"@ 3#!4$#6&$7/%8(&9)\'0=|('?`)*^@*+A~LVWX[{k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}('?`)*\|@+*AVWXk,;l.:m-_}<> ]}2"@ 3#"5%#6&$7/%8(&9)\'0=|('?`)*>oO@^A+*~LMaAVWX[{k,;l.:m-_w}<> 1!|2"@ 3#!4$^"5%~#6&$7/%8(&9)'0=('?`)*\@[A+*]VW{X}k,;l.:m-_}<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\ >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\1!|!3#(-_C 2" 3*`W'@X#~|\|2"#6&$7'%8(&9)'0(-=)^~*|@@`A[{V;+W:*X]}|\_ (Ԩ `(T(lO(6 V(`(M(ڰj( L(vP(ޢb(lb( O("  ((H (ԨN(L( O(Z(ׂC(J,(i(ܤ J(K(BU(0U( O(  ((d       zstty flags 0x%xinputoutput (console %s)i/okeyboardmouse: %s zstty_attachzs_shutdown: not enabled?%s: device enable failed zsopen%s: %d silo overflow%s, %d ibuf flood%s szskbdkeyboard, flags 0x%xkeyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%x : failed to set baudrate : failed to set modes : no keyboard %s: %d silo overflow%s, %d ibuf flood%s smii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %d!A  !@@@@mii_phy_setmediamii_phy_setmedia: MASTER on wrong mediamiiautnsphy((hDP83840 10/100 PHY: %s, rev. %d nsphyterd ((DP83843 10/100 PHYDP83815 10/100 PHY: %s, rev. %d qsphy@`Q(@QS6612 10/100 PHY: %s, rev. %d lxtphyP !P|!((LXT971 10/100 PHYLXT970 10/100 PHY: %s, rev. %d luphy"| ` ( LU6612 10/100 PHY: %s, rev. %d tqphy$% 9(x78Q2120 10/100 PHY: %s, rev. %d ukphy(4| : Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphy*\+,(X(86(!(((3((2(BCM5222 Dual 10/100 PHYBCM5221 100baseTX PHYBCM5220 10/100 PHYBCM5214 Quad 10/100 PHYBCM5201 10/100 PHYBCM4401 10/100baseTX PHYBroadcom 3C905C internal PHYBroadcom 3C905B internal PHY: %s, rev. %d scxsplgetxscannot allocate scsi xs scsi_free_xsonly the first 4,294,967,295 sectors will be used. scsi_donescsi_execute_xs: USER without NOSLEEPscsi_execute_xs: USER with POLLscsi_execute_xs: NOSLEEP and POLLscsicmdscsi_execute_xs: invalid return code (%#x)scsi_execute_xs: impossiblescsi_scsi_cmd: buffer without nosleepunknown error category (0x%x) from scsi driver scbusy%s(%s:%d:%d): probeReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Sense)Q)P)P)P)P)Pp)PX)P0)P)O)O)O)Op)OX)O8)O)N)N)N)N)N)N`)NH)N0)N)M)M)M`)M0)M)L)L)Lh )L8 )K )K )Kx)K@)K)J)J)J)Jh)J@)J)I)I )I )I )I )Ih )IP )I8 )I0 )I )H )H )H )Hx )HP )H( )G )G )G )G )G )GX )G8 )G )F )F )F )FX )F0 )F )E)E)E)E)Ep)EX)E@)E )E)D)D)D)D)Dh )DX )D@ )D )C )C)C)Ch)CH)C()C)B)B)B)Bh)BP)B0)B)B)A)A)A)A`)A@)A)@)@)@)@x)@H)@)?)?)?)?h)?@)?)>)> )>p)>@)>)=)=)=)=x)=P)= )=)<)<)<)<)<`)<@)<()<);););); );h );8 ); ): ): ): ):x ):H ): )9 )9 )9!)9!)9h!)9H")9$)8$)8$):$):$)8$)8$)8$)8h%)8H&)8(&)8&)7&)7&)7&)7&)7h&)7@&)7 & )6& )6& )6& )6x& )6P&)6('(')6')5')5')5')5')5h()50()5))4))4))4))4))4h))48))4))4*)3*)3*)3*)3*)3*)3p*)3P*)3+)2,)2,)2,)2x,)2P,)20,)2,)1,)1,)1, )1, )1`-)18.)1/)00)00)00)0x0)0X0)000)00)/0)/0)/0 )/`0 )/@0)/(1)/1).2).2).3).4).5).`5).@5). 5)-5)-6)-7)-8)-x8)-P8)-88)-9),:),:),:),:),x:),@;), ;)+;)+;)+;)+;)+p;)+P;)+0;)+; )+; )*; )*; )*; )*x;)*X;)*@;)* ;)*;));));));))=))`>))0>))>))>)(>)(?)(?)(h?)(H?)((?)(?)'?)'?)'?)'? )'p? )'P? )'8? )' ? )'?)&?)&?)&?)&@)&xA)&PB)&C)&D)%E)%F)%G)%G)%G)%PG)%(G)$G)$G)$H)$pI)$XJ)$@K)$(K)#K)#K)#K)#K)#K)#L)#`N)#@P)#(P)#P)"Q)"Q)"R)"S)"hS)"PS)"0T)"U)!U)!U)!U)!U)!pU)!HU)!(W)!X) Y) Z) Z) xZ) XZ) 8[) ([) [)[)\)\)\)])`])0])])])])P])])])])p])8])])])])h])8])] )]!)]")P]#)]$)]%)]&)p]')8]()]))]*)]+)X],)]0)]1)]2)`]3)(]4)]5)]6)x]7)@]8)]9)]:)];)`]<) ]@)]A)]B)x]C)@]D)]E)]F)]G)p]H)@]I)]J)]K)]L)x]P)@]Q)]R)]S)]T)`]U)0]V)]W)]X)]Y)`]Z)0][)]\)]`)]a)X]b) ]c)]d)]e)x]f)@]g)]h)]i)]j)p]k)@]l)]) ^) ^) ^) h^) @^) ^A) ^B) ^C) ^E) ^G) p`) `a) Ha) 0a) b) c) c) d) d) pe) `f) 8f) f) f) g) g) hg) Pg) (g) g) g) g) g) g ) hg ) @h) i) i)i)j)k)k)hk)Hl)(m)n)o)o)po)0o)o)o)q)`r)Hr) r)r)r)r)hs)Ps)(s)s)s)s)s)RMA/PMA Is Almost FullProgram Memory Area Is FullProgram Memory Area Update FailurePower Calibration Area ErrorPower Calibration Area Is FullPower Calibration Area Almost FullCD Control ErrorNo More Track Reservations AllowedEmpty Or Partially Written Reserved TrackSession Fixation Error - Incomplete Track In SessionSession Fixation Error Writing Lead-OutSession Fixation Error Writing Lead-InSession Fixation ErrorDecompression Exception Long Algorithm IDDrive Region Must Be Permanent/Region Reset Count ErrorMedia Region Code Is Mismatched To Logical Unit RegionRead Of Scrambled Sector Without AuthenticationCopy Protection Key Exchange Failure - Key Not EstablishedCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Authentication FailureCommand To Logical Unit FailedRecalculate Failure OccurredRebuild Failure OccurredRedundancy Level Got WorseRedundancy Level Got BetterState Change Has OccurredInformational, Refer To LogParity/Data MismatchMultiple Logical Unit FailuresData Loss On Logical UnitLogical Unit Not ConfiguredSet Target Port Groups Command FailedMultiply Assigned Logical UnitAssign Failure OccurredCreation Of Logical Unit FailedAttachment Of Logical Unit FailedRemove Of Logical Unit FailedExchange Of Logical Unit FailedModification Of Logical Unit FailedAdd Logical Unit FailedConfiguration Of Incapable Logical Units FailedConfiguration FailureDocument Miss Feed Automatic In Document FeederDocument Jam In Automatic Document FeederAutomatic Document Feeder Lift UpAutomatic Document Feeder Cover UpVoltage FaultInvalid Packet SizeIllegal Mode For This TrackPacket Does Not Fit In Available SpaceEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailurePower State Change To Device ControlPower State Change To SleepPower State Change To StandbyPower State Change To IdlePower State Change To ActiveStandby Condition Activated By CommandIdle Condition Activated By CommandStandby Condition Activated By TimerIdle Condition Activated By TimerLow Power Condition OnFailure Prediction Threshold Exceeded (false)Firmware Impending Failure Drive Calibration Retry CountFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Controller DetectedFirmware Impending Failure Channel ParametricsFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Access Times Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Calibration Retry CountSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Controller DetectedSpindle Impending Failure Channel ParametricsSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Access Times Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure General Hard Drive FailureServo Impending Failure Drive Calibration Retry CountServo Impending Failure Spin-Up Retry CountServo Impending Failure Seek Time PerformanceServo Impending Failure Throughput PerformanceServo Impending Failure Controller DetectedServo Impending Failure Channel ParametricsServo Impending Failure Start Unit Times Too HighServo Impending Failure Access Times Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Seek Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Drive Error Rate Too HighServo Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Calibration Retry CountData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Controller DetectedData Channel Impending Failure Channel ParametricsData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Access Times Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure General Hard Drive FailureController Impending Failure Drive Calibration Retry CountController Impending Failure Spin-Up Retry CountController Impending Failure Seek Time PerformanceController Impending Failure Throughput PerformanceController Impending Failure Controller DetectedController Impending Failure Channel ParametricsController Impending Failure Start Unit Times Too HighController Impending Failure Access Times Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Seek Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Drive Error Rate Too HighController Impending Failure General Hard Drive FailureHardware Impending Failure Drive Calibration Retry CountHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Seek Time PerformanceHardware Impending Failure Throughput PerformanceHardware Impending Failure Controller DetectedHardware Impending Failure Channel ParametricsHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Access Times Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure General Hard Drive FailureSpare Area Exhaustion Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededFailure Prediction Threshold ExceededSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change InputUpdated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsAuxiliary Memory Out Of SpaceInsufficient Access Control ResourcesInsufficient Registration ResourcesInsufficient ResourcesInsufficient Reservation ResourcesSystem Buffer FullSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase Failure - Incomplete Erase Operation DetectedErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationInitiator Response TimeoutData Offset ErrorNAK ReceivedACK/NAK TimeoutToo Much Write DataInvalid Target Port Transfer Tag ReceivedData Phase ErrorCommand Phase ErrorInvalid Message ErrorInitiator Detected Error Message ReceivedSome Commands Cleared By iSCSI Protocol EventProtocol Service CRC ErrorAsynchronous Information Protection Error DetectedInformation Unit iuCRC Error DetectedSCSI Parity Error Detected During ST Data PhaseData Phase CRC Error DetectedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)Medium Auxiliary Memory AccessibleMedium LoadableEcho Buffer OverwrittenReported LUNs Data Has ChangedVolume Set ReassignedVolume Set DeassignedVolume Set DeletedVolume Set Created Or ModifiedSpare DeletedSpare Created Or ModifiedRedundancy Group DeletedRedundancy Group Created Or ModifiedDevice Identifier Changedcomponent Device AttachedINQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Unable To Update Self-Test LogLogical Unit Failed Self-TestTimeout On Logical UnitLogical Unit FailureLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTIFY MessageMechanical Positioning Or Changer ErrorMedium Magazine UnlockedMedium Magazine LockedMedium Magazine InsertedMedium Magazine RemovedMedium Magazine Not AccessibleEnd Of Medium ReachedMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Beginning Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumSequential Positioning ErrorMedium Not Present - Medium Auxiliary Memory AccessibleMedium Not Present - LoadableMedium Not Present - Tray OpenMedium Not Present - Tray ClosedMedium Not PresentSaving Parameters Not SupportedESN - Device Busy Class EventESN - Media Class EventESN - Power Management Class EventEvent Status NotificationRounded ParameterRibbon, Ink, or Toner FailureEnclosure Services Transfer RefusedEnclosure Services Transfer FailureEnclosure Services UnavailableUnsupported Enclosure FunctionEnclosure Services FailureEnclosure FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedMedium Not FormattedCleaning Request RejectedCurrent Session Not Fixated For AppendCannot Write - Application Code MismatchCleaning FailureCannot Format Medium - Incompatible MediumCannot Write Medium - Incompatible FormatCannot Write Medium - Unknown FormatCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorInsufficient Time For OperationOverwrite Error On Update In PlacePartition Or Collection Contains User ObjectsPrevious Reservation Conflict StatusPrevious Task Set Full StatusPrevious Busy StatusPersistent Prevent ConflictIllegal Power Condition RequestCurrent Program Area Is EmptyCurrent Program Area Is Not EmptyInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectImplicit Asymmetric Access State Transition FailedAsymmetric Access State ChangedRegistrations PreemptedReservations ReleasedReservations PreemptedLog Parameters ChangedMode Parameters ChangedParameters ChangedI_T Nexus Loss OccurredTransceiver Mode Changed to LVDTransceiver Mode Changed to Single EndedDevice Internal ResetBus Device Reset Function OccurredSCSI Bus Reset OccurredPower On OccurredPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Conditional Write ProtectPermanent Write ProtectPersistent Write ProtectAssociated Write ProtectLogical Unit Software Write ProtectedHardware Write ProtectedInvalid Parameter While Port Is EnabledCopy Segment Granularity ViolationInvalid Operation For Copy Source Or DestinationInline Data Length ExceededUnexpected Inexact SegmentUnsupported Segment Descriptor Type CodeToo Many Segment DescriptorsUnsupported Target Descriptor Type CodeToo Many Target DescriptorsData Decryption ErrorInvalid Release Of Persistent ReservationThreshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedNonce Timestamp Out Of RangeNonce Not UniqueSecurity Working Key FrozenSecurity Audit Value FrozenCDB Decryption ErrorIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Address For WriteInvalid Element AddressLogical Block Address Out of RangeAccess Denied - ACL LUN ConflictAccess Denied - Invalid Proxy TokenAccess Denied - Invalid LU IdentifierAccess Denied - Enrollment ConflictIllegal Command While In Implicit Address ModeIllegal Command While In Explicit Address ModeObsoleteIllegal Command While In Write Capable StateAccess Denied - Invalid Mgmt ID KeyAccess Denied - No Access rightsAccess Denied - Initiator Pending-EnrolledInvalid Command Operation CodePartial Defect List TransferRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data With LinkingRecovered Data With ECC - Data RewrittenRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With L-ECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Data RewrittenRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Sync Error - Recommend ReassignmentData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend RewriteData Sync Error - Data RewrittenData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorLocate Operation FailureRecord Not Found - Data Auto-ReallocatedRecord Not Found - Recommend ReassignmentBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldRead Error - Failed Retransmission RequestAuxiliary Memory Read ErrorRead Error - Loss Of StreamingError Reading ISRC NumberError Reading UPC/EAN NumberCannot Decompress Using Declared AlgorithmDe-Compression CRC ErrorUncorrected Read Error - Recommend Rewrite The DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block ReadData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retries ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorInformation Unit Too LongInformation Unit Too ShortInvalid Information UnitCopy Target Device Data OverrunCopy Target Device Data UnderrunIncorrect Copy Target Device TypeCopy Target Device Not ReachableThird Party Device FailureError Detected By Third Party Temporary InitiatorWrite Error - Not Enough Unsolicited DataWrite Error - Unexpected Unsolicited DataAuxiliary Memory Write ErrorWrite Error - Padding Blocks AddedWrite Error - Loss Of StreamingWrite Error - Recovery FailedWrite Error - Recovery NeededBlock Not CompressibleData Expansion Occurred During CompressionCompression Check Miscompare ErrorWrite Error - Recommend ReassignmentWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorWarning - Enclosure DegradedWarning - Specified Temperature ExceededWarningError Log OverflowHead Select FaultSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorUnreachable Copy TargetLogical Unit Communication CRC Error (ULTRA-DMA/32)Logical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalVerify Operation In ProgressSet Capacity Operation In ProgressRewind Operation In ProgressLocate Operation In ProgressErase Operation In ProgressCleaning RequestedOperation In ProgressNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02x%sCheck Condition (error %#x) on opcode 0x%x DEFERRED AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) onoff COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Error in %s, Offset %dCDBParameters, bit %dActual Retry Count: %dProgress Indicator: %dscsi_user_doneUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category (0x%x) from host adapter code user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistrscsi_do_ioctl: impossible cmd (%#x)scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksscsi_probe_bus)]`)]P)]H)]8)] )])])\)])\)\)\)\)\)])\)\)])\)\)])\)\p)])\)\h)])])\`)])\P)\8)])\0)\()])\ )\)])\)\)[)[)[)])\)[)])[)[)[)[)[)[)[)[h)[`)[)[H)[@)[ )])[)[)])[)Z)])Z)Z)])Z)Z)])Z)Z)])Z)Z)])Z)Z)])Z)ZX)])ZP)Z@)])Z)Z0)])Z)Z )])Z)Z)])Z)Y)])Y)Y)])Y 1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P4.21NEC CD-ROM DRIVE:2731.0gMemorex CRW-26421.061.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TESW03DALPS ELECTRIC CO.,LTD. DC544C02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 3.SDT-5000 SONY DCASC3725SHP0002ST150176LWSEAGATE4421-07MICROPjaz 1GBiomegaELS85S QUANTUM DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID A00MD21/S2 ESDIEMULEX RZ55 (C) DECDEC 1588-15MBSUN0669MICROP 1.01CD-ROM PX-40TSPLEXTOR%s offlinescsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUvendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixedscsibusprint not configured vm_map_lock_read: intrsafe mapcd)_)_)_)_)_)_)_)_)_NEC CD-ROM DRIVE:260 cdstart%s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMfictitiousdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcach)`x)`x)`x02009000SPECTRA %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s s%s: warning, READ ELEMENT STATUS avail != count %s: could not sense element address page %s: could not sense capabilities page vm_map_lock_read: intrsafe mapsd)b )b )b )b )b )b )b )b )b )b )b )b )b )b )b )b )b )b %s: %luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec totaldrive offlinesdattach: unknown result (%#x) from get_parms%s: WARNING: unable to establish shutdown hook sdstart%s: not queued, error %d sdioctlSCSI opticalSCSI disk%s %ssdgetdisklabel%s: WARNING: cache synchronization failed )j )j)j)i)i)i)i)i)i)i)i)i)i)ih)i)iX)i@)i)i)i()i)i)i)i)i)h)i)i)h)i)i)h)i)h)h)i)h)hx)hp)h`)hH)iEEEE)i)h0)h()h)h)iMT-2ST/N50 TEAC ????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st)i)i)i %s: %srogue, drive empty or not ready density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled%s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d ststart%s: not queued %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d generic)ox)o`)oX)oH)ox)o0)oX)o )o)n)oX)n@ )o)n)oX)n@ )n)n)oX)n@ )nx)n`)oX)nP.T)nx)n8)oX)n(. T)n)n)oX)mFujitsu M3096GM3096Gm FUJITSU UMAX UG-630UG630 UMAX UC-630UC630 UMAX IBM 24562456-001 IBM Ricoh IS-410IS410 Ricoh IS-50IS50 RICOH Ultima A6000CA6000C PLUS Ultima AT3 AT3 1.60 ULTIMA ss)q)q)q)q)q)q)q)q)q)q)q)q)q)q)q)q)qh)q)q)qP)q)q)q8)q)q)q )q)q)q)q)q)p)q)q)p)q)q)p)q)q)p)qC7670A C6270A C7190A C5190A C6290A C5110A C1130A C2520A C2570A C2500A C1790A C1750A HP MUSTEK %s: %s %s: generic scanner %s: already open %s: not queued ss_set_window %s: MFS-06000CXMustek 6000CX Flatbed 3-pass color scanner, 3 - 600 dpi MFS-12000CXMustek 12000CX Flatbed 3-pass color scanner, 6 - 1200 dpi %s: not queued mtkrdymustek: lines actual(%d) != computed(%ld) mustek: win-size actual(%d) != computed(%ld) %s: C1750AHP ScanJet IIcC1790AHP ScanJet IIpC2500AHP ScanJet IIcxC2570AHP ScanJet 3pC2520AHP ScanJet 3c/4c/6100CC1130AHP ScanJet 4pC5110AHP ScanJet 5pC6290AHP ScanJet 4100CC5190AHP ScanJet 5100CC7190AHP ScanJet 5200CC6270AHP ScanJet 6200CC7670AHP ScanJet 6300C set_window failed compute_sizes failed %s: set_window failed %s: compute_sizes failed *f0S%s: trigger_scanner failed %s: not queued *f%ldP*f%ldQ*f%ldX*f%ldY*a%dR*a%dS*a0T*a0I*a3T*a0I*a4T*a1I*a5T*a1I*u2T*a%dG*a%dL*a%dKscanjet_set_window%s: interrogate write failed %s: interrogate read failed %s: bad data returned *s1025E*s1024E*s1026Escanjet_compute_sizesuk %s: unknown device %s: already open safteSAF-TEsafte_match %s: unable to read enclosure configuration %s: unable to register update task fan%dpsu%ddoorlockalarmtemp%dsafte_read_configsesDell %s: unable to read enclosure configuration %s: unable to register update task ses_attachpsu%dfan%dtemp%d%s: error in sensor data dmaledma[%s at %s] offset 0x%xespdmacable-selectiontpeauiburst-sizes: rev 0esc11+2fasunknown (0x%x) nameesp%s: line %d: CSR = 0x%lx /usr/src/sys/arch/sparc/compile/GENERIC/../../../../arch/sparc/dev/dma.cR_PEND%s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address%s: intr: addr %p, csr %b bINTbERRfDRAININGbIENbSLVERRbRSTbWRITEb ENDMAb ENCNTbTCDSBL_CSR_DRNbDSBL_SCSI_DRNfBURSTbTWOCYCLEbFASTERbTCIDISbENNXTbDMAONbALOADEDbNALOADED%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d lebuffer[%s at %s] offset 0x%xburst-sizes: %dK memory nameqec%s at %s offset 0x%x#channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameranges%s: PROM ranges too large: %d %s: reset failed. be: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s %s: device timeout %s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting %s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid tcvr type %s: invalid packet size %d; dropping %s: bmcr reset failed %s: bmcr unisolate failed qe: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s %s: device timeout %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... %s: invalid packet size %d; dropping hmeSUNW,hmeSUNW,qfe: expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe%s: stop failed %s: device timeout %s: burst size unknown %s: setting rxreg->cfg failed. %s: reset tx failed %s: reset rx failed %s: link status changed %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP%s: invalid packet size %d; dropping %s: mii_write failed %s: mii_read failed SUNW,fasptscII: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency: expected 2 register spaces, found %d : could not allocate dma softc : could not map DMA registers burst-sizes: could not map SCSI core registers dma espattach: no dma foundespaudioamd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" audio: expected 1 interrupt, got %d pri %d, softpri %d mulawmicvolumespeakerheadphonesmonitorsourceoutputinputsoutputsrecordaudiocsSUNW,CS4231: expected 1 interrupt, got %d : expected 1 register set, got %d burst-sizes pri %d %s: error interrupt %s: timeout waiting for reset mulawalawslinear_leulinearslinear_beslinearulinear_leulinear_beadpcm%s: timeout committing fspb %s: timeout committing cdf %s: timeout waiting for !mce %s: timeout waiting for autocalibration micvolumedaclinecdmonitoroutputmuteonoffrecordsourcespeakerheadphonesinputsoutputs%s: attempt to free rogue pointer cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %p %s: trigger_input: already running %s: trigger_input: bad addr: %p depthwidthheightlinebytesfb_setsize: inappropriate bustypestdscreen-#rowsscreen-#columnsvm_map_lock_read: intrsafe mapwsdisplaydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsdisplay.cscrdata->nscreens > 0%s: screen %d-%d added (%s, %s emulation) wsdisplay_forceclose: bad screen%s: screen %d deleted wsdisplay at %swsdisplay_console_inittedwsdisplay_console_device == NULL: console (%s, %s emulation), using %s !wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplaytty() on ctl devicesc != NULLwsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wswaitwsmoused_sleep   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000wscons: copybuffer memory malloc failed vt100 x! P!%D diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_vt100.cedp->console == 1wsemul_vt100_output_c0c1: ESC in kernel output ignored edp->tabs != 0wsemul_vt100_output: kernel output, not consolewsemul_vt100: invalid state %d[>24;20;0cdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_vt100_subr.cedp->tabs != 0P2$u%s%d/\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_csiwsemul_vt100_handle_dcs: bad type %d  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%%$ $ $ $ $ %%% %%<%%$%4%,%"d"e"`  "% "# #!%## # #  ""#*"d"`"e"+"4"""""<"C!!"a"""")"*"'"("!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_vt100_chars.cnrc < sizeof(nrctable) / sizeof(nrctable[0])[34~[33~[32~[31~[29~[28~[26~[25~[24~[23~[21~[20~[19~[18~[17~[15~[14~[13~[12~[11~OSOROQOPOyOxOwOvOuOtOsOrOqOpOIOMOjOkOlOmOnOo[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCvm_map_lock_read: intrsafe mapwsevent_init: already initialized wsevent_fini: already invoked wsevent_readvm_map_lock_read: intrsafe mapwskbdwskbd at %scannot load keymapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wskbd.cwskbd_console_inittedwskbd_console_device == NULL: console keyboard, using %s !wskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach wskbd_input: evar->q=NULL %s: event queue overflow wskbdread: evp == NULL %s: connecting to %s %s: disconnecting from %s ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrysun!\l!]!hL!j!m!ndiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_sun.cedp->console == 1wsemul_sun_output_lowchars: ESC in kernel output ignored wsemul_sun_output: kernel output, not consolewsemul_sun: invalid state %d888rasops_init: font table is empty rasops_init: couldn't lock font rasops_init: fontwidth assumptions botched!rasops_mapchar: no font selected????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not lockedagtenPFU,agamodel: model %si128_fb_physaddri128_fb_sizep9100_reg_physaddrffb_depthffb_widthffb_height, %dx%d, depth %d bwtwobwtwo/p4model: %s, %dx%d cgeight: cgeight/p4, %dx%dcgfour: cgfour/p4, %dx%d cgfourteen: expected %x bytes of control registers, got %x : expected %d registers, got %d : expected 1 interrupt, got %d : model%s, %dMB, rev %d.%d, %dx%d %s: unknown interrupt cause, msr=%x cgsixSUNW,cgsixcgsix/p4modelcgsix on mainbus? : %s, %dx%d, rev %d cgthreecgRDImodel: %s, %dx%d cgtwelve: %smodeldev_id (%s) %s: %dx%ducoderev, microcode rev. %scgtwocgtwoattach: impossible bustype: %s, %dx%d cgtwo_getcmapcgtwo_putcmapmgxSMSI,mgx: %smodel %s: expected %d registers, got %d fb_size %s: expected at least %d bytes of vram, but card only provides %d , %dx%d pninekp9000: expected %d registers, got only %d : bt445 did not attach previously : rev %x, %dx%d btchambt445: id 0x%x, revision 0x%x pnozzp9100: expected %d registers, got only %d : unknown color depth code 0x%x, assuming 8 %s: rev %x, %dx%d, depth %d stdout @ is my-self addr char-height %lx ! addr char-width %lx ! addr font-base %lx !p9100_romfontp9100_pick_romfontrfxRasterFLEXRasterFLEX-TV: %s %s: no SBus registers! configuration, unknown %d bytes conf. structure, revision %d, %dx%d rfx_putcmaptcxSUNW,tcx: expected %d registers, got %d tcx-8-bitmodel: %s %s: %dx%d, id %d, rev %d, sense %d tvtwoPGI,tvtwoPGI,tvthree: %smodel, revision %s revision%s: old-style boards with %d registers are not supported %s: please report this to freqcodehresvres%s: %dx%d vigravs10vs11vs12model: %s %s: expected %d registers, got %dVIGRA,vs11, %dx%d zxSUNW,leomodel: %swidthheight, %dx%d %s: zx_cross_wait: timed out %s: lost carrier on UTP port, switching to AUI port %s: lost carrier on AUI port, switching to UTP port sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundaryUnknown3e/vmeonboardmultibus/vmeieie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s %s: device timeout %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions %s: receive descriptors out of sync at %d %s: tbuf overflow %s: reset %s: abort commands timed out %s: disable commands timed out %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: multicast address setup command failed %s: configure command failed %s: individual address setup command failed xdcxdxddummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xdnfreexdsubwaitxdcmd nfreexdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq%s: off-line: %s xdc_reset%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE xdc_start%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout xdc_tickSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatal VMEDMA errorVMEbus errorDrive faultedHeader error/cylinderHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown errorxycxyxydummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xyc_cmd%s: stole control iopb xyc_startbuf null buf%s: warning: out of DVMA space xyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq%s: off-line: %s xyc_reset%s: soft reset %s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]%s: watchdog timeout Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown errorsiswsi_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p si_minphys len = 0x%x. si_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC si_reset_adapter si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO si_dma_free: no DMA handlesi_dma_free: free while in progress%s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d sw: DMA error, csr=0x%x, reset sw: short transfer Polled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sxA'W COPYRIGHT 1991,1992,1993,1994 QLOGIC CORPORATION ISP1000 Firmware Version 01.37 Customer No. 15 Product No. 00 $   qp \ pISpP p p?p 10 y8xc/   @B bxx xxO 85 xxx i8@h< !xh(hh hhhh#hh' i:  h hhhj-  i;  h? h2h7 h @hhdpx xdx1xGx62 ppxxxxx4xMx22xxxxp  p  z zp@xxVxU 8h!Ux'xx 8o!e@C 8j!!! `xOx> 8o 8i! @S @xx| a`@^|ppppp 8yn.. HW2 &cl{z 8yetrq @xsrq @p a` P @|qxp@x A A Sxppzxxxx ppISpP p p?p yx 10 Y )W Qp ar P @xUqrsp 10@psr Q I] ApO Ik Awpp qWpp@kp   B J &Sxp @kHk&Sxp &Sxqp! rxp%ppxprstprstҠ@xr@xx @xzz{~|vxxxxxxprstprst֠@܀x@xx @xz{|xxxxxx 8Y! rx 8A! x 8B! x a8@a bx 8E! x 8F! x 8G! x 8H! xyz xqā:jh@#kx$k xwxX kj 'x xHF a; `<F<xN   xS{zyx xwxX ijk xqġxxqġ 8A"~!xxq  "@pxxآ~ 8B"!~xxd2K a8@a bp`p`x a8@ap`xq  (@  2@  < a8@`~a#xx6xqġ 8G"!~xxqġ 8H"~!xxqrȡע!yx "z xxqā: rh~&@@@"" j @)@/@@@@@<xx@xx@r̂@rh@r a8@a(@Y2@_<@edHoxiPHoxiCHoqqrxj hhk qxwxX jk phph'x 85" p xqrs̡xxwxX jj 'xwxX jj h@xI 'xwxX jj h@xI 'xw A I Q xe 'jxwrswrsxh@'x x |  @x xww A! I Q xe a8@`g`xxI |wwwwƧ a8@``gxxI  A! I Q xeph>8< |xl 9 A! I QxX h i 8U?8?U ih0@@hK hH@pxyhK hH@px px y8x a8@```xxhh hF |xxx0qqyJ|tsrtsr y8 @x5@x@x>x` x 8h  # " $   , .%0~x1eeff``xI |p@xqpyxqq!hx ii -h p@x!p@pxqrs!!y/F[]_p@qrsxBp@pppwqx 1a&$0$"F3H 1aHx:x:x:UUwxX h0  'xwxX j4 'xw~ rȂxX l0j2 8''$xw~ rxX l4j6 8'$xy`qqġybxy`qxyTqqyVyXqqyZy\qqy^xyTqyXqy\qxp @pppqrs 0` Sx ppqp q p|p @pp pqrs 0x ppp  p 2q 2,Sp|xPe@=,xR c|~ y8xP b,xR| ]zR r@U/  xL | ;|xX)h**h.h i 8O! h@ ``h~ x ~he@`hxxx+'hhx+'ii |e@`` x>!x|`  @h(`h,`|~ q8@p@ʠ8- pB|~ q8@ 8r@!H!Ӂ!tB|xX hxe@/x,x`e@/` `,( 8O @/h` `hhxdx `d,h%`x`` xx+'hh | 9 A! I Q xe8:?8?: |h\ a`\xx]|@cxyeuw}uuuuuuuuxx0 x x xx0 x  8," x  xx0  xp a` @|,`, cxdxfxhyj@,xyn| ~ a8h- k`d`f`haj@-xanx+A |x@ ~`e@x `x>|xle@ xdxf,xnxj |xMytprТ"x@MxhM @xMx5@Mz|{x@! x$ @x@Dx>xxM xxxx xMxx`yN|VeVVVV 9xx``x`xx|x@lxVx`x`@x@xxxx|xxVxx|x@xVxg  `@  @ 9  @xxX- h+h/hh - h pxĂ@ xx>|xm,xx`x,h`x-`x`xxxxx `|.%0a`a@~x1eeff``gxX h@4 x x xxx` ;`"jh HJ@J 9xx, he@RaiVi!``hhxx h@@v@h x~~i0!h2i4i: xI xx|`` x xe@`x`xxx|ypxt xvpx@xh @|h )xle@x@~xą(x@ @| {yrpԢ"# |H | | q p?pr?? q@ x z{ `$@ @x@1xx? xxxx x?xxyx <xp֠ q | 8h ~ y 8@!b 8!bx0bbxD|~ # q8@ y 0^ +#@|x##S3xox xx pxpxpbxxxCxSx pG8pC | " x|  px" |  px¢! |  pxӡ" | "ϡ | ~ a`bc |" ~ a``` |" ~ a`` ` | ~ a``b `c  | ~~h@e a\xm@S a[ ~xm@? `p=x2xe[ q8@p``q` pxDxa q8@``q` pxD xg   |,@ `` ``x`xn| 8A"  ;"@ !!"|~h䠌 @堄`:p q@塌q~aap  @! x x pppp~aa!p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@|0"x礜P"xy'!"Q"w$''((()bM7 'f7x  |pp?p0@Kp3 p\pyV^l^xx Fx&jpx9x/px~xxx x`xx[ x& ppp38px9x/qx~xxyxx`xx[ x& ppp38px9x/qx~xxyx qyx x`xx[ x& ppp38px9xx/9p hxox/,Phxn A xAx/9xp\ hox/,P`` hx 1 Ax0K x, t@@28 0qD*H) 8!de?!#qFpp?x9v@8qD&x.qF%h%Xu>,P`<p2~ / p"x"hhhh#x-ڠ-y"#"###--#--$$---$x禄@# x:xx9h@#hx/xii#3h#;h#+h@#xXx9@#;xXx9`@#@##Ix#c~Znxtzyx#V?k!hk"h@@#k~Znp#xx1x3exgx9x4jilk"@#""!|{##@~Znxgx9xg"#x3vx9x3x9xjx9xXx9xx$ i@#ši ~pH ````` x#@#i ~pH ````` ,H @#x/ x,X@#x`(x~X~Z#xUx9xix9~X$xXx9xjx9x-x- y@$xx$-#| @$%H$%x$'x#$z$'x$ $#@$=H$=x$#@$hh~X 0~Z`` ~pH `` ,H @$ax/ x-=x$p ~pH `` ,H @#x/ x,X@#x`(x~Z$xUx9xix9zx$#@$H$x$-x-x-x-xx@$xzx-y$-+-,آ$xx-xix9$xx. xix9P$x#y$$%%@$x p:py$$$$''L&$$x禄$x1M@%xh@%W%`` x*@%Wx+x1Mx%>(%Wx1M`` x+4`@%>`@%4@%4`x%>h(hx%`0@%.`` h@AhhpT ~ `h` `h-%T``xA~x&hh'o@%%%t`@%txzh.j*:"%x%" @%h%x&xA@%@Aih@%p8hix+ x+%`` h%x+x%pT `h`xxAH%x"y%%%%%xp@%x-xixjx9xxy@%x-xjx9hh&x-x& @&xx. xix9x/x0&&y||`&&h/h+x&&5hH5&5x1M| @&_xЀ&Cx4xx4y@@&Mh/h+x&2hH5@&Gp8&Yyzi.j*x&2@@&ih/h+x&2hH5@&cp8&uyzxЀ&|?i.j*!&x&2x4|@&`` hj(i,j:i>h+h/h3 hh py&&&&&&&&&xh&x+x&pT,P `h`*` !8W$@& x&-" k|wx.x/`@& ~ \ h  !\  x!j@&~ ![~  x!j@& p&x&8&xAx+ x+h'xox4J~!G@'x'/ ~h:`` x/kh@'9i ih@'@h !8Wh "j8ip2"y)-)))-xp)x+x1Mp4` x)p@)p \ hp>p2"y))))))xx. xix9p)x+x1Mp4` x)p@)pzx| i\--qV h@)h@* hx)p \ hp>p2~ / p*x)jhhh#n~Zh @*mx.x*mp*$x+x1Mp4` x*)p@*pzx|yy[--qV h@*Hh@*ahx*;p \ hp>p2~ / p*Yx*Rjhhh#n~Zh @*mx-~Xx*m~: `pJ`pN`pR`@*klih*{{||ަ~Zx3vx*h!#$@*{{||h~Zx3x/ j@* i ~Zy-p>: Hx9` @*̀`"`` p`&|x1Mhhh@hpy****+****xx+ x+xxAppy*********y pxAhx'h+ ``|x+'`@++x``` |x+4`@+&`|~~ 8.!@+1 |~~ 8/!@+> |~~ 80! |~~ 8/! |~~~ 8.! 8/#  80|x/hx+x/hx+x/hx+wx/q[-- h+xAhr@+hx+h hpx+ h+x+x+hh xxA-}~ii@, i@+H+@+ 1++x.@+x,x+x.O ~)```x, ii~X~Z+xUx9xix9 ~)```x, ~X,xXx9xjx9 ~pH `a@,KbH,@, &,$"0bp(,4,: x,: ,:  ",?"(x.S++x.@,Kx,x,Ox.Ox,xXxZ xix9 ~)``,r@,l,la | 2 x,bp(,, x, ,  cH,@, xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |-zii@-i-x-cx,ȩ x/ x,X@-x`(x~X~Z- xUx9xix9~X-xXx9xjx9-%@-/qH! -/ x.Ax-cx,xXxZxix9 ~~)``  -S-Qax-` xxxzhh | ~pH `@-k @`xxx`x`` |~p@-x-x-֦ @-x@@-x@-{?-@--@-Ҡx4xx4yx-֦@@-x-?-Ҧ~Zyz -Ƣyyzzx4xgx2x9xgx9xjx9x. xix9x-xix9h#x.i ih@-hxix9 x.  x. x.  x.  x. xx~Z|~?;;: y@./x```88y@@.?x```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 8F (@.} !.  x. !/  d$@. #p.x.|~ 8F"2H.@. !.   2x.(@. !.  x. !/  d"@.H.̄ #p.x.|d.xpx x전@.$. !x.$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| ;|yzxЀ/%?|~ y 8@ !y/5/g/?/?/?/?/?/=/=xxKxH/AxKxH/Hh@hxX@xZx0/g/gh /exx/gx | ~h:` /a@/`/`~ii  @/! x/ x/ ````~ii!` ` ` |xjx9xix9xXx9xUx9xx9xx9xx9xx9xx9xx9pxFx9~x0/xx x전!@/xx |xx |x0@00 x|xx x전!@00x~xx |p@0. ~-`/hx-x,h hxX?hh/h+xKx!̠ @!x전@!!x- ~h: ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I1Mprr p@1_x1dp |p1q1qx2.x1ip @1p1p1p@11ipx1@1x31@1ix1p |d$@1,p 91'hh 0h)!@18'1pu@1 91x1| ~ " y8 qp pp q p pp Ix | I1p2pqp1䡄0@101p2p 2q 21x2hppp2 pqH2xp I|~~~~ "qx2. |r!qp 2p 2p y2H2R2b2p2b222p2xp2[ Ix2_x32[x|p2ix2mx32ix|px1x/+h@2}h|xxx2rqp (x@2xx2x2',X`c ""c!$@22 +`x2+`1=,holkpx1|8'2`@2 ` 91Q@2p| Q|P9'2 91`d2-`|~ ~ " h `hklW1~ h@@2~ yxX@@33pp3p@3x$3!x3^,X'``~p`p !3N@3N3Nppvpx`p`pb $pb#pvp+`x2x3`x33^ |~ ~ " pp3lp |~ ~ "  I3vpp3~ h@@3h$@3 P 91-`x33 |~~~ ~ " ~ h@@3 I3h$U@3-p.` 91'hh "hH3ՊQ3x8'3pu `@3 91x3" i $"i#3x q x3 |p@4'!p!p!p!p~ yxX@@44vpx2|~~ ~ " I4 q4*h$@4:x1dx4:q42x2.x4pq44x2.p4p4p I |~~~~ ~ "  I4J 1p h&ppp@4hSpp4j Ip |~~ ~ "  I4yh `hklW1~pp4,X'``p`pppvp 1 4qp 4 H4x2pklp Ip | 4Ѣ4̀|~ @44H444x4#4~2 |~2x45c `x x"5[x$x" 84!5  ~?x/ `d5 i8@h@58@58h0 @58!@58 @6@ a;  `<@5N`>5N`@5N~xIp5Tx5> @5[ x5>x5xx5fx5x7 |x<x>5wx@x>xH@5wxJ5wxI|x4x65x8x6 xD5 xF[ @ e@5` @5`"@5`,@x5|x(x*5x,x*x05 x2;#@5ˢ "@5À 5# xI| i8@h@5h<@6@goxXh 6= 8+!@5`#x6=h!``?````` BgoxXh@6hhh h6xh`/`+,hx i8@gh xD A! I Q0xe 85"j>86" 8+  8, i8@h | 8O!d ix`hX?``H``/`+h0@@6|hK hH@6ip6ix6`hK hH@6vp6vx6m p6|x6xhh hF 8h xLxJ | y8x6x6x6x6x6 83 84 x3xGxK|  8F"<@6 {*{.| 0 8F"2@6 9"<@6 '{6{:|  8F"<@6  "2@6  {>{B| / 8F"2@6 9q"<@6 &&{"{&|  8F"<@6 ~ 81# 82# | 81! 7U 82! 81 83!7  ;"#@7U"@7@@7@@7@@7@ 7U #  !~ xI|nPTI,ptispptispSUNW,ispQLGC,isp: expected 1 interrupt, got %d clock-frequencyispPTI,ispISR 0x%x SEMA 0x%x%s: cannot allocate request queue %s: could not mapin request queue %s: cannot allocate result queue %s: could not mapin result queue %s: kdma handle already allocated%s: Request Queue Overflow++ %s: kdma handle not already allocatedfpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_addfpu_explodefpu_ftosfpu_implodefpu_rightshift 1fpu_rightshift 2/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertiestwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecdbootpath_fakebootpath: /%s%x/%s@%x,%x:%c WARNING: %s map is bogus, using default sd-targetscpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configuredPROM sync command%d%s at %s %saddr 0x%xiono PROM root devicenameproperty lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intrinterrupts%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector romprop*3p*3x*6led*7*7*7*7x*5x*7p*7X*7P*7@*78*7(*7virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error*3*5x*7*7*7*7p*7P*7@*78*7(eccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsfindzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%dpre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d getpropintsearch_prom: null nodeiommuWARNING: opennode not valid on sun4! %s ' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !romgetcursoraddrPROM exit failedPROM boot failedraidrdstxdsdxyuse one of: %s[a-p] %sparsedisk%s%dsetroot: device name too longroot device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right setroot %cconfig_attach: device name too longgetdevunitcache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent vm_map_lock_read: intrsafe mapfp align without being the FP owning processfixalignin4_cksumstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsAsync registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAnmisoftintrclockprofintr_establish: level (%d) > block (%d)intr_establish: strange block level: %dintr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xsetrunqueueremrunqueuevm_map_lock_read: intrsafe mapreal mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cachestartup: can not steal dvma mapunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %ld using %d buffers containing %d bytes of memory WARNING: not updating battery clock attempting to power down... power-offWARNING: powerdown failed! halted rebooting dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @0x%x:%d device bad device not ready area improper i/o error succeeded error %d Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p mapdev: zero sizemapiodevcurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed warning: ldcontrolb called in sun4m vm_map_lock_read: intrsafe mapmmrwmmrw: out of space in kernel_mapvm_map_lock_read: intrsafe mapVA2PA: Asked to translate unmapped VA %ppmap_page_upload: no memory?mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typeme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptesme_free: no segments in pmapctx_freepv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULLpv_syncflags: no segmentspv_unlink0pv_unlinkpv_link_4_4c: allocation failedpv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%lxpv_syncflags4m: no pte pmap: %p, va: 0x%x pv_link4m: allocation failedpmap_bootstrap: unsuitable number of segments (%d) rp->rg_segmap == NULL! pvplL1 pagetableL2/L3 pagetablepmap_release: segment list not emptypmap_release: releasing kernelpmap_rmu: no segmentspmap_rmu: no pagespmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%xpmap_protect: last segmentpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTEpmap_enter4_4c: can't fail, but didpmap_enter4m: can't fail, but didpmap_enk4m: can't enter va 0x%lx below VM_MIN_KERNEL_ADDRESSkvm_uncache: table entry not ptekvm_uncache !pg_vtrapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 insn access MMU missv8 data access MMU missv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 intwatchpointtag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b syscall cpcb/ppcbsyscall trapframesyscall nargsvm_map_lock_read: intrsafe mappagemove 2dvma_mapin: null page framedvma_mapout: extent_free failed vmapbufvmapbuf: null page framevunmapbufcpu_fork: curprocsdcddisk label read errordisk label corruptedno disk labelSunOS disk label, bad checksumi7i6i5i4i3i2i1i0l7l6l5l4l3l2l1l0o7o6o5o4o3o2o1o0g7g6g5g4g3g2g1g0wimynpcpcpsr kernel: keyboard interrupt kernel: %s trapFaulted in DDB; continuing... prom?%s(0x%x, 0x%x) at i7fpi5i4i3i2i1i0l7l6l5l4l3l2l1l0o7spo5o4o3o2o1o0g7g6g5g4g3g2g1g0fqwstateotherwincleanwincanrestorecansavecwppiltlpstatetbaticktttstatetnpctpcillegalasrfprspcasiccryxcciccfcc3fcc2fcc1fcc0pageone_writen_writesone_readn_readsfqtoifdtoifstoifdtoqfstoqfitoqfqtodfstodfitodfqtosfdtosfitosfxtoqfxtodfxtosfqtoxfdtoxfstoxfdmulqfsmuldfdivqfdivdfdivsfmulqfmuldfmulsfsubqfsubdfsubsfaddqfaddd34efaddsfsqrtqfsqrtdfsqrtsfabsqfabsdfabssfnegqfnegdfnegsfmovqfmovd4efmovsswapaswapcasxastwa8r7rprefetchaqrprprefetchldstubaldstubt2ds2dcasaldxaldshaldshldsbaldsbldswaldswstdastdstqastqsthasth6q6pstx5q5pstbastbe8e7eqepd8d7stadqdpstlddalddldqaldqlduhalduhq6p6ldxq5p5ldubaldub8e7eldfaqepeldf8d7dldaldmovrgezmovrgzmovrnzmovrlzmovrlez1jdmovrzsdivccsdivretrydoneid2dpopcudivccudivrestoresdivxudivxsavemovomovulemovugemovuemovlgmovulmovugmovuojdmovvsmovvcmovnegmovposmovcsmovccmovleumovgumovlmovgemovlemovgmovemovnemovn0jdmovasubcccsubcflushTdsmulccsmultvstvctnegtpostcstcctleutgutgetletgtetnetn0F12FtaWdumulccumulqpreturnPdUNDEFINEDmulxqdpdjmplYdrdaddcccaddcimpdep2sraxsraxornccxornimpdep1srlxsrlornccornFPop21Edsllx1DdsllandnccandnFPop1mulsccsubccsub1iT12Ttsubcctvxorccxor1iW12Wtaddcctvorccor1iP12Ptsubccandccand1iY12Ywrtaddccaddcc1id12daddfbofbulefblefbugefbgefbuefbefbnefblgfbulfblfbugfbgfbufbnap,mfbabrgezbrgzbrnzbrlzbrlexap,1lbrzap,ubvsbvcbnegbposbcsbccbleubgublbgeblebgbebnebna,mbaCdsethimilltrapncallnop undefined %s,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s] %ld[%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN), vm_map_lock_read: intrsafe map/emul/svr4vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapsvr4_readdir_callbacksvr4_readdir64_callbacksbrk: grow failed, return = %d svr4_setinfosvr4_waitsvr4_sys_statvfssvr4_sys_fstatvfssvr4_sys_fstatvfs64vm_map_lock_read: intrsafe mapsvr4 socket cookie mismatchsvr4_sock_ioctlunknownsvr4_sys_xstatsvr4_sys_lxstatsvr4_sys_fxstatsvr4_sys_stat64svr4_sys_lstat64svr4_sys_fstat640unsupportedvm_map_lock_read: intrsafe mapti_bindsvr4_stream_ti_ioctlsvr4_sys_putmsgsvr4_sys_getmsgsvr4_term_ioctlsvr4_sendsigT_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR (sparc) svr4_sysarch(%d) vm_map_lock_read: intrsafe map/emul/sunosvm_map_lock_read: intrsafe map2Kn,X  `  % K2Kn,X `%Ksunos_sys_ioctlvm_map_lock_read: intrsafe map4.2ffsnfssunos_sys_mountsunos_readdir_callback1sunos_sys_uname*lX*lH*l8*lX*l(*l@`*lX*l*k @`*lX*k*k @`*lX*k*k  @`*lX*k*k*lX*k*k @`*lX*kp*kX @`*lX*kH*k8*lX*k(*k@`*lX*k*j@`*lX*j*j*lX*j*j*lX*j*j@*j*j*jp@Magma 2+1HS SpMAGMA 2+1HS SpMagma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_SpMAGMA_Spmagmamttymbppmagma_prom %s (unsupported) clock pri %d softpri %d: %s magma_attach%s%x: fifo overflow %s%x: ring buffer overflow : %d tty%s smttydcd: %d port%s mbppdelaymbpp_sendmbpp_recvspifsttysbppSUNW,spif: expected 2 interrupts, got %d : expected %d registers, got %d revlevverosc: rev %x chiprev %x osc %sMHz stcpri %d ppcpri %d softpri %d : %d tty%s ssttycd%s-%x: ring overflow CCR: timeout : %d port%s bppSUNW,bpp: Zebra : DMA2 : Unknown type %s: draining still active (0x%08x) xboxSUNW,xboxmodel: model %schild-presentfalse: no devices write0-key ranges%s: PROM ranges too large: %d %s at %sexternal battery discharginginternal battery dischargingexternal battery charginginternal battery charginglid downexternal mouse attachedexternal keyboard attachedexternal VGA attachedexternal battery attachedinternal battery attachedmain power availabletctrluctrl: expected 1 interrupt, got %d : expected 1 register, got %d pri %d Tadpole_S3000XT %s: %s%s, %s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected return value (0x%02x) %s: command %x failed %s: (op=0x%02x): unexpected data (0x%02x) in state %d tctrl_set_glyph%s: SHUTDOWN REQUEST! %s: LOW POWER WARNING! %s: main power %s restoredremoved%s: external vga %s attacheddetachedtctrl_read_event_statustctrl_read_ext_statustctrl_belltctrl_brightnesstctrl_tfttctrl_lcdtadpole_powerdowntadpole_bellapmioctltslotts102ranges: expected %d memory ranges, got %d pri %d: %d slots pcmcia socket %d%s: slot %d still busy after 3 seconds, status 0x%x %s%s: unable to create event kthreadtslot_event%s: spurious interrupt on slot %d isr %x couldn't establish interruptstp socket %d: rev %x pcmcia%s%s: unable to create event threadstp4020_evstp4020[%d]: spurious interrupt? stp4020_iointrcouldn't establish interruptstp4020_delaySUNW,pcmcia: only %d register sets : expect 2 interrupt Sbus levels; got %d : attach: cannot map registers pri %d and %dpcmcia pcmcia_card_attach%s: error %d detaching %s (function %d) %s%s, " (manufacturer 0x%x%sproduct 0x%x)at %s function %d "pcmcia_function_init: function is enabledpcmcia_function_enable: function not initializedcard has intr handler, but no function doesfunctions have ih, but the card does notdisestablishing last function, but card has no ihchanging ih ipl, but card has no ih%s: can't alloc memory to read attributes %s: can't map memory to read attributes %s: CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx-; memspace %lx%s%lx%s%lx@; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS pcmcia_parse_cis_tupleV1-1FD605 PCMCIA EtherNet CardSVEC%s: using CIS quirks for , %s %s: couldn't establish interrupt : function enable failed : unexpected number of memory spaces %d should be 0 : unexpected number of I/O spaces %d should be 1 : can't allocate i/o space : can't map i/o space port 0x%lx/%dep_pcmcia_attach: impossible, %s:**z** ********x*h*`*X@*P*(@* ****@3*****l***H****p*h*`**P*H*@`**0*(** *** *HT**GC****** ****HT***@*p** * *h*X`CGCZ)IeI*P* *ZIZIIIIII0I0PI0**IE0**]IE0**PI I****@"***-/********h**P*H*8**  ")A**u ****@&o@o @o @  @& 3BIE0@IE0HTIE0**@IE0**IE0** I@#(01.00CFE-10CompactCard EthernetXircom8041TX-10/100-PC-Card-V2SMCcorega FEther PCC-TXDFEther PCC-TXFcoregacorega FastEther PCC-TXcorega EtherII PCC-TDcorega EtherII PCC-Tcorega Ether PCC-TDcorega Ether PCC-Tcorega K.K.PCLAI-O DATAE-CARDLINKSYSDFE-670TXDDE-650Ver 1.0EtherFast 10/100 Integrated PC Card (PCM100)Linksys10Base-EthernetCFPCMCIA LANFast EthernetETHER-C16Fast-Ethernet10/100 Ethernet CardiPortEthernet CardR01NIC-2000pGVCTAMARACK004743118001ANDCLNT-10TN1.0VFastEthernetNE2000DCN40BC EthernetCNetP/N: EEN10B Rev. 00Seiko Epson Corp.V1-1FD605 PCMCIA EtherNet CardSVECAdapterEthernetW89C926ETHERNETEN2212ACCTONEP401 Ethernet NE2000 CompatibleRPTICISV100EP400RPTI LTD.DE-660+DE-660D-LinkUE2212PCMCIADEPCM-XXDIGITALPE-200PMX AMB8002TAmbiCom Inc: unexpected I/O space configuration : unexpected number of i/o spaces %d should be 1 or 2 : can't allocate I/O space : no suitable config entry : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s%s: couldn't establish interrupt %s: can't alloc mem for enet addr %s: can't map mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Vw* ** **********p*`Pttt3V*X*H*`V*8*p*`8V*0**V*****`V***s**h**Xoo PM*@*k&h= = s qPs&! qh**l C** **aWR211PCMAllied Telesis K.K.D-Link DWL-650H 11Mbps WLAN AdapterD-Link CorporationGW-NS11H Wireless LAN PC CardPLANEXLA4111 Spectrum24 Wireless LAN PC CardSymbol TechnologiesEval-RevAPRISM 2_5 PCMCIA ADAPTERIntersilRoamAbout 802.11 DSCabletronAWP-100 Wireless PCMCIAAddtron11Mbps Wireless LAN PC CardNTT-MEVersion 01.01Wireless Card CMZ-RT-WPNECNANOSPEEDSMC2632WSMCVersion 01.02HFA384x/IEEEINTERSILWLCFL-11ISL37300PWL PCCL-11coregaWireless_LAN_PCCB-11corega_K.K.Wireless LAN PCCA-11Wireless LAN PCC-11corega K.K.: function enable failed : can't alloc i/o space : can't map io space port 0x%lx/%d%s: couldn't establish interrupt %s%s , modem: can't map modem registers pri %dpwr-on-auxio  %c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapK%  `   X,nK22Kn,X `%KCLGET: returning %x ttcompatgetflags: %x vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapsparccompat_09_sys_unamecompat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsocknamevm_map_lock_read: intrsafe mapcompat_35_sys_fhstatvm_map_lock_read: intrsafe mapOpenBSD3.9GENERIC#532 @(#)OpenBSD 3.9 (GENERIC) #532: Tue Feb 28 09:04:10 MST 2006 OpenBSD 3.9 (GENERIC) #532: Tue Feb 28 09:04:10 MST 2006 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC *sun4c compatible0 0 f8000000 15c6a0 map-pages*d'(T <<d d@@((HI5wG1vuF-|E@ @D@H  0 0    &B`&BX&BP&BH&B@&B8&B0&B(&B &B&B&B&A&A&A&A                              vSTUVWdbZ[^_`aXYj\]cmlfhkRei !"GHIJK{|}~LMNOF&'(<=>&'?@AB<=#$3*?AC+Fx+F+L+",,+L+!+++L+"l+++L+"l+++L+"l+++L+"l+++L+"l++++"h+4+H+L+"l+4+H++"h+4+H++"h+++ +"h++++"h+\+p+L+"l+\+p++"h+\+p++"h+ + ++"h+ + +$+"h++++"h+++L+"l++++"h+<+P+L+"l+++L+"l++++"h++++"h++++"h++$+L+"l++$++"h++$++"h++$++"h++$+L+"l++$++"h++$++"h++$++"h++$++"h++,+L+"l++,++"h++$+L+"b+P+d+L+"l+P+d+L+"+P+d+L+"+++P+!+++P+!+,+@+P+"&+T+h+P+"&+|++P+"&+++P+"&+++P+"&+++P+"&++0+P+"&+D+X+P+"&+++L+"++++"t+<+P++"t++++"t++++"t+,+@++"t++++"t++ ++"t+ +4++"t+H+\++"h+H+\++">+H+\++".+p+++">+p+++">++++">++++".++++".+++L+"'+$++L+"'+8+L++".+`+=++"h+`+=++">+`+=+L+"\'+`+=++".+`+=+L+"6'+++L+"l++++"h++++">++,++">++++!(++++"|y++++".++++">+++,+"h+++4+"h+++<+"h++++".+X+l+4+"h+X+l+<+"h+++4+"h+++<+"h++ +D+"h++ +L+"h+H+\++".+H+\+T+"h+H+\+\+"h+H+\++".++++".,,$++".,`,t++"|,,++".,,++".,(,<++"h,x,++".,,++".,T,h++".,,++".,,++".,D,X++".,p+>+L+",p+>+L+",p+>++">,p+>+d+"h,p+>+L+"P,p+>+L+"V,p+>++".,,+l+"h,,+t+"h,,+|+"|,,+p+"|,,+X+"|,,++"|,,++"x,,++"x,,++"x,,+d+"x,,+P+",,(++"|,,(+L+"|,<,P+P+"J,,++"|,,+|+"h,,+=++".,P,P++".,P,Q +L+",Q ,Q4+L+",QH,Q\++".,Qp,Q+L+",Q,Q+L+",Q,Q++".,Q,Q++".,RP,Rd++"h,R,R++".,S4,R++".,S`,SL++"D,Y+>d++"p,Y+>++"p,Z+>x++"p,Z+?++"h&C(&C &C&C&C&C&B&B&B&B&B&B&B&B&B&B&B&B&B&B&Bx&Bp&Bhs,KP [   $]@x= D}* $]<TPyXa^|lD&Nh&N`&NH&N@&N &d&d&d&d&dp&d`&dH&d8&d(&d&d&c&c&c&c&c&c&c&c&cx&ch&cP&c@&c(&c&b&b&b&b&b&b&bp&b`&bH&b0&b&b&a&a&a&a&a&ax&a`&aH&a0&a&a&`&`&`&`&`&`x&``&`H&`8&`(&`&_&_&_&_&_&_`&_P&_@&d&d&d&d&dp&d`&dH&d8&d(&d&d&h&d&d&c&c&c&c&c&c&c&c&cx&ch&cP&c@&c(&c&hx&b&h`&hH&a&h0&h&h&g&g&g&g&_&gx&g`&gP&g@&g(&g&g&f&f&f&f&f&f&f&f&fp&fX&fH&f8&f(&f&f&e&e&e&e&lH&o&o&o&o&q&q&qx&qp&q`&qP&qH&q@&q8&q(&q&# &%&$&0&HMQZWXL<&- =` =` =`33&-> ? @t =` =` 5    ,& =` &>&Ap&=P =` Q IP =` l  X  &4 `&8<&6# D L =` &l&&t (& &78 &8 =` }  =` > B ~  d&7  @  @&'l&'8id s      t =` ~ &5t&=&A<&9X&9& 8 a&( &6 =` =` =` =`)&(  =` =` =` =` kH =` =` =`$0 =` =` =` =` =` =` =` @ p =` =` =` =` =` =` T 4 =` =` =` =`&:&<&;h {$[      8 =` w  d GA(A =`  0C =`ӌӌӌӌӌӌӌӌӌӌ =`  &. =` =` z }   =`  &. z {P { =` =` =` =` =` |( =` =` =` =` =` =` =` =` =` @  P d   <&1 &2 &/ c a| bt  l<&< q   pqB`B =` =` =` =` =` =` =`  D X  =` 3mT *H l  z[@ z p0 < | x| y8 =` =` =` =` =`}x}}}nD~ ~\nnnopn +V+V+V+V+Z< +W,&&&&&&&&x&p&h&X&P&H&@&0& &&&&&&&&&&&&&&&x&h&X&P&@&0& &&&&&&&&&&&&x&h&X&P&@&8&(& &&&&&&&&&&&&&x&h&X&H&@&8&0&(&&&&&&&&&&&p&h&X&H&8+Y 0  = > >H+ZP+ZX+Z`+Zh+ZhdB@ +"''' ̌ +Z  8 T  '%'%'%'%'%'%'%'%'%'%'%'%'%'%x'%p'%h'%`'%X'%P'%H'%@'%8'%0'%x'%('% '%'%'%'$'$'%X'$'$ V Z _` ` c ` a d d d e q q@ qh s8 t u ttyclsttyopnttybgttyinttyout   ̠ T T 4  | , Ҁ ; ; ; ;  ; ; Ӑ T 4  | , Ҁ T  @ ; "d  , Ӑegp ; ;h(qj ӐhX Ҁ ; ; ; ;  ; ; Ӑ   $  '8+^ +^ l,4`':p ,+^+^ 0 @ hP(&ffs(ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdefT$ɐDp$ٜ@Dph$<X|Xph$<X|X          '~'@'8'('''~'~'8{{||}'p^`'~'8 +x+y\l9L,7h`Mx'\+y(+y\']\^'l4m,2+}d8`l"h+}Ug4}8l4Uq+},/JCl 90*LS8+}\+}d\@T+}<\+})<\+}l\$+}3|\+}2(t\Ҥ+}a8\ +}l֐\4+}/t\x+}7u \x+}p \)+}Xp\+}\t'+z<+} dX+}+}+}+}+}}E#(D<8Q @X,+~+~+~+~+z$+z(+z,+z0+~+~+~+~+~+~+~+~+~+~+~+~+~+~2(@AAA==(A*E@ dd%(i @@@@@@@@@++P//|+++x+T++++$+D+L+H+x+'' $'(0P'U(U0UV[T'p344p44++H+t+x+L+P'*8+(+++77776666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\( UhUUV( V(VPVxV( 8W W<WXW( WXX X\(  XXXX (  Y\YxYY( 0$Z@[[Z ( 8 ( @WWWW( H Xt[u( X `[|( h `t[p( x h\Ŝ( 00  \(р( @@ ƌ\H ( Xt[u ( `[| ( Xt[u( `[|( Z\h\( Z\\' @,0 x@1$Q'XLu @      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''+++ +&+:+F+X+j++++++ +(+P+r+++++@+b  +b+c+c4X+c`p\+cr$+cjX+cr+dw+d<+dhq+d ;+d ;+dh+e+eD H+epp+e+e!+f(+f4N,+fdj+f/x+ft8+f+g d+g@4+gl+g +g +g+h+hl+b +hH,+ht4+h ;+h0!+0+b 4+c+c+cr+dw+d<t+dh+epp+g@4+gl+g +g +hl+b 0!+p+b +ch+c+cr+dw+d<+dh +epp+g@4+glh+g +g +hl+b +h P0!8+($($($(%d+b  +b+cT +c4T+c`U`+cU+cW+cX+d\+d<IV"k}3 3 D )8 ӌ ))x!`! !!,!X!!!(!0!d!!@)x)p)h)`)X)P)H)@)8)0)() )))))))))))))))))))))))H!-!-!1!1d2d!9 !:x!@++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy)0)() )))))))))))x)p)h)`)X)P)H)@)8Boldface.iso1 + wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp++   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް+ + 2+()+`a++++++++++  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~+o+++++  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     +a?++0+@+$&+(!+P!!\!!)!Ǭ!Ȍ!<x!! )h!T!͸ d!,!)!Д! d!h!)!!׸!L!!D)!t!8!!!)!!P!,!(!)@1+$A'* + + !!!$!H)p!!!h!!L)"""p""@)@" h" " "("L)4"")h""0"x""4)p9100_romfont"*`"+",@"'"(0)"3"6p"5H"/"0 )X":";"<x"8 "8d)"@"AP"E"="=)"H"I"M"F0"FT)p"W"X)))))x"\"^)`"")x"")ƀ"L"ˤ")ph"h"И)x""0"0"h)ژ"0"h)ڠ##|####)@# #   0#N#N*5*;`*;X*;P *;H *3*;@*3*;8 ; ; ; ; ; ; ; ; ; ; ; ; ; ; ;" "L""8"" ; ; ; ; ; ; ; ; ; ; ; ; ; ;4,^0a`b|m<wvdT,T"""L""L"XL88 ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ;,| ; ; ; ; ;]`(a`gDӨ ; ; ; ;Ө ; ; ; ;Ө ; ; ; ;Ө ; ; ; ;Ө ; ; ; ;Ө ; ; ; ; ; ; ; ; ; ; ; ; ; ;L80 ;L ; ; ; ; ; ; N ; $ ; %X % &H ; & ; L##4#<#<#$ ; N# ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ;8h ; ; ; ; ; ; ; ; ; ; N ;" "L"܈"ܸ"8 ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;ք\ڴ ެ 0 ; L ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;  ; ͸ ; ˔ ; 4, ; N ;L8 ; N ; ; ; ; ; ;   @    0 ; L , \ p  ;  , ; , ; ; ; ; ; ; N ;TDT ; N ;jd ; ; ; ; ; ; ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;%% ; ;% ; ; ;%P ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;ld, 0 ; L ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;""""(" ; N ;$ ; ; ; ; ; ; ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;===== ; ; ;"h"|'0(8" ;" ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;, ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;]`(fTfgD ; N ;uu ; ; ; ; ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;|dL ;D ;#,#L ; ;# ; ; ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;  D d 0 x x!6!7!8$ ;!8 ;!? ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;%<(%?%@d%@%AX%Cl%A$ 0 ; L%J%L%L%L%M ;%N` ;%Y%\\%d%dp%]\%e%d 0 ; L%nH%nP%n`%nx%n ;%n ;%p%q ;%r%sX ; N ; P  H ; ; x ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ;^0a`kllm< ; N ;bDcpdtTl ;y ;zxD ; ; ; ; ;Ө ; ; ; ; ; N ;Ө ; ; ; ; ; N ;Ө ; ; ; ; ; N ;Ө ; ; ; ; ; N ;Ө ; ; ; ; ; N ;Ө ; ; ; ; ; N ;{{\ ; ;l  ; ; ; ; ;ֈXH ;l ; N ;08 ; ; ; N ; ; ; ; ; ; ; N ; ; ; ; ; ; ; N ; t | ; ; ;~  |` al#,#`,",#(##l*O*O*O*O*O*O*Ox*Oh*OX*OH*O8*O(*LX*LX*LX*LX*LX*O*O*N*N*N*N*N*N*N*N*Nx*Nh*NX*NH*N8*N(*N*LX*LX*N*M*LX*LX*M*M*M*M*M*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*M*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*M*Mp*M`*MP*M@*M0*M *M*L*L*L*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*LX*L*L*L*L*L*Lx*LX*L`ޭ*T0`*T0d*T0h*T0l*T0p*T.?*T0t*T0x*T0|*Tx0*Tp0*Th0*T`0*TX0*TP0*TH0*T@0*T80*T00*T(0*T 0*T0*T0*T0*T0*S0*S0*S0*S0*S0*S0*S0*S0*S0*S0*S0*S0,)*U$^*VH*V@*V8*V0*V(*V *V*V*V*V*U*U*U*U*U*U*U*U*U*U*U*U*U*U*U*U*Ux*Up*Uh*U`*UX*UP*V*V*V*V*V*V*V*V*V*V*V*V*Vx*Vh*V`*VX*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*W *VP*W*W*V*W*W*V*VP*VP*VP*VP*VP*VP*VP*VP*V*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*VP*WP*WH*W@*W8*W0*VP*W(*VP*W*W*Wp*W`*WX@*`*`*`*`*`*`*`*`*`*`*`*`*`*`*`x*`*`p*`*`h*`*``*`*`X*`*`P*`*`H*` *`@*`*`8*` *`0*`*`(*`*` *`@*`*`@*`*`@*`*`@*`*`@*`x*`@*`p*`@*`h*`@*``*`@*`X*`@*`P*`@*`H*` @*`@*`@*`8*` @*`0*`@*`(*`@*` *`*`*`$*`*`*_*` *_*` *_*`*_*`@*_*_@*_*_@*_*_ @*_*_ @*_*_ @*_*_@*_*_@*_*_@*_*_@*_*_@*_*_@*_x*_@*_p*_@*_h*_@*_`*_@*_X*_*_*`*_*`*_*` *_*` *_*` *_*`*_*`*_*`*_*`*_*`*_*`*_x*`*_p*`*_h*`*_`*`*_X*`*_P*_H *_P*_@*_8*_H *_8*_@*_0*_H *_0*_@*_(*_ *_(*_*_*_H *_*_@*_*_H *_*_@*_*_H *_*_@*_(*^ *_(*^*^*_H *^*_@*^*_H *^*_@*^*_H *^*_@*_(*^ȁ *_(*^*^*_H *^*_@*^*_H *^*_@*^*_H *^*_@*_(*^ *_(*^ *^*_H *^*_@*^*_H *^*_@ *^x*_H *^x*_@ *^p*VP(*^h*_H( *^h*_@*^`*_H *^`*_@(*^X*_H( *^X*^P(*^H*_H( *^H*^@ *^8*VP0*^0*_H0 *^0*_@*^(*_H *^(*_@0*^ *_H0 *^ *^P0*^*_H0 *^*^@ *^*VP8*^*_H8 *^*_@*^*_H *^*_@8*]*_H8 *]*^P8*]*_H8 *]*^@ *]*VP@*]*_H@ *]*_@*]*_H *]*_@@*]*]ȁ*]*] *]*]H*]*_HH *]*_@*]*VPH*]*]*]*] *]*]xP*]p*_HP *]p*_@*]h*_H *]h*_@P*]*]`*]X*]P *]X*]H*]@*]P *]@*]H*]8*]P *]8*]H*]0*]P *]0*]H*](*]P *](*]H*] *]P *] *]H*]*]P *]*]H*V*]P *V*]H*]*]P *]*]H*]*]P *]*]H*]*]P *]*]H*\*]P *\*]H*\*]P *\*]H*\*]P *\*]H*\*]P *\*]H*\*]P *\*]HX*\*_HX *\*_@*\*_H *\*_@X*]*\*\*] *\*]x`*\*_H` *\*_@*\*_H *\*_@` *\*\` *\*\` *\*\` *\*\` *\x*\` *\p*\` *\h*\` *\`*\` *\X*\` *\P*\` *\H*\` *\@*\` *\8*\` *\0*\` *\(*\` *\ *\` *\*\` *\*\` *\*\` *\x*\` *\*\` *\`*\` *\*\` *[*\` *\*\` *\*\` *[*\` *\h*\` *[*\` *\p*\` *[*\` *[*\*[*_H *[*_@h*[*_Hh *[*_@*]*VPh*[*_Hh *[*_@*[*_H *[*_@p*[*_Hp *[*_@*[*_H *[*_@p*[*[p *[*[*[*VP *[*VPx*[x*_Hx *[x*_@*[p*_H *[p*_@x$*[h*[`x*[h*_Hx(*[X*[`x*[X*_Hx,*[P*[`x *[P*_Hx4*[H*[`x*[H*_Hx8*[@*[`x*[@*_Hx<*[8*[`x*[8*_H*]*VP*[0*] *[0*]*[(*[ *[(*[*[*[ *[*[*Z*Z *Z*Z*Z*] *Z*]*Z*[ *Z*[*[0*Z *[0*Z*Z*Z *Z*Z*Z*] *Z*]*Z*[ *Z*[*Z*[ *Z*[*Z*Z *Z*Z*Z*] *Z*]*Z*[ *Z*[*Z*[ *Z*[*Z*Z *Z*Z *Zx*Zp *Zx*Zh*Z`*ZX *Z`*ZP *Zx*ZH *Zx*Z@*Z`*Z8 *Z`*Z0(*Z(*Zp( *Z(*Zh*Z *ZX *Z *ZP(*Zx*Z( *Zx*Z(*Z*Z( *Z*Y0*Y*Zp0 *Y*Zh*Y*ZX *Y*ZP0*Y*ZH0 *Y*Z@*Y*Z8 *Y*Z08*Y*Zp8 *Y*Zh*Y*ZX *Y*ZP8*Y*ZH8 *Y*Z@*Y*Z8 *Y*Z0@*Y*]@ *Y*]*Y*[ *Y*[H*Y*]H *Y*]*Y*[ *Y*[P*Y*]P *Y*]*Y*[ *Y*[X*Z*]X *Z*]*Y*[ *Y*[ *Y*Y*Y*Yxh*Yp*[ h *Yp*[*Yh*] *Yh*]h*YX*YPh *YX*YH*Y8*Y0 *Y8*Y(p*Z*Zpp *Z*Zh*Y *ZX *Y *ZP*Y*Yx *Y*Yx*Y*]x *Y*]*Y*[ *Y*[ *Y*X@*X*X`*X*X*X*X*X*X*X*X *X*X@*X*X`*X*X *X*X@*X*X`*X*X *X*X@*X*X`*X*X*Xx*X*Xp*X*Xh*X *X`*X @*XX*X `*XP*X *XH*X *X@*X *X8*X *X0*X *X(*X *X *X@*X*X`*X*X*X*X*X*X*W*X*W*X*W*X*W*X*W*X *W*X`*W*X*W*X*W*X*W*X *W*X@*W*X`*W*X -  !" _`abcxyz{|}~ZN]Y^YBYYYYY.YYYYsvr4,>$,A$f#l% q q@ qh s8 t$   =` =D A4 $lZ$$n` t v$x f$4 $d ~ d$$ &' =` =` $ =` =`$@$$$ =` =`$o0$ =` `P$ =` $P =`O T<$ =` =` T $$}$ =`$T$z  $t =` =`$ l $  g $p$ =` =` =` =` =` =` =` =` =` =` =` =`$ =` =`   $ =` =` =`$ּ$( P$ u {x   d  $$$ $$$ =` =`$$ =` =`$ =`$$ =` =` =`$ 5$L ?>$ ep > B $$ $@ $\$ =`$d$ $ =` =` @$0$h$ ~ $ =` =` =` =` =` =` =` =` =` =` =` =`$$$$  , =` =` =` =` =` =` =` =` =` =` =` =` =` =`$o$p$n =` =` =` =` =` =` =` =` =`$$ =` =` =` =` z {P { =` =` =` =` =` |($T =` @ =` =` =` =` =` =` =` =` =` $ $$,$($$ =`$x =` =`$o$pL$n $nD =` =` =` =` $L  D  &4  &6&7  &78&8< &8  &5t &6  L =` =` =`sunos#<,I#l =` =D A4 %%Z%% t v%\ f =` %) ~  =` &' =` =` $%-%+| =` =` =` =` =` =`%$ =` =` `P +8%l =`%O T<%-  =` T  =` =` =`= =`%" %l%+ =` u {x %  g&&| =`&- < =` =`33%!T> ? @t%' =` 5  %% , =`&-$ &>&Ap&=P =` % IP =` l  X  &4 `&8<&6 =` D%"T =` %,p&&t (& &78 &8 =` }  =` > B ~  d&7  @  @&'l&'8id =`      t$ ~ &5t&= =`%*%+<& =` =` =` &6 =` =` P =`%'4 %(%)@%%x kH&2&3 =`%'x%)%%'<&*t&, &+<%$ =` % 8 ep%# =` =` =` =` =`% =`  {$[%*`%$@  @@ @  !"#%/%0*lh4%:%;(*lp%I%J*lx%Up%U*mx%X%XD*m4%m%m*mD%o%o,*n%s`%s*o*p*p*p*px*pX*p@*p0*p*o*o*o%w%w*p%%,%%*s%@%p%x%%% %%8%X%(%4%%*t%% %(%p%x%%%%%%%%H%l%*vPp%%c0' c'c055$s ?/ ޸5,S,T45,T,T=,S,T4=,T,T(,UP,U(,V,VtP,V,W4U,V,W4,V,W4,V,W4*|*|*|,W,W%ڐ%%T%޴b5= V@t@<%%(%%@"%X%t%% %%.symtab.strtab.shstrtab.text.rodata.data.bss@ &!&A&[H)**^ T/,Z`,G`,4,0 .$f@&A*,Z`+pp$05 +<@M,8K0=@X,cL$|"'+@hM"#D@5X0#8+"L Լl+`\$] T5%PBDM$lY!Cm,{, @t8.@ot+ d$F( X8600#X *X7,YD+~Y+WDdv (#%|+ CT,#, | LV +b+?,Д` /8V8iHdz+z<t C l+Z!,+4 D,`(X @ <X PL%+F,%B#V tl`+@i<r _@${+~ZT0#LtT"8XD / 8X&$z t6 TCPU+te,+nTP~"70& @ 4\$\"$+c$ \_X+rx z %x85%<dJxQ$\Ph@m zEx0+$Wt+z+8+o8 hh@D.!0dX=o4MD4Z$f#vHL  DD%n`HU8 մF .40P t +z$1E@:`G0(R+~b L,l.`@w .h.P /8 @8/ 8p/ 1TD  4p ?@ !X !4 !L *  . t :# ID d o%AX y L +9` 5Td 7 +y t X + | + #!m8 5 T G%@ L#k a* t0t w .h   W, Z $8| `p # !|  D "p L 00$ ? FZ( U#,  b"D l h }+mT +$( ~X@ +Z !x\t 0C  0#, 2H  #N$ T, "+< 9 ( D%$ I+xL [. e qP< +@  KH< M %"TH !AT4 +h T q@( +Y K ! +x 3/p =8H I,L P/ P `. jd| zlH m h .` $0h  X   +\  x @dp"0-+9HF XQ%ClZ =@c.Wk#$0x#W(/ $Pn=ToPl%`l w0@ {Px#6ԤU+ <@^x,l d(v(\4dل +hD@4 @L 0 d0 7p=AlMX &T`Bl<lu+x  "\@14$L"hL(P"0 QT$3+($ \6װ A+0J,8(Z!Lm$Tzt0|@,P%DH+y\4_h< @-XhH//9 ~J%Ze l3X%+>d!hUp@ P`@ 3Tx%q+W L ($]\X59@H S04^mlv1(,Lx d%@ X$$% "4$,/$d@+g@$R|\+,cg@lz!d VT/+bh T L dpVD0/ +X  < !Tt, |3(xN|`u. "/ @Dp,԰t+P@+ A,h40X   $#{ D/Q@ ѴxH3Q#Ȍ_,f!rTz  [4 4lbp+ 0"H< <( 1%n9HB.`N+l]+JXs0f Uu  %'40,h<"Иe<P"$+h1+~G P+oHXm Blx |4 U+~NP$|5@!,, s,.p!@$-<4J+?Rp$\@e+ir`{`Dʐ!{+(  mTh Tz+\x 8l/(4+:#6XC(N3g s$\(ly08Ȱ` \<G"J$YT.}0U0+LL)!3x5V(BXRT(a0Edk! ~H*l+e%} ^LLOhhlD* (<#+$  $ҤH$T4$0+ $:,#$Cl$R+G4$^$jH$xq$$zP $ ,$ x$+GP$ qP$ I $!,$+H$$H$dp%/t %&6X%*%nx%4%= ,,%M,%_Y0%hP%y\% Ѡ%x8%Ftp% 8D%"P%.x(%~,8%%&6\l&A8&/9&=+h@&U!&a wH&x&(& @&%t&"Ct&@$&+&0=T& 0&%dph& '8' -x4'$R\4')@`$'6!@'H0'VbDH'^/'f'w'0'.'.f4 ''!P''>H'l\'D' '! ( (# @(*l`(;n $(K+M (RatD(]T(l 0(h(0(œ(0(+}(%(q\(+gl$( )5)d).<):u)Id8)S ,)[ )d\)n#\@)z! ))`)+)+WL) ֤)%) H) ) 4$*Q* Y*.F*$̰*1"*:R *DD*M Yhl*]H*h/*q+l*8l*.h$*L*+*$)T@*g8 * wt*"<*Uh */+ "ʀ$++ +' +/,#+8et+C \+L|+\e+t+ ո+$A+.+$<+P+q+++$]DD+t+ [D,/ ,),$px,7K,C%xH,Q1L4,c+rD,qH,~,`,,|,Ԝ,ތ ,̄, @--t-& \d-:(8-G ش-N+-Q%$-`! 4-o8-=-<-0$-+- (--+- x8-DP- .+ZP.$.&#pdh.@0h.V L<.^s0l.i0=,.|l(.H.+.,.p.#nh.,.4`.+d. 4/$n/8/ +/+ =x`/7 $(/Bp|/M!/[F /m -`/u1//` /0C/'//+F/8/40 ,(00&!U08 0O Ft0W0gx0r @P0~!h0 d0%d<0 w(0W| 0.0+v800G0+1"1+HL1)H12t8 1>0` 1L1` 1o#1g@1%$1+d@1#1 th1!׸1+1 d1q|1 Ȝt2p2%P2$E|2,n 2@+,2O+2[ 2s$22+V2F,2'4822jd 242+gd3i303 3't363I 83R0=03a53p 3{+D<3S 83)3+y3$}3,%43#f33R0 4 /4 4$47x 4LR4W*,$4c!GX4s/4{X4E4+4)4 %4,4<4+P4 yP4 95 X5.?5 5,+j5B+F5X"\5c,I5p P5(Tx5L85$,5D5+i5+5 _d55,S`5 6f86'D6!n6/U 6>I|6P.p6Z$T`6h"m |6t `6~#JT60%6\$6(6<L6+~6 x6.G7 $7 K4h7&+7A EL7Q$7^7m"B`p7{|7`7 U7+d7`7x7707 47+8 p8 #,88#dh89+@8D!5L8X&9X8p,)8y4D8p8c8`$8x8&@8Z848 E8 ll8T0h8RX8L8,9+H9XL99#/9, !9? 9Gh9S!9k|P9w9+\9%s`<9d 9p490`9 ilX9+L9Q`: :.:!2 :3Z$:F:PK`L:_ :p$:+:0: (4:.:p:<:0::d:01x;vPX;%`;$p@;4 ;B%H;Rq0;\CT;f+aP;sh;|4;V;H;i(;, @;& ,; | |; ;1 D; tH< < `< $<')t<9+!P >( O>0 >7|(>C,(>P0%>["$>g/"ɐ>q#> $>/ >#0P>+ 4>+?|>8d>GL> 4> (>H> Tp?(?"F0$?! ?+H?4x?Dd(?S0?\h?g+Z?xp? ?B?$L?X@?\?"H?? h?WP?%z@ l@+ 8@t@-/@4.Q @@@W%+<@@ku@@tx@Ҵ@,8@/@/@+l, @+@ @+?@+p@ A$tA!Y,A)@A3 `A=nHAK0Aa%nAkUAyQTA%A+~A4HA/ A A W`A$A \A#2AxA%]\0BNB xB -(B' lDB-EhB@2BUBd%l$Br B|#ƠBB `B(P B$B*BBLB%TB0B\ BmdC"CK0CTC(pC8\lCHpTCX$Cl.?Cx/C$C.(C!TCpCxClHCpdC (`C 8DPdD D+~D8 D@+DIDV"(0D^+^De`pDq*8BDv% D_8D,<DD&-T4D$(D+D,D)\E xE+ZEE'+E/<<E?ՈEL,AE\+Eg+ hEt.E~bEz\XE(@ E/xE+\E+rhE 4E+E+E0F,(F ;F(F*F3+G8FB ԨPF\+ Fgu(FnQHF FLF.F @F,FHF=TF!)PFJF8L G.WG+DG<G/+]G?$GOGV|PGa Gm tGzwG G+h$Gx@XG'GpDG0G+~ G |G)axGlxDH.TLH z$DH$$H2%H<+HD 4HR+r<H^+E<Hf.WHt+H~+dHlH`H.AH+ H#H+H&@H0H#H0TH"!4H+W I )I *tI',#I0I@x$IIXIQ g4I] yIh(Iu XI l I ,hI" h@IsXI+x|I ,<I"cI 0I+Iy`J <hJJ&%w\$J0'WJ8JH&8J^ ,Jj <Jv+HJr$JTlJ#FXDJ04JTJf,J(J PJ*( J0hK@|K K#0&K2H0K9+KE0=4KNmKZl$Kf Kp(K| BK 0K QxDK9K hK.K!K+hKh K%KK4L L,tL& WL2 =DlL;.LOv\LX.QLc+p8Lm 8LzJL+xlLlL&*tL.L LVt$L"0L xLKL+\M@l(M M+$M%EM3#t M>50MK MZ.M`0f@MrM~+$M ҄M`M+rM M M.?MLM/M%DN.q$N LN%$N.!hN:.<NH$|N[ Nk ´NzքTNDN dN Vl\N!tLN0!8N .hNqhpN N N0O $\4OfO%70dO5O@!(OM!@O[4OqWO+cOO+bOxpO%\O R4HOHHOLP|P!|P!dP-+ P<+}4PG!PShP`Pg%(Px$ 8PDPJP,<Pp0@PDP 4P !P ,PdQ+tQ\Q'<Q+ Q6QB004QI+~Qi-LQv+(Q{”Q @QO|DQdQ pQ,$Q0Q.A Q $QpQ*@%RR tR:R#R3~RG+R].Ri#x@R@RphR.͌R R":@RpR `R+|R޼ S S+b\S+ 0S2 S8 ˔|S@xSO/dSi""4S}FlSc`S6 PSl(S$tS+S S\S,#S%TTİT4T,XT8|TE$V 4T] H,TnT 4T.Tބ|T.f,T"NTLT @T#|U+ohU+VU+U+PU!I84U2 d8UA glUR M UYlUd!UwV(U+\DU%@U0U#k4Uy\UU"WdU+U$)V,V+cV%V? L$VQ4\LVhlVx ̄HV$V VVMV+V%3V!PVTV+V0Dt$W|W+W* \W4.W?+KxWF!HWQ0 \Wg @tWp\ W+hW! W$Hd(W lW"WL 4W'WW (`WD|X!XX X+X<$XMH X^ /H\Xi.?XqXy+bX+xX\XadX0XHXmTX dX X X(JYz$YiY$:Y4%(YB0YL+YdpYy/<Y+TY,Y008Y TY40`Y/YTY,S4Y+Y YZ0Z $Z<Z.$o<Z?%@`ZI!ٌZ\,xZm/ Zt0ZA Z ]pZ}ZsTZ+gZ$tlZ.Z (Z xL[#8[Tl[T h[*"H[6Q[Bx[N#X[XR[l!8[w NP[t[]l[<[<0[ 4[q[8D[,Q [ \ c\ @\F Wp\Q$T\e0\v0&\ ]\&( T\(l\\,'\<\ d\D]E] % ]+T](Y]7 N`]An]Tdd]\d]g% ]St0]%d ]X] `<]Hh8]+W,]& ]"t]+']+g^ 8x^^ (4^(*^;5^Q\^c$`^w^.^"X^4^9(^D^#,^+H^\H^D^._P_ _0> _/%*@_C0/0_P d_\ VPp_h&0 _v0_+l_ :t_wt_#_X|_I`_ _1P_0 ` 4`"A`. x`>.f0`M<`W&@`]`hpp@`t `{t`%ڐ,`0````0!<P`ݰt`$a(a|a% u`<a2+h a?~ <aK̄LaXaf||aq0a+a(H4a`a%)@a(,a aaOa.xaP4b+t$b b* b: `bDX8bT b]+f,br <b{,UPdbdb0db 6b#gdb+b0&bXc`c .\chc&+L$c6+ZcBX cQ$cgӸ,ct8c$8(c!/c\c0c <c 8c+WPc  c+d +4d!#rd5 xd=:PdR.?d^+di,dqXdw+`d~}8 Pd"$d!*4d+$dd8dpD8d(`Hd\$d Aeb@,e@<e |e'!H`e9XeE&eO"APeZ<ec-ev?e e ee$0eL(e,e200ff4f +f)$Mf30fDfL0fV9L (fcPfn+e$f Lf+z f f~f+DHf+}f S,fg"-dg.g*<Tg6+gG>tgR%X,g\ 0 gj Pgt"`g g#qgg zt g$gDg,g "hUXh #o ha@Xh/,ZTh5"h?FhN.h]hhm xxxhx <h8 8h/h &hh 00h`Lh+Ahtdi ,R@i !i8 iM/iX0id0fHim iv@i|i0i0i ]$Li~,iLiLi"Li@j/tj ,<j |j,j%RP j=$hjN"6pjW$jj1j~ djJ8dj+xj z$Pj,jh jXj d(jD`j8|k pk|k*0(k5kH xkR& tkdpk|88k$kn<k Xk.ƴk+r0kDk+k |kjl 8\l.hl)#Zhl2O$lC <<lQH\l_ pli <lt\l@l@8l(Xl,tl dl 8l|l#dl+ l+Lm @m$tPm'.Gm; mG0=8mYplmjC0m#|mPmtm!@mCH$m0m.q@m+Lm $n"Vn D 0nXLdn$/n3vx$nG$lnS+xnZ+$nmHn~&=(nHpn\n+$n,Tn<\n$pL<n0n+oo"J`o [o) o9+xhoG`oT *Hodhoq+oz1$o+@oV$o $Xo!oܜ$o+op%\\p hpWp!/p+/p> (pF+ pMlp_)`pmhpx)t,pp 8p0p,'p^|pp%mdXp Ҁp.p+0q0q @q.Dq q'%qC.qOxq[%Xq`+qj08qxq&pq$Ҍq+q$)Tq+q h8q0rr r+>$r%r3 OrF DrU r^0rutr4|r+r4r +8r"<rڴXrGr \0r+Zprs!@sBt,s! s-̔s6 sA`\sQ0s]Q sgDsy)cs+ss b ps4ds+s L<s$Ds$Dt tt$Dt3tC XltR" htYR(tchTtst} pXt$$t d@tnt0pt0pt+\t%$HtXpu+>xu +uP$u% tu0$u< 4uKWuTua+z,ut[@u~ Wugpu!u+$u #|duLu#XT\u( u.pu+Hu(v `dv\v,,hv3 \$(v;,) vRk|lv^ ktvn0vw/vvv%xv @v ]v0v "dxv%P|v0w +LXwB( w$4w=8XwP u\w^ 2@we@wp!w{ Zw ؔLwd|wFw%Jw#hw HwNpw\w w x #x/ x x).x:0DxK"h0xSexcQxxtRxxPxItx.xxH,x!hx0hPx$<x+ (y+C y#|y!.y2PyC`yNyZ|@y{%.y Ty+ZLy'( y+d$yyxyB8ly%m`y z Nz+cXz-!z;ϔlzK% z^kzn{dz84z*z#z\8Hzz |dz/xz.͐{+F{ H,{ \@{/+h{DK {O#d{XH{``{l<{x0;LX{+(${"L{ td{P{0{4TP{{ ,{W\{ |(4<|0|+||8\ |K ٤0|X 0|by4|kܨ<|+ZX|%,d|+~|+^| ;$|.<| t|p|+} ,R} X}#$D}8 }D$@}\"S}d+r }t Wx4}{ z }0L}w\ } @}0<}O@}0f`}+y$}}{$}4l~ D~"+~53`,~>~Q+~b׈~p~~@~,Z,~& ~P~[~.`D~x~$K~J(~+y~ ^p~. % 1`h4l=؄ J4hUz<f+o, +h+_.^%|"|D$P0 hd %$/"иl/+X:P M$`]$sp0&+y @ Hop4,*rl "p $$f.Ŝ;!N |W0dZ\r.~$p0/< <+f$Qd+=l% P \@0 +E*T6+G U b,SLlX8w\p"T 4 F   +,+h@%!TN, dZ@ܘ ,Tl: DBK[ e+ x8+DTRP J,*8Ti0|X+`(`+ zXd# 1 <= .D Rcc \m,Sdр<" +@%Hh,)%( =(%+++<10Ph: h(E,PN34 ]Cm 'pw d~.$\pDh`/N+H(/ ~%gL$3'.0+P7=D%0(NpXa2 Pm?z,Q4j@  (!H+W`Z`L> @+kD9I,Q Q!#f@z+^ "S00'`)d+g$+( d 8'5@5X$AM, TerpGDWD$^ $d%T`\|0![ 2P@+tKp 8V+g,Z8o6 X! Ό$i"eD^ /LnD@!+83 |8E2Uܠf<x!$0Gt+& . /,+PT8p! X,.4 t(B0'dOlt ٴD0'l t 3D0';t< (T$D0tB$S%L\Hjty30 /hKh >+ NH+o` .7d0/4 T,0<%,l@DQ ]7hj+yvw.Gh%,$+LT 0# U,P DY-&DH`8\@l,N U#JD^9k#Hw#(h+~p+3+Z|h0+op0%&.4dF+YD8j (w ~ a0<(( [T h\h t$N.@,p$02T? 8L($W/h+[tx+g8Gt/ $L $0d /4 0+ 8&'l43  0:TAd,O",Zn`z&T#g)htH DD @lTB4 +wh8 4,+FD% ["+dq ~%dP \  9|0(L4x.Q+8 0 ']X.OH<+C+TOEHh\Do-0(UhY!6,`#(dH@ ,P #l".h*01:+G+O s WQ a!-ny,,0$ v+hp` "L+xq /%' hd1 B MwU b hj%Js>+*PL D 44+?0@ | @<$8.Yt# L7+~P@ _`K@q!6T~88'; ddJ.D%(8[H4ih(T<+F"(1,? y F|WL8c+0(u&A<4+"8 D+L/+[L Dl0'p$Hj 1T tϼh%|#l$#<"(00dH <(% <0w,T'l8&6R BZtoi|! ̔+ |20'tL+c$0'x  {(i3 'lA+~V{Hq7T| `xLX+0 | d.̨0C%$ r,%YL5 (E.TPx^ |0iuHu(d dl ܨ&= ].Yd+\pOBj!4/P|<+FY߄ex ($$)|& < (p+L8s&l@4 ,: <G,V<d.n,@ Lx4@A|+8 < N  l+V(#d,!ДX +Z +Jl1LA.K(Q 0`Ql%$4+c4$0X"$dT0GH8@ ! P%UP0  $( 1*:,hC&3 H_!1l9dv  %)p#$ t,,"{X E$l&.4)0\2 =LAN [}n )y\ldD T" $! P4 /t4p\+>0 5  +D0RL w.M:.F U1Xj7wMx @|+c,$ 8+ @%$8, 6lH x(5.A(LZ.Hcud<t <z$4+\p PT+(+Y"i \0h0.+V00  ,Z4d1cGKV00$f Whr$(xɜ([,@X,*\#@+} ̤!H0 +a" l,P;$TL -^ 4e{r ;,d~lt-T l(T7  8!C,x,Q,($hl5tHjXSAb.^sX{" |cD ̬ Xp L< 8X)tP pp ;' 3"h:`Jd$W.^{j+u`8%+[x  , }P 0< h\ld(+T4=I+Y  _ 3$g0'|xT +@+@h `hx!t@\"T``0 |+0e`+!lP? 8J/` cnD0 h$$0)+x4$$d0 al%%TfP#y!9\ `$+DdP/?O~Pal0r4 .$0+r."܈0 lP!\+g$#P ",$<+ `9$HK0_(j+u\+80!&:z3 "D (3]  "<X$+D`- DD4 0@8I/XI,l wd t+Y+?(<4 ^ !0q+/&ApH#[8%H'%@1tDQPY+?P(h"t+$P8+T#8X4 ,&, t+_4+C l0 +xH%(# <.<<lF|U,,(cpn ̌x~s,8N+_< a%po8$t+bH ot, c@:+"\AhV cLg 1n5L|+HJ,%nX`9h(f\1\d V`<,dHH\ -P+.$QD;uxGI@V_]+Vl.L{wpl%h#p8|/h(0 0.Q+~ O0. e<##!x6X>/I%@\].eKn{4h.`+dSx H@%N`"M` P"54+eh+[).2"$AOZ k7\| Xp\H` .p LL<Hx+_8.0P G '00,(7hH0`P0P^,l }wX,YT|0P C09 4!T.`0AAOh_.<h@\y#\l\0C%(!_e xh"E( h+y. Д  @h#  Y8#+a-,#=lG+<x]+l\H ~Oh +Z~d8xdt,[  4 $$, ?",J)X N@ez t# % ی UDD4 t8+x!l+a+V) 41},B$LV&7 ,m. x`!L!]#E\7 (@.p5+f+ 206XtC,SHR"@^ @i+v-4"ܸ0 $+V+f$۬  x$4"=\+ 01Ex@J U%h!{DŒ,Rxœ#i´֐<+ !0}\%T!ǬB +J 3 P8?,QF,L0/8Z}v<Ã!TdÑ!nlä Dlì 4t÷<0?TnXE+X#%8l. < H|XPP_(_p4j|8|!Dtč(ܤĠ" |ī"8ĸ(ׂL0@ (H D&\+ ۈl3#,`> `N`lWIHlN yŊ LœXDŠ TpŰ  UX%+ ( !t4vt)+2 Tt<@xL%fd/t%'<<Ƅ,ƙ(ƪ0Ʒ%<"4c80/H h=Y+ 7=Jx$M&<0Z (8a"bl8l0(Hz njFǚ$tǫ.ǵB|$,R08q \0P03!dl+4HD+ S c.ǀj/dȁiȑ/|ȟ+h$ȴ"%p+e$f0++\ X+| mx.=W/f tv K$~Ɉ80ɛ0ɤ#K@@ɬ.q(ɴ >|ɿ$p# +~.+* _<& 6 ,C?@HQ`Y i Du"5|ʀLʈDʐ0)ʝ dPʧG(ʴ+d\,02hD`A%"D ?H,L8 DhHU48b7xdqטˁ l ˋ .8˖U0dˠ/ˬ{x˵.˽$DL8 &H%T@0#0#P` z#1lAIƀT,_:tXn $tw |@̍%Ud̘+8̧ l̯ 0̾%*`+Zt,$ ALpL" l30>SM=t`l",@\w"($͂ɐ͎"L\͕8H͢hͲqͽx#$7 + (rh )"6+[G+[(jw|z  ΅+WHΔ+f4$Σ+pά0 μ%+(('tX! y8.("/,7,?B<Q ((Y+ iw+ϊtHϗ&Aϝ"8ϬPϲ D%X@@+Pp4T, #5PL!(<)CD5dCR.DŽ\Y@4hU s&p| A4lІ$ И8Ш0?ж'xRp ۼ+_&\z$0 L+02 L8C00(L۔^PLgy s t}.ыUDј ̨,Ѫ%tѾ {xL& 8D#D4 X\+0(9XH+ R [Dc 8p+s%lH҂+DҐlқhhҪq (ҳ)pҽ$!hD BP@ "0 fT0!, :H`F)lda$TqƌD} \ӈ%ipӗ+}ӥ+a<ӵ"QD0H@h 8D45 &LH5,@7|hN.$V| b%$upԃ0lԔ%Q ԟvԫ+YԳ$LԻ\/0+\T+o@%QL"7Tm<D<h"+\/+6<I/!T  ^;0j $`sDՁՓըջ ވD+\%(+L+b$-\ "7.l : E]IkDv}<.։.M֛]< ֥m4ֱ,Qֹ$ PDU(/4T+?#^(#D~|P._tI/R& [Y$g 9|8s,؀$؎ `ؘ+جL4(+.,d, #H/+ep$>+\N/Z0 i0q} ~+ّR,<ٚ ,١"TX٪S8(ٵ @#|H "4%` D%8KH! 2TC<_+Fg{Pڇ#èژ,ڠ,|(ڰ+bdں<& 0   ?<8 +~%C(:4lQ.P\)(k*LTu$(ۅ#ۑ <dۚ$oD۩ u\۵\(ۿ0)Wt/hh!d,#\/@6w\E 8P,#<Yf+o,~ иDܓv`ܞ0ܯ"Hܺ+ D\+< >H8 "4%l{  xl*(ڰ<#$D.q,L#<T(lf xq*{ |4ݍ !4XݖHݟ 0,ݷhD0 "n Y!N, %+dl: w|G 8Q.Mels$Lދ+ޔ ޠU0PޱxL } P0+z0 DH! 0 0 80Or[ o )< ߀#TlߌHpߞ+y߮!ߺ@D@K\+D008 X<` n0h 3# F$$W _/l0 }+ |,84*\< ", D!BLlL &< .(&D9!!8G \ G d+v.U@xV @0,/+Z$p@4+9d& t %X ,*+T8+|L @ZTf ;o!]X+p(.˔ '0+@tX@ 8X8[a\ )$ P\6и IGlh]4mHy TG(h  7(4zy.a%$o0X50,@tO& |W&tTpl80,H$%$+d$G 4+\4.Z0:%\\)& X1.M=%(N/]%$fU s B\ \L$4@ 8/ Lx"0+h< 4P@ 0 +^4+@,mp7 ʌH["QtfN(0t00Qld E /h% u.%@+\%#\D-xtD%0Tߜa+rm M4u s8~++Z<$ L!6G8+\$D dDp+~0 8/OhADO )Z+?a7qB !9 P H ^`(00K%!vT E|;$-%,p4>PN+r4Y ,d 2j,px5( +P!,*~@ "/$xH+F x&TP0l;+dP.Zti+u @l,0T+|/ D  @{P4 0T V 0$$),2+_B%\J:0Q+zd$an0u+ T<l0,, 8 #Ld1Tx#`\ 6P,"L|d 0\+D8' x7.ΐ$C޼(X Lj/t# 00+F00& $P "pPlm<( 0$d,$lL/tp= J "Xa i˰ho+tXy%  Tlp0=$ּ8 @dh %Xxΰ(w+[# 20 <DE%LO xZ Lc q%aL|?pXH%ڼ\+<%N|4 Z  P$$, d:Y\xN+_<,l)v+@0 L < . +l,l $` ,# il5+d D!D4W0Gj,ls.xx/ x"U@ T 9xP08#rs $ < 0+@( $H0gD9 S( bhPoPw4 Ԅ$ zh".  pX0@t!  T=* ,$6+t?1LXXѼpj ?pu+$d ~XːL H4%`.pd).N4+;nH`I.dPh\!j4qp~|P.N( N#<,O3T0+X D  #h+p$..;TE.K%U`\!|my! t$!$( 0H w|$ N0x( D,4!8?,L__t/ dH&<4+\LDx 8 xp #$+g,+?4tDB/ JpU+DXa jOL8{%L.,%<+z( $($`%;(0),+Jt` 4(/7+CG$4`#\j Xu %'0)08t)h%H"{X   6|( {$T$!5! FLlPSÐ_& c!p|ps0\ Vh#D+<XP [``1l, є$!,Rd*ɰ?(GU(gݸr(x+Z+F5d<Xd kH3t0 O`[ -!G=RDcF`<rS|+j0"L#T <و@+~ Ѵx-d%L"!T`4$="\O&U Qd<q+DLt+ +Z$=@ +9]4++fX  v wT*.N55tA `K 20T%Q a|z+z8 t+Fx#( <H. % 60)H X,* ,5&'DI$PWTfo@py/܈ %-L/$NTT&-XLTh.&\:LEX <R+b4o*44*d "= 8+,L%n.+ D+@ D"=D<$4P1L<%tN%^%T8js`}/$nD+h$k X@u(dg0$X/$P 0# /<\>=K+Y9 p w%| <&`+G<"&!ip<Pt|>"#++P:$DEU*d e$r00ilX"l#X$&&|.Q$ 0 +p"<3+8+^HC$PM]$<p#4x2tp/x0%A$4 980jT#hl| &;ht8TWt +L.+m @%<(XI DT(f+[v < ~p4GP4$81l+d+G0  4 Z`+f$ 70)L, `5I޸<Z#jDL~ 98000+P,+}+y Pp \pbH;H/ =%DpR4f#dy ,g +  $d"M0M|++4  .(&"p0+B+]Ja[.jw HtT3($\"8p !<d< "  +D("Q,%i2&@=,PFHRb m 8z+$+x.bvXY ;7 %dh"p /(*\`:W(R/^LDm\|vS0D+ wPll<<08W D)h4Md8 V(( +Y "(x .H4 C R-h  a D n 8 ~\  H M  &\ Ox ,Z0 Il8 !^  (& 6 FK S+J g+A<p t`H | =$ x8 #XL  RhD   VTh .R / @T |( @  ,&>< F. V ] }$8 ( L blL %e (d* p %v<  $ 0)P uL  + |< ; @ L ft U c c Ph ka` v!   Y 0  . 0 +$ , 4 pT +D\ )/ 8˸ J\ Q+  ]0  gH p  +x C  H i `(8 X\( epL , @ ,%)%p.4&.0 ? OxZ/ d l+8@t+y(4| +p@a ,+px2`%hdT/5ـ,%!45/(A.Nt^8m*}0+8/$t ^,R8+b P )l$h7P@&8<TS/` d@jL::h,D00  ,%l$Ƥ, E\ 8CH((": GR.q0Y@dg%8v +d]h<!L TP +@ l% $ ,85(6G0T.a>|t48 {.P!(*0D.U $ @t  </# uP+^=.hG0)T`p,k9H~+,R8($ (#0)Xwax޸((!p4,ZT@HL%UpDV '|_#͌lnw8X0.0 Y\ 8N ( < +fd$k|\h !!8$+ : pPI+O%gRtY$ l4p4l `%hM;4  a`44*608J Y `,T4\{+D@h+,"80 # (R`X/+H8 B _\O+[$h v3{0<(|  D#%sX|`zK8!x+x#64ItRt`!to}d,+P\X+@+z4y<,8c,(+VX#5hL.# = /C BTK2W%m,a?$qaX ;hL14C| \ f /.x&9T}4 / 0|:$IDKXX+oP^8k.δ${0 d 4$4   X+_Dk$+#<θLL' 1`?xO0h PsW\H\   vl.D*#,6M+p0  T0 U$~\`1 d?Ҭ M& <U+r@a VXp10` t<<j %xh($g,0@ H$. p*D2kh(=HK% W00He$uI q( ^T&20 $U` .ZL/ :*ެ,X lP#+=(:%<GT h$Du+z+.b\0:UX l z\:T+ 0) 6H|AP La+rzfX l/ %l>p%`` <| P\"lL & 0 #`X  8 (H 25  G!d [0 dx nd {8 \L ` x j| }0, Z 0 ]8 .T! "!l!.Oh!0+!6!B2L!L,(!V+~!_P!o$X!"P\! <@!V, !!$$!&8!.x!0)\!+<!;T4"" ;`"*$("?$#|"P+x"\!"g"u/"ˠp"R"p"!0"K0t""FTX"Dd". "+D@"ѬH"']4# pd#)p#6uH#> $#K$!X#^_P#~o8#%#.(#B8#7 #+#il#j L#9#$ +tp $"J|$" $0"L$;$L $V.@$_3<$t}4$Y$0)`$ btP$\T$$Xp$$$$ d(% 0 % BT%"8dL%'E%0ɬ%D%TT%]lH%o ,%K\P%G(%`%+hH$% ?%,I\L%% %%:<%4T%& T@&&=&* @&9ۼH&L<X&Y544&r" x&$*Xl&P&(&!\&$l& & l&0=<&;T' $x'#U$8'%X'4-'Ff'`($'r@'~R$'"8' x'T$'+a't'd'h'x'(%'+P$(4( 0GL$( Gll(#%(:[(I!,(V`(a"P(o7D(/(4T( =,( @(%( ("(:(+z0(+y) <)p)"#PX)+@L): d)G4)NT)[ t)hQX)@<)0D)z )Xd).() .)()0)h)H* 4T**#*+ *0 Z``*@$0*E0H*S D8*\.*a 8*o TL* T@*D *x*,*+t*Yd*)@*` t+ /P+ +Z+&(+' +/,$+C<D+R#/+Z +u $+T+\l+"EP++~+V++/+t+.+#,+a, x ,!O,",0!vXt,@``,T3lX,jD,w. $, h,<, , , 0p,, , ,T-L-f0-&.-34-E@(-S+>-Y-ct -t-#@-!<-!|-0`--#-! d-%|<.'P.t.$.2.Ol.=,#.F!@h$.`.j,L.v%$._D.^| .. |.y|.%<X. . QH.%/ <//%H/-0*,/94/E $|`/OeH/X </d/s 0/ t/p/%TH/J/ ah/+c/&(/+y/ @/+G@0 0#0-3P0B& 0H0W/40^$0r\(0+0TD0 Bl0%T|0 040#400.01",1 $^H1!2`d1:"81E.1d!L1r!110:11xX1 p1<H1( 1D2#h22 yL2%T21D2:d<2L*XL2Z+c$2j E2r2202+h2"T,2 l2PD2D2w2 2+x3,3 ,#30!043K $3[d3e MH3p0*03(`3#X3343%33 3!ۨH30Gp3/4/ 4 +xL 4Q<4%"04/8\4><4Rd4g4p04-P4+@4 P`42\4@4)|404f 5+L5+55&55 5C c5K/5[$<5j!H`5/,5%5D5ֈ5hh5 s5-5 d5Dd6%L606&065& 6:6AP6N |46Z%(H6o -6vp06D6P606:6dh66X60`6D7D(X7+H07#Dp72.S7?#7J0P7aY7p017Qh7x(7 7|7 (h7+9\7" @7$70*8Ihh8 \,8 8"$80R\8E.8O P(8\$8j` 8s 88}\08"=$8+L8+D8+8@8 t8+E80T9-9j P9t 9/+aT9>c0h9J"`d9W0+9f@t9r%TL9H9%w$9Op9i 9GDD9 9!:x49+L9.q4:" :H:X:+"h\>.A>+w08>* P>> k>LHx>d!d>q0 >}"ˤx>"O<>%S >?>%E>+>OX>L>V>+> (?+c`$?.? H?%<?3"N(??%\4?H$,?X)_L<?d+?uL???9(?&%<?(?"`? @p?.X?.@,@ %U4@%p@,@D@5@?Npl@MԄ@V .@\x@@f#\L @n+@y:p@%`@ j@v<@ @"h@*x@ ӌt@ A HpAIA$80A+!Ҝ0A;p`AMR(AVe@A] UAk.8A~ @A/AxtpA&A[lAʄ |A TA,'A XA HAB (0B >DB +B,"AhB; BIޘBW/BfHBs P,B}B+8 BgPB+f$B B"BlBHC0C)# C6!hCE CU.dCcMPCrDC{]$C+CrCiC C <C (C tDDDD(%TD?tDL+@ D_%XDo8Dy%$D~|(D+TDD9DrHD.DPD `D.D.<DD0+E0(HEhE *8E*!LE6$dpEI)X<EVhEe5Es ctE@E+mLEBEHE0E+p(E+(FaF.x8F"HF00+F>IFLxFT%HFd0,Fx+xF F7`F@F (F.F#]F<FHF"PF18G GhHG) tG/p|G;,@GIG\+~Gg!Gs1G!- G0G,QG(G&1GnG PH>HK<H#$n``H2,RPH;Cl$HF.XHO&+<Hd\LHy+` HJdHHl4 HlHH]0$H(S04H@H <I.\I _Id,I' 0I: IG%t IY#'8Ie |dIs#HI";IAXII&I!@HIs,I&%I(JhJ `J2J.,QJ6 XJD JS_J\.Jb% Jj T$Jx bJpJ,|Jk|JHJLlJ JuJJ x|0J#IK KY\K' K4.aKC$KTIDTKg+d`K|%'xK+XKc,K(K%޴K$|KJ\K.lK.K|dLu L +L# <L,+c$L<HDLT]L`%(Lu#LxLxD LDL|L| LgLL.L̀L+L!`M d(M" $DM.s@M@$,MHMV+M\"P(4MiH Mu%#$M+_0M!`4MM6M \MdM!M+HN lLN#N$ D N*00LN<NRNa.F Ng0"`Nt9`N/XN+N TxN8N xN 4NcNN.FN+8TOY|O ,|Oc |O&&<O:.P8OCOLެ On#IOxCXO ,O "dO$O ,,O/O"\O`O"S4O/P$pP:P&!!hxP5)PB+pP\+hpPs.P@P =`P.XP8$P, DP P,P^P%PѸtP$QB`lQvdQ+ <Q'#Q4!7\Q?/QJ+tQValQ_%4 Qe!@QlQ }HHQ/Q 88Q1xQ CQ%Q/Q 4Q#$Q bR' RpR!|(R++$R1+ R8RO޼R^hRmXR{\\R!{\0R \TR hR#qRR"LS#pxS%tS-!wS=#@SJ74hS[ HSi l`$Sy+ZhSS+rHS l S;S%(STS #Sw0Tc`T ,T"PT- <T;+TA?dTR#DTY!-x TmPT|\( T]tT"T+<T,XT T.T\ T`TgHU+DU $GU+yU S\U,+FU9UF(<UQ(U^Ut8Uq8U+lU%U+rU+[hU[tUU(U+yU A\U#s(V +V0,V,\V8+pVDI<VP <VYXVjV 'xV+ (V/V lV h(V @V,HVdW8hW#FW6dW-(W7 ,W?(WP+LW\We%$Wu W TLW+WWWPW+@W <W є XO X d4X,HX5@DX>#lXF|X^XXrxX}tpXPX YpX1|XUHX0XQ X0 PX#0Y |Y /YY#+\Y,Y5.YC",4YP!DY^XYeYp+Y+~YfY <`Y$@YDY/Y.Y TY YlHlYZ+pZ4Z', @Z/P(Z=! ZF)ZO%hZa t8Zl+~Zx DZ z Z w`ZX<Z <Z0XZ01Z?xZHZ54[ (Ԩ[[- x`[A+f[Y+][g,Z[t+[#L<[L[@[+a[2H[ [ p[+W\=\ !<\Q\(\\0L\8T\D0,\U ?tT\g  <\u (\Tt\$X\X\+}\8 \$ \;\ D]~<] t]% |]4pL]A%F]L+ ][+<]m+`]x ]+P]%۬] ]3H]#]/]' 0]Ӽ]#4]^t4]!8D^D^ /^ ՜^% ^4.^<@^F <^Uh^f ^t \^+\^$]8 ^ 4l^\^ t^0,^^=^e^/^.__|_"L8_0d_=4_P+__+[l_mKD_x@_UT_+Y_!hL$_Y(_ |X_$OP__t_+` Nd`$`,@`:'l`I h`Q4`bu|`n`~%8`%` x `Px`0` `0`3a.Fa`a ,pa&+a6+H0a>H,aP,P(a`xhak [tasTHa|  a wda a a aP Xa)a, aPaa%Lb$b( b .b&+Pb3=b@!L@bRdb]&-bp+d<$b~+b Db LbLlb+b%}4bb+b ^bDb.c!@dc2DXc4cH+`ca:cs S$`c} h@c0\c90c 8cDc+c}xc"Ic+ c$!dp,d8d$ (d3 Xd@+[pdP+W$d],di+!dqHd|!1d0d.Z\dXd!gdXPd?d.eEe /e e( e.,e?#sHeIeU.f(ed,`emuex+8e+\e+hle e 0e p0e,+De4e ӐffHf*+f4%+|fE fV+xfd0fn.a fvf f~ |f 8f+f Pf f+?f&2<f `g2x g-%lxg=#mhgV @g`%@gs+g}"4,g+W@gDg Pg!$g\gxg |g+ZxgVg h0th U <h*"^hh3,"h@"ED`hY00,h_@Hhkhhu0`h hidh.h%k04h+Lh+!h h,$h%L8h d(h#Zx4i0i|i!Ѩ4i:+~iG/ ($iPQi`ii$80hiv P<i,4iii$*i|ii!j ^Tj x@j GPj/+hjE0pPjR#Lj`.jlb<jv lj ,j($$j!pjZlj.Zx(jJl0j$s8j(j,ZTj%|k %@d`k 4lk# "h8k2 kK kVYxkjtHk Lk,k%k,#k U k8k(kDlkv\k a|k6k|l98<l0hl"Ll8 lN34l_"xxll Tlt ,l`l!@l2pl/l#{l8l/l|Tl+Ll/l(m_pmtm%$m9`xmQ,Dmb$Xmq`(m\mm \m404m0m#W\m+Dm ~hHm0,myln"$n$n$x0n2/nAsnT$nl x0n/ n+xn Pn '<Tn I,hn.n0fh nwtnHnCn!Qho lo%a`o.Alo= @oMA(oW.Soe,$,oq#&@oz|o`o'N4o&5to,o 6xho%oto(lp p.`p"}p/ `Pp8 pKu<<p\|plfpx+8p߰p|p%+tp0HpLp,p/p,$$p#7<p0p ;p&|Dq 3<qlq0#sqH!dq_Lqk%qv!q q7$q/ql4q/ q q,(q/q qhTr]rr 8r-$ r:/ rHudrV!%Dhrm<r(r`|r\r r 4r rb8TrtLs+,s&s(!s:w<\sI.@sRtds]`sg02lxsk/sw &Ls%@ssx s!8,s/s$pDs)j4s)`ds%j(tt+Z t$OLtHt, V4t5 h<tF tQHtY;tl+t ht @dt. tD t,xt0Gt+t4xt"t(t%/llu8u%/|u/դ uB#uP#ru` luk+uw%Xu u+~u, u dXu#ZDu q(u |u u@u/$v PvLv+v"+(v2+ v>MpvLvV0v^ `vn8v~Xv%P\vcdv#t$v!4v'v/v Lv xwdwPlw%0w4/w>0dwJ"bwQ֔wb/ wow{ޘ$wtDww _w.w \tw( w" w T`wTP$w8xDxhx!0 $x.Xx7+,x>ptxJsx[%4$xm<xw "x#<xx tx0,xTxdxx.PDx ,y0-y )py"\ Hy-\y7\Py? DyM%yb#pyu+Kty8Dy lyHy `Ty Symygyjy+DDy+z+[Xz/z&+z4Hz<bPzI&4z^0tzu,z{ 8z!pzz?<z0lz XPz+Cxzz |z{&3Tt{ 9T {n({+"<,{7{F X{Q)$@{]+{d V@{n {z ( { tp{+E{#l{Ө{$!L8{+p{vt{(| t| W|;|*!|8 @4|?%r|H\|TY\|g h|n+ ||0l||W| |;4|4|('|.S|^8}0t} Lh}+dL}+S}8+}Fx}U}c 4}p+}+F}o4}}{T|} {`}0x}8t}(} H~ ~x~-+>~3/~; 4~V~b$~qX~}א ~+L~Pd<~~#S~~+|~%$~| +d (#$H18+H%XM+h\+$v@(.,8,%0++% * jXD 8*|8 J޴XthbML|m0! Rt/. x d#X8 $p@+[\+(!\48 $p`+@05 dC L:@V 6 l_hk+$q} ̜0  D,-۸/0@Ph l  ,"+D42HD 0MbLZ+e0 s,X }d0d+~+8`4#s0P 1x=!!-wd7+[dE6l(V+a o l<z HOt/ h"||\L d+h$)%D4$ (J[+b$m {~+D *pNxd@ ݸ%\4 X) yx\ O  IPH$$nT48DA/W"0^.\gXt |4 p/t/+#qDP+41,)# ,|%+/$|< O01_ OPn xvb|!#<.t O4#s?tx8&4'189 EX`R_+s+F  /x/`\: LDD(hX+ 0tx * ׬7 P@V"o4 ,(+r+\ttD!\4.P $$. p9.DhhP-bPq#@` 8}dTp\ A ,(,+~+G,"%/@.PP@/HH ܔ4U.PL]+d$x\stz < πH(%l.Hl+t  .r' 5)p,A$W/ 4 `+e<v/h~ <M@!D90p @P$|pN@%!T q 'U4 x@+4x6 @FtSl[jL Xt e|P+R X+_@ `!L\,((!o4_E8Q+88[",<k v)k+DVP -,@| T,+L3XL"(" 7"3AO'2Y+c+=r0- @X wp :dp+$4 p0 A 8 ,M5+B/HT h0\%4o+@@$@0u=\l^M0l '[(74J/T^|b4n+} &  0-$x h, @<D ++] 3+\<& E2d]#m+E+~ ؄D {,( $ 8 #( DH4)VHH+[W%,l0 u ,.'xx ? H.q8,$.\+a$,+ J.`%"4/KL?'6HF.,QO [iVx+y+Y ވϘ$?$& 82%B(R!d ͸@m& $^!\ d+g 0!.^ !t Sd 8$$ 3 mL=|<GOXt`#*P|i+Zy %%Tt<('MDXGU Ұ+#! .(> HR* 8a&><{&4/  $d+eD$0hl%ی m|\d + t7@D Qd\Cen0#4{0|" .Tl Dth0< ,Y.  /]D/-dLB\L t0W p`+i+r%@0%wxDxF0T(00P@ zJ0+\ p(& u02?$P!Da hph&.4| lu2\50 Y k(ĸ8/&4 $"p`1+y:+T L ] 0q(p<~ @#d&78,U\% .<+d<8,Q@+IJ(Z00 l!@}S80fd+c!, `0  AHH| t(*/.@AJ xh4[ T`g q!B@ ΈT `"d&0#˼P#X$#\`)DCOU tD^%q!BX.PP+(. A,& <(ޢT# @t8!0l+J5l> 2,F+U&'84m+a`@x+4:tB< g ۔8&/0/0+`T+$ P! 0+, ? `O+e$]6X$kw+($TLw \DtB\D$L , +e !k`+/60.\L^i t0r |~` < =D+,P @a 0G .Dl (1!+>0?L W/it\p?+$p8 ~ 4<h+f+H Ld"+rp8 $@OD\_+0h(v+oX}4 `< H,'+,#+Fx!͸ +"W  #i ( (4,hA+0IHXS X@]Hi$z+"@ l"t_$  4Dl (0( ìH t|)25$l\C 48S&4^yX h,nV | Hx8% `: `>,0(+$6 O0|di,x+#|h"L u 0A+H.Lh%hp+z#+\6 E.S _\@z# Z , p0C/` X"R4 ,Q\xB4 H.& H:^8\M,QHU+\H^ Gk@`{plY< #~|.PT\4Tp/d P\5t 0.`' D|2/F Uwd#`u ~TL0PX9L+].$td8x+~.+LhL/ U@/'.D49 , H 4tV"`$c+Z`v8 A| R|4+P&D fX$xlV8 4P @l$H$,;P:+[|G.a$O 4[/!cr& t%h@n++x | '$ ,]\0.d g 8s<+ ;$9.LB ~N\rTg"tpDdd+e,>H!7 $7/ll !upt<d.L:hJ ]+(f!u2,p7h  *h!~ \8'd T/l+ +P0& 2T+ht$+!$M \Єld~eۤt`,x%nPWDD\ @tL&".5w| G `XRc$ m#!u!t|Vh MDdX';x+( ( 40+d$c0 1H+l^ QDm4z04 , HX$I,h+g$ 4(/ ,$<&)2I?.R|c!st}*J<T p<#\D D@+X0+,D+Fh"2OX=f@Vxg+DPyg4|8 x0$.0`+@\+dy+_ !,d*9|lFQ a l2`u ||^08 0+ .=|+8$ D J\-87`PpEJlO Yk<z0?&l.(%$)o[  V@ Plư+de8vP+x( U|8 G*`Z0h0r H,{$U| ( y0@%XD)x("I Z  8t"X',2 X@I_ po Hz#m+%I</x.Tp# qh,A  00@.  &"H"$,6WB(L.Z $\0b hHl{,(<( 4&!x0!C@+@$,Z<W< "x8, `@%3,? L.AX0`0m xt{#L Dp+WT<#-L" P<]Xt , Wl+Ph -ӌ(+;?`@Fz4U Tg ({ r(.t$z t T 4h(X L (D!&+L0DIc4 R8\0 @m8\%-8t lTT,|%<֘t  .800D+F`,"<<90W a0n)p{0 )<,Z+<+H p/< |4 l|x, Q<l. |; \dS+|\+spec_vnodeop_opv_descwi_set_nwkeytrunk_port_statepfslowtimonanouptimeuvm_map_callrandomreaduvm_page_lookup_freelistrfxmatchnfsv2_procidpf_normalize_iplongjmpp9100_ras_eraserowsimport_flownewblk_in_progressffs_vnodeop_opv_descxyc_unbusyprocfs_rwvfs_opv_descskdb_trapvfs_allocate_syncvnodepcmcia_printarpresolvedp8390_readchange_displayparamzsc_intr_hardchrtoblktblsys_minheritbridge_startsystr_policy_pleeprom_takepfkey_addrbufq_default_allocchild_returnhmewatchdogrtlabel_unrefne2000_write_mbufsearch_promfdcresultuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagesncr53c9x_scsi_cmdcopyinstrsys_getgidfpu_dtofext2fs_vnodeopv_descsdofilewritevdumpmagssmatchttyflushsys_setsockoptipcomp_inputvop_lookup_vp_offsetscomdefaultratesunkbd_setledsxfs_message_installattrpf_state_tree_lan_ext_RB_NEXTwihap_sta_disassocdefrouter_lookupinetswpowerhook_establishwdog_periodcgthree_burnerses_cdip_reassrt_maskedcopyin6addr_anyVOP_ACCESSpfr_fix_anchorip6_get_prevhdrtrunk_fail_inputscheduler_startdb_logstp4020_chip_io_unmappmap_changeprot4_4cdisk_findnsphy_cdzs_printhme_mintipmforwardingsys_closebmsafemap_pooltrunk_port_watchdogsunkbd_ioctlrtflushclone1in6_purgemkludgeffs_inode_allocnfs_receivedes_encrypt2mountlist_slocksys_setsidsvr4_sys_semsysbridge_timerax88190_init_cardudpencap_enableprefetchaudio_attach_mitcx_setcolor__ashldi3vn_statsvr4_sys_fxstatbtcham_matchvop_getattr_descunp_detachnd6_nud_hintether_ip6multicast_minsys_msggetchange_sign16_swap_bytes_be_mtsam7990_watchdog__mainsppp_lcp_downepreadxfs_emptyqufs_quota_deleteportal_mounthardclockpf_get_wscalenptesgenc_xform_aes_ctrwi_read_data_iohandle_workitem_freeblocksipsp_is_unspecifiedmyip_ifpin6_domifdetachdevopnudf_mountfsnfs_syncfilt_audioreadwskbd_cndetachdb_get_variablezs_read_datacd9660_vgetcrypto_dispatchsunkbd_setclickif_group_routechangetprintf_opensbppreadtcp_del_sackholesisp_reinitwsdisplay_burnerdest6_inputgsignaloptionsnodepf_socket_lookupfb_alloc_screenipport_firstautowi_txeofmii_mediachgcpu_hotfixipsendredirectsbpf_setifpfi_bufferunp_internalizetk_rawccevcount_intrfc_lfcemptyvfs_export_lookupif_cloners_countyieldifnetm_freemtbclosefilt_seltruesc_print_addrcgthreeattachcgfourteen_promcomspeedlogvn_writechkpmap_alloc_cpusoftdep_count_dependenciesin_ifscrubmttyioctlzskbd_rxsoftdp8390_media_initpdevnames_sizealaw_to_slinear16_be_mtsscsi_mode_select_bigroute_dstch_usergetelemstatusinit_execcarp_clonerbridge_rtdeletewskbd_cdwsemul_sun_detachsys_getdirentriesbcmpcypress_cache_enabledb_set_breakpointsnd6_dad_startmsg_freehdrexec_maxhdrszam7990_stopblf_zerokeydb_force_whitespacesvr4_to_bsd_sigsetipsec_delete_policymmmmaprasops1_initsensor_getxdc_remove_iorquvm_map_spacefitsnewblk_hashtblsetjmpaes_ctr_reinitopenpromopenxyc_e2strwsdisplay_switchproc_targetsuvm_deviceopspppioctllogread_filtopsrasops_cursorvndxfer_poolfilt_fifowriteffs_specop_ptcp6_mtudisc_callbackcopyoutstrmainbus_matchpromcngetcext2fs_fifoop_opv_descuvm_swapin_remmodule_hypersparcimport_saxldcontrolblxtphy_servicess_cdcs4231_get_propsswcr_newsessiontcp_attachsunos_sys_setsockoptwskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writesensors_countm_zeroagten_putcmapffs_specop_entriesunp_gcingpf_pull_hdrbdevswbaddynamicportssemu_listau_set_lr_valueX_db_line_at_pcuvm_mk_pclusterptsstartdomainnamesvr4_sys_unamelockinitswap_encrypt_ctlgetdirtybufttywrite_filtopsnd6_ns_outputbpfkqfilterVOP_LEASEpppoeintrpmap_rmu_pzs_init_regnfsfifo_readttyunblockmttystopremovedepfr_sinsi_dma_allocgetproplenigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2mfs_closefilt_procdetachcbq_remove_queue__divdi3amd7930_opensys_clock_settimepfr_destroy_ktablebstp_designated_port_selectionlocnamesnfs_vinvalbufdisk_busydb_breakpoint_allocpfi_initializetcp_pulloutofbandevcount_sysctlpf_anchor_global_RB_FINDsddetachtcp_signature_tdb_inputprocfs_domeminfopool_set_drain_hookmouse_copy_extend_linebe_tcvr_readxfs_dnlc_lookuparprequestsiginitxfs_has_pagepconfigbridge_clonervn_default_errorxydumpnfsrv_mkdirpf_frag_tree_RB_MINMAXsvr4_sys_socketip_sysctlsppp_ncp_checkxdc_e2strmsdosfs_vptofhscsi_mode_sense_bigffs_fifoop_opv_descsvr4_sys_nicebstp_inputtrapbasecgtwo_accessopsrasops24_putchar12setdisklabelpfr_lookup_tablenfs_disconnectdeflateknote_removemtty_catslot_create_event_threadroutedomainicmp6_errorimport_identityVOP_MKDIRrtl80x9_media_initepgetufsdirhash_recycleip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddlogpf_purge_expired_fragmentsep_pcmcia_attachep_cdpf_osfp_flushuvm_page_physgetmsdosfs_syncudf_inactivescsi_mode_sensebppclosestackgap_randomvlanattachendtrapcodeffs_clrblockgre_clone_createtcp_timer_freesackbpf_filterchgproccntpriq_getqstatsip_draindb_map_print_cmdpflogstartsoqremque__adddi3uvm_map_inheritnfsrv_initcachefifo_printinfosvr4_sys_pathconfapmopenbridge_flushrulecd9660_synccgtwo_setcolorsvr4_sys_sigaltstackin6_ifawithscopevop_inactive_descaudioreadfdc_cdnfs_rootuvm_schedulercgtwo_burnersync_printnchashvnopspool_cache_initsys_lchownmsdosfs_removecd9660_readdb_read_tokenwi_get_idzeroin_addrbmtphy_cdprocfs_startuvm_map_protectwsfont_enumprintfin6addr_nodelocal_allnodesgif_clone_destroytrunk_ether_cmdmultisched_lockxdioctlencifrandomwriteprelist_updatenfs_sigintrhmac_ipad_buffercrypto_drivers_numsppp_pap_closeinit_machclkip6_protoxsys_shmdtsys_recvfromcs4231_opensun4_hotfixswcr_freesessionttrstrtsys_sbrkpv_unlink4_4crandombt_loadcmapfdmatchzsnull_stintsysctl_doprocaudioattachkcopywsdisplayopenext2fs_inittiocm_to_zsrtfreechiptotimeagten_cdfb_pfour_burnermgxmatchcuio_getptrcd9660_linkhypersparc_get_asyncfltsbpp_rwukattachhostnamelenipcompctl_varscd9660_specop_entriesmulticast_register_ifm_tag_freegre_mobile_inputnfs_flushttyopensunos_sys_nfssvcnfsrvhashraw_ctlinputudf_printxyattachccdlookupnd6_ioctlcarp_carpdev_statexystrategyipsec_in_useipsec_exp_allocationsbpfclosedevwaitsoftdep_setup_removesys_writevsys_setprioritypfr_setflags_ktablescopywordsm_tag_prependip_defttlsppp_auth_type_namearpintralaw_to_mulawwsemul_vt100_output_scs94_percentkqueue_registercred0in_delmultipfr_ina_definetcp_signatureppoeinqnfs_fsyncuvm_forkvfs_op_descsuid_findnd6_rtrequestncr53c9x_selectuvm_km_suballocrasops_eraserowsip_mrtprotosunkbd_keydesc_esbpfdetachsys_closefromfifo_ioctltunkqfilterttydefcharssigexithidirtypagesepsetfilteruk_cdfpu_normin6mask128tcp_signature_tdb_attachdead_lookupisbaduvm_amap_poolin_pcballocVOP_LOOKUPdb_shift_exprxdclosexfs_statfspf_qid2qnameclockmatchpcred_poolenqueue_randomnessbridge_ipsecipcomp_initemul_nativeienab_bis_4_4cwskbd_inputdes3_zerokeysppp_cisco_sendsystrace_nameiswap_ctxtcgsix_ras_copyrowshypersparc_memerrnfsm_strtmbufcrypto_getfeatvop_rename_vp_offsetssys_ovadvisetctrl_read_event_statushme_poll_stopsl_compress_initlockmgr_printinformc_delete_classbufq_default_freewsemul_sun_cnattachwsdisplay_kbdholdscreenufs_quota_alloc_inode2ipcomp6_input_cbmicrouptimepnozz_cdtimerattachsb_auxio2_regsocket_poolesp_read_regnfs_realign_countpgrphashsys_setpgidaltq_enablefd_set_motorprofhzcache_enterdb_watch_tableexec_elf32_makecmdspf_osfp_insertumax_uc630_swext2fs_bufatoffsys_setlogindb_trapiommu_matchudf_statfsam7990_rinttcp_do_rfc3390xfs_ioctlsys_setresuidpfi_group_changegre_in_cksumsimple_lock_debuggersppp_attachcrypto_kinvokeauth_hash_hmac_sha2_384_96tcp_sackhole_limittrunk_rr_inputprocess_get_wcookiedp8390_debugrn_deleteberintsd_get_parmsiskmemdevstat_rush_requestsreq_clear_inodedepsccodeszs_get_speedsppp_ipcp_scrwi_watchdogpcmcia_powercarp_proto_input_cipsec_def_compfc_lmdistancecs4231_sa_hw_ifnch_poolsomaxconnip6_mrouter_veripsec_exp_timeoutsystrace_processreadyxyc_remove_iorqip_directedbcastppp_clonersystrace_fnameisp_cdfixalignbe_tcvr_writesvr4_emul_pathuihashtblpf_src_tree_RB_INSERTscsi_get_xsau_get_portaudiommapdma_cabe_tcvr_idlepfr_validate_addrfdcswintramap_initffs_flushfilesffs_blkprefetherip_allowicmp_sysctlsys_lseeksystrace_iomapdevexec_aout_prep_zmagicaudio_check_paramsoclock_capool_cache_getnprocsdes3_decryptllinfo_arpmsdosfs_pollfpu_implodepmap_enter_pdiradd_poolmsdosfs_accessaddupc_intrdvd_read_bcasunkbd_keydesc_nosb_auxregbiscam7990_copytobuf_contigwsevent_fininfs_connectip6statnfs_doioip_mrouter_setienab_bisviking_memerrvmebus_translateuvm_pageboot_allocxfs_devpollconfig_pendingpf_rm_rulemii_phy_updateswwritepfr_enqueue_addrsasync_daemonmmu_reservemon4mudf_islockedether_crc32_lenfs_numasyncrn_searchcompat_25_sys_swaponipipstatsecureleveldb_consolesvr4_sys_aclwsemul_sun_output_haveescarpt_keepbstp_topology_change_detectionencrtrequestdb_printsympcache_flushsys_seteuidvmeprintbtcham_cdwskbdpollmax_protohdrsensor_adduvm_map_checkprotmixer_opendes_is_weak_keyep_isa_mediazsops_ttyepstartesp_sysctlpfr_destroy_ktableseeprom_cabufpagesrandomkqfiltervnddkdrivertbr_dequeuebridge_outputsys_keventcopyargsarc4_reinitmi_switchcd9660_statfsrndwrite_filtopssysctl_sensorskern_sysctlcgtwo_ioctlnd6_delaypmap_enu4min_pcbinitnfssvc_addsockcompat_43_sys_recvsbppwritetdb_walknmbclust_updateie_hardware_namesfdremoveuvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTudf_getattrscsi_user_donekillprocp9100_ioctluserconf_cmdbuflinear8_to_linear16_lewi_get_pmaudio_init_recordxfs_insertdb_print_loc_and_instpf_reassemblevop_pathconf_vp_offsetscgfour_mmapamd7930_query_encodingrt_mpath_matchgatesppp_ipcp_downsensor_task_scheduleapmioctlvigra_putcmapiommu_printauxreg_cauvm_map_entry_poolcrgetsttywriteunp_bindtcp_delackcsignalreaddisklabeldb_print_cmdwskbd_set_displayvirtual_availtunopentcpstat_udivreplace_endxfs_devreadfree_msgmapsdb_break_tablencr53c9x_pollfillmapentrynfsspec_accesstcp_timer_persistssioctlnfssvc_iodrelookupwsemul_vt100_output_esc_hashsys_umaskfpu_comparesyn_cache_reaperfilt_fileattachsysenttun_lookuptcp_setpersistwsscreen_lookup_syncufs_ihashlookuppmap_extract_pread_machclkienab_bic_4_4cicmp_rediracceptapmcloseledattachvop_reclaim_descwsemul_vt100_detachdb_boot_halt_cmdsoftdep_setup_inomapdepbridge_stopisp_getrqentryip_outputptcpollbpf_mtapfdc_resetfindblknamecgsix_ras_do_cursore2fs_i_bswapnfs_reconnectmfs_vnodeop_opv_descnkmempages_maxpool_initpcmcia_card_attachbpfreadpool_putm_copym2bus_mapsysctl_structpf_statusam7990_startxdcmatchxfs_writenfs_ngetsysctl_rdstringuvn_attachlasttimefiforead_filtopscryptoclosesysctl_disklockcnkqfilterdesiredvnodespmap_redzoneufs_pollmsdosfs_readlinkp9100_setcolordes1_encryptspec_vnodeop_pxygetdisklabelukmatchlookupnchinitexec_mapdb_qualifysnprintfext2fs_readlinksoftdep_setup_blkmapdepaudioprobeether_ioctlsyscallrnd_attachedtqphy_servicesppp_state_namepf_normalize_tcpoptip6_forwardingkdb_kbd_trapanon_swap_offhme_meminitarp_allocatedrasops_isgraypfsync_bulk_updatepflogattachtslot_mem_mapslinear8_to_mulawifindex2ifnetcd9660_ioctlrt_mpath_conflictbridge_rtagepfr_dynaddr_updatein6_savemkludgein_pcbnotifyallbstp_tcn_timer_expiryfilt_audiowdetachmouse_copy_worduvm_pglistallocsyn_cache_addwsdisplay_addscreenxfs_devwriteincorehztslot_io_allocagten_setcolordefrouter_resetstart_cryptocd9660_ihashinsfreefile_poolbe_cacheckaliasdl10019_mediachangeagten_caamd7930_round_blocksizegetquotattyretypestartuphook_listsvr4_sys_fstatvfssrmmu_vcache_flush_regionrt_timer_queue_changelf_initcpu_attachuvm_km_pages_lowatrn_mpath_countssreadsd_switchfdchwintrmii_phy_matchsun4_vcache_flush_pagepninek_cdsdclosevop_poll_vp_offsetsvop_generic_kqfiltersvr4_sys_creat64tdb_freepffasttimoinitsiginfosys_getuiddb_set_cmdcgtwelve_mmapuvm_unlock_fpageqberesetexec_setup_stackgetfpxfs_getattr_commonpager_map_wanted_locknfs_clientduao_createdb_free_watchpointspfsync_update_net_tdbpfr_clean_node_maskrfx_accessopsffs_realloccgwskbd_load_keymapcs4231_round_blocksizeqe_rintcd9660_bufatoffaudioclosegroupmemberuvmspace_initether_sprintfsttyttymsdosfs_unlocksoftdep_move_dependenciesselwaitppp_bsd_compressktrnameicarp_set_addr6icmp6_mtudisc_callbacksxfs_susermodule_ms1sys_forknfs_readdirsppp_ipcp_tlfpfkeyv2_dump_walkerip_setmoptionscarp6_proto_inputpf_hash__qdivrempil_to_vmeldcontrolbspec_opencgfourteen_mmapswcr_sessionsfilt_bpfreaddb_watchpoint_freewsdisplay_emulinputuvm_fault_wirepcmcia_ccr_readsi_freexfs_inactive_commonnfs_niothreadsvm_nphyssegshmget_allocate_segmentsvr4_netattachip6_randomidproc_filtopsuvm_lock_fpageqelf32_os_pt_notetrunk_ether_purgemultifiledescopensys_vforkvop_reclaim_vp_offsetsuvm_pager_initCopybufferwinChkNamest_decide_modedvd_read_copyrightdmaprintvmi_list_slockxfs_node_purgepool_draindb_history_prevcarp_ether_delmultisppp_ipcp_TOmyip_initializedsvr4_sys_msgsystrap_typesun4_cache_enablepfkeyv2_sysctl_walkerxfs_getattrsync_vnodeop_psys_mkdirdl10019_media_finiuao_reference_lockedufs_fhtovpcrypto_donewskbd_translaterttrashbridge_brlconfpfi_fill_oldstatusmblowatrasops_rmaskgetnewvnodeufs_inactivepromcnprobend6_mmaxtriesamd7930_start_outputbe_tcvr_read_bit2sys_socketnwindowsSHA512_Lastdead_vnodeop_opv_descncr5380_wait_req_timoxdc_rqtopbsunos_sysentvop_generic_bwriteep_mii_clrbitnanotimesvr4_sys_stat64ufsspec_writedead_vnodeop_entrieslxtphy_cahme_tintiso_disklabelspoofpcmcia_cafifo_badopfdfreeepmbufemptywsemul_sun_scrollupipcomp_zeroizesppp_get_ip_addrstty_countsvr4_sys_faclie_setupramdmaattachfindnodemkdirlisthddeflate_globalraw_disconnectipsp_pending_acquireipsec_ipcomp_default_levelsensor_task_registerticket_altqs_inactivesvr4_delete_socketbrelvpauth_hash_hmac_sha2_512_96msdosfs_mountfszstty_attachpfr_match_addrvigra_getcmapwi_stopip6_sprintfsync_fsyncvop_setattr_vp_offsetssetstatclockratecd9660_strategypf_init_thresholduserconf_parseip6_keepfaithsys_msgrcvqec_resetext2fs_alloccheck_inode_unwrittenusercryptowskbd_deliver_eventcompat_43_sys_getrlimitdb_eregscom_fifo_probest_loadfdcopyrmc_get_weightlkmopenemul_findsystrace_msg_ugidqeintrb_to_qxfs_removeled_blinkred_getstatsxd_cdudp_sendspacenfs_mknodSHA1Updateifg_headvfs_rootmountallocrw_initcd9660_openwsemul_vt100_output_dcsuvmcnt_dumpnfsrv_wakenfsdpf_frag_tree_RB_REMOVE_COLORxboxmatchip6_mforwardsoftdep_setup_allocindir_metabsdi_sihme_mii_writecmaskxfs_uninstall_filesysext2fs_blkprefmsgmapsdb_pool_print_cmdwi_alloc_nicmem_iobstp_stopdb_delete_lineellist_get_mindlsvr4_to_bsd_speedzsops_nullrpc_auth_unixVOP_ISLOCKEDshm_committedsys_kqueueccdgetdisklabelauiopSHA512_Transformuao_referencexfs_channelisp_copy_out_hdrsunos_sys_execveauxio_powerdownin6_addrscopesunos_sys_lstatled_cycledb_searchmaxlockdepthpppcloseraw_usrreqsystrace_closepolicyksymsopenoclk_set_secsnblkdevscancttyinput__stack_smash_handlerpf_frag_tree_RB_FINDesp_dma_isintrbiodonecarp_hmac_verifyah_inputdb_set_breakpointcrp_req_queue_tailmyetheraddrgettdbxfs_message_installrootmulaw_to_ulinear16_be_mtsukopenmaxslpext2fs_makeinodeswap_bytes_change_sign16_lest_read_block_limitsviking_mmu_enableufsread_filtopsufs_symlinkptmopenufs_mkdirmbppioctlgetidprom.mulcgtwomatchin_iawithaddr__anddi3cs4231_setup_outputtbrt_missmsgdofilereadVOP_BMAPip_dooptionsvn_lockpf_change_icmprip6_ctlinputxd_castty_modem_controlpmap_extract4_4c_mulpar_err_regstpattach_commonwsemul_vt100_handle_csiqe_readsbdropaltq_assertzx_accessopsmkdir_poolxyc_entoacttcp_debugpmap_protect4_4cqecattachinpcb_poolsplassert_checknextralocpf_consistency_lockzs_abortsetusesys_setegidblf_keynoswap_bytes_mtssppp_ioctlpf_osfp_find_exactzx_matchfifo_readrn_matcham7990_setladrfcd9660_symlinknfs_progppplogcharautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockallsvr4_sys_mmapuvm_faultrandomioctlxyc_rqinitpppwritesoreceivesystrace_newpolicytctrl_intrpool_getuextralocdb_show_radix_noderootfspf_frent_plnfs_in_committed_rangesunos_sys_setrlimitfpu_initpf_calc_mssrip6_outputsoftdep_freefilemfchashtblinflateportal_vnodeop_entriesscsibus_cdndflushppoediscinqipsec_last_addedpf_commit_altqpmap_kenter_pa4_4ccompose_tab_cmprn_insertspec_pollfilt_kqdetachkernel_segtable_storesbppioctldb_flush_linepfsyncstartpf_osfp_findipsec_exp_bytesipcomp_sysctlbufqueuesconfig_deferm_tag_initxfs_appendqif_attachfpu_sqrtgre_lookupsttyioctldqsynctcp_sack_adjustm_reclaimnameipfi_kifaddr_updatepfi_ifhead_RB_INSERText2fs_readdirip6_ctloutputdead_pollpv_syncflags4_4cpfr_clr_tstatsvn_accesstqphy_funcsmfs_reclaimversionwihap_initzs_breaktslot_slot_enablevpagelzs_dummykqueue_initxysizeuvm_pagezeronfs_readrpcin6_setsockaddrigmp_leavegroupcom_common_getcsvr4_sys_getdents64masterpaddrmountlistbstp_initializationuserconf_histbufcgtwo_getcmapnfs_mknodrpccomsoftwihap_mgmt_inputtunreadconfig_deactivateVOP_REVOKEscsi_probe_bussesclallocipsec_esp_trans_default_levelbiowaitzstty_cafilt_ufsreadxdwriteunixswudf_reclaimsccsstp4020_chip_mem_freedb_stop_at_pcpfr_attach_tablewinuf_invalidcompat_25_sys_omsyncsvr4_sys_lstat64tqphy_casw_2_leftovercarp_sysctlwsdisplaymmapccpuncr53c9x_readregsobio_cduvm_map_replacermc_newclasssvr4_to_bsd_sigaudiocs_canfsrv3_procsboothowtofdinitarc4randomnsphy_funcstcp_delack_ticksttopenether_ipmulticast_minconfig_rootsearchrip6_sendspacescsidebug_lunsuao_dropswapip_mrouter_detachenxioesp_attachslowtraprnd_event_headwsdisplay_switchtoconsolein6_maxmtupfopenxfs_install_filesysRMD160TransformSHA1InitinflateInit2sys_setreuidie_cauvm_map_findspacesystraceioctlwsevent_initxfs_quotactlcryptoopenpfr_ktable_cntuserasymcryptono_asyncflt_regsptcread_filtopssvr4_jerq_ioctlsdsizefdstrategysys_pwritevesp_dma_intrkqueue_scansys_semgetvop_print_descpf_find_rulesettcp_closeepioctlnfsnodehashicmpsrcpfr_ina_commitsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockdl10019_mediastatustctrl_tftswcr_idwdog_registerif_indexlimdb_varspfr_kentry_plst_switchch_switchm_padfallocbufferszskbd_consopsctx_alloclxtphy_cd_udivdvma_basesppp_lcp_tlupromvecdatp9100_ras_copyrowsdeadproc_mutexdb_breakpoint_freepfctlinputphys_mapuvm_anon_removeufs_lockcomintrhme_mcresetsys_accessnsphy_statusgif_ioctluserconf_initkillpg1p9000_ioctltrunk_port_destroytunwrite_filtopsvputonfreelistierintmouse_removesunkbd5_keymapdatacpumatch_sun4cnfs_getreqext2fs_mountrootxboxprintregyearpf_commit_rulescompat_43_sys_sendmsgsetrunnablepool_do_putclock_cdnfs_closedb_check_interruptsd_crazymapwi_set_ssidnd6_prefix_onlinkgre_ioctlsppp_ipcp_initsensor_delosversionelf32_read_fromau_get_lr_valueprocfs_getattrfilesys_syncertvtohzip6_mroutervmi_listnewfreefragudp6_usrreqratecheckin_rtchangevfs_syncwaitcansignalmsdosfs_check_exportpfi_detach_ifgrouplf_setlocknbigpipewsfont_map_unicharnfsv3_procidin_controllmaxuvm_pagecopypfr_clr_astatssw_optionssysctl_quadsys_readexec_process_vmcmdsvndclearpf_nfrentslevelsoftcs4231_closexfs_starttunread_filtopsudf_disklabelspoofcompat_10_sys_semsysmbstatttyinfodb_flush_lexp9100_mmapzs_putcnfs_savenickauthttyinexport_udpencapmfs_checkexpqe_cacarp_set_addrgetnulldevdb_dmesg_cmdextent_destroydb_lpip6_forward_srcrtnfs_writebpenc_xform_rijndael128if_group_egress_buildaltq_detachloop_clonergetcttsetwaterwhichqsudf_readsl_softc_listfilt_apmrdetachdb_last_addrmouse_copy_startcom_obio_matchcgfourmatchmsgbufenabledbsd_to_svr4_sigsetfilt_ptcrdetachunp_disconnectzsopenufsfifo_writesys_listensys_mountcgsix_ioctlfifo_nfsv2nodeop_ppgsignalpf_get_sportfirstcshm_delete_mappinglinear16_to_ulinear8_bedb_read_bytespf_poolmasktcp_rndiss_inittdb_deletecgthreematchrasops32_initaudio_silence_copyoutuvm_page_rehashvop_getattr_vp_offsetspfsync_sendoutvop_islocked_vp_offsetsksymsattachne_pcmcia_enableqe_ifmedia_stsffs_fsyncnfs_sillyrenameau_portofagten_ioctlrasops8_putchar12wsdisplay_consinetdomainwsfont_findcbq_pfattachmemcpysunos_sys_statfspmap_is_modified4mkthread_exitipip_mroute_inputp9100_romfontpowermatchsi_getdisk_constructvfs_unbusywsdisplay_paramufsdirhash_getprevip_nhopsrip_usrreqpfkeyv2_cleanupspec_writeaudiostartrdqhashipsec_esp_network_default_leveldb_map_equalnbpgin_broadcastpool_page_free_oldnointrfd_getfilencr53c9x_free_ecbptcwritesdioctlrpc_msgdeniedutsnamefdcstateexit2__hex2asciigetcpuinfosbusresetip6_mloopbackext2fs_cgupdatebridge_clone_createmulticast_encap_iphdrcurprioritypf_anchor_global_RB_INSERT_COLORiommu_attachpppasyncctlpcpu_setperfufs_lookuptvtwo_ioctlscanjet_ctl_writeufs_bmapdoasyncfreeip6_mrouter_detachip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createmulaw_to_slinear16_le_mtsp9100_ras_erasecolssi_findtunclosedb_elf_sym_initam7990_copyfrombuf_contigsvr4_sys_waitffs_fifoop_entrieslogclosesppp_increasing_timeoutnbufpcmcia_submatchSHA256_Updatepfr_skip_tableudf_readdirufs_strategybounds_check_with_labelether_input_mbufbstp_disable_change_detectionif_qflusharc4_timeoutext2fs_checkpathpppoe_softc_listzx_copyrectbstp_initialize_portsocantrcvmoreepreadeepromdevclsfile_filtopsst_cdch_cdpf_tbladdr_setupmsdosfs_renamesysctl_proc_argsqeinitzskbd_putcext2fsfifo_reclaimdes1_zerokeypipe_wfiltops__lshldi3reginvalturbosparc_cache_enablecd_load_unloadturbosparc_get_syncfltlematchzstty_cdpmap_activatebmtphy_resetvop_create_vp_offsetsbstp_port_state_selectionconfig_make_softcpf_anchor_node_RB_FINDncr53c9x_msgoutunp_discardexec_aout_makecmdsdma_setuphandlersip6_outputwi_read_record_iofd_camagma_hardcgthree_mmapip6_mrouter_getsafte_caswap_syscall_lockufs_kqfilterscsi_autoconfcheckdirsspin_locksexecswwsfont_addmulaw_to_slinear16_beqeattachSHA256_Update_intnsphyter_cdwsemul_vt100_output_csikdvma_mapinses_detachin6_are_prefix_equalin6_controlleapyearsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96cs4231_intrtcp_seq_subtractsvr4_sys_statvfsswcr_authcomputetrapsignalcurproczscloserushjobwskernel_fgrn_inithead0db_single_step_cmdnd_defrouterblf_decfdcloseexecprocfs_unmountevcount_attachlimcopysunkbd5_keydesc_itwi_do_hostencryptnfs_vptofhtcp_timer_rexmtpcmcia_io_mapvmebus_sccrypto_pool_initializeduvm_swap_markdecryptrt_timer_initnd6_useloopbackxyc_carip6statptydevnamemulaw_to_ulinear16_le_mtstcp_debxcnpollstp_sbus_cacd_casys_truncateesigcodescsi_xfer_poolsysctl_wdognfs_boot_getfhsvr4_sys_pread64mttywritecgfourteen_getcmapsi_dma_intr_timosrv_ipcache_alias_distsppp_pap_opensoacceptkqueue_pollcdgetdisklabelvop_bmap_vp_offsetssvr4_sys_ioctldb_call_depthpool_page_alloc_kmemdb_printfbootstrapin6_ifaddloopufs_createmgx_putcmapnd6_optionscd9660_seekpv_link4mnd6_llinfo_settimercgsix_mmapmsdosfs_unmountelf32_load_psectionxfs_close_commonSHA512_Finalrn_mpath_nextprocfs_stat_genslinputpf_src_connlimitmtty_cdcpumatch_turbosparcdb_add_symbol_tablepf_state_tree_ext_gwy_RB_INSERT_COLORm_tag_nextpf_check_congestionch_getelemstatusmax_softdepsmsdosfs_writecompat_43_sys_getdirentriesexec_script_makecmdsignore_bogus_trapsxfs_attr2vattrfilt_pipedetachcd9660_rootdb_unaryne_pcmcia_get_enaddrss_switchxfs_eopnotsuppselrecordxfs_reclaim_commoncomstoprip_outputstp4020_chip_intr_disestablishsppp_strnlenstp4020printext2fs_accesshme_rxcksummld6_fasttimeokthread_qimaxxdc_piodrivercg3_videoctrlvop_unlock_vp_offsetsstioctlchioctluserconf_pdevuvm_object_printitpf_find_state_recursemustek_get_statustcp_sack_partialackzstty_rxsoftmbpoolxdcintrst_write_filemarkstcp_canceltimerstrunk_rr_attachtqphymatchrip_recvspaceroute_initccdreaddb_store_countipsp_spd_inplink_rtrequestuvm_vmspace_poolsunos_sys_getrlimitmfs_rootbasespec_lookuppipe_createstackgap_initnfsbootdevnamefifowrite_filtopssysctl_vnodend6_sysctlnmi_hardipsec_common_inputpf_tbladdr_copyoutvn_openpf_frag_tree_RB_NEXTnfssvc_sockheadpf_anchor_node_RB_NEXTsppp_pap_TOif_clone_createmachclk_usepccpf_route6.udivuao_detachpowerattachmallocamap_pp_adjrefep_pcmcia_matchrpc_versesp_inputin_pcbrtentryudf_readatoffsetnfs_iodwantbstp_forward_delay_timer_expirysvr4_sys_timescpumatch_vikingknote_dequeueamd7930matchtcp_outflagskqueue_statsbus_testdmanfs_boot_initpppdealloccd9660_rrip_analyzeoclock_cdnfs_vfsopsienab_bis_4msunos_sys_fstatfsip6_v6onlysys_preadvms1_mmu_enablesystrace_execve1db_tok_stringpf_src_tree_RB_MINMAXnfsv3_typesys_recvmsgses_read_configpipe_statskipjack_setkeyvn_writevop_mkdir_vp_offsetsVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputuvm_km_free_poolpage1vcountms1_cache_enablevm_page_zero_enableinodedep_hashppptioctlin6_delmultistathzpf_test_state_udpenc_xform_cast5wdog_ctl_cbhfsc_add_queuebsd_to_svr4_sigactionah4_input_cbpfr_ktablehead_RB_INSERTmem_access_faultwskbd_cnattachktrcansetvirtual_endledmamatchsys_getloginbuckstring_initipsec_hdrszicmp6_rediracceptext2fs_vnodeop_opv_descms1_cache_flush_alldetruncdb_elf_symbol_valuesnswitchexitcgthree_cacopyoutpfindesp_caip_ctloutputp9100matchwsevent_readenc_xform_arc4pf_routearp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallpf_match_portccdattachwsdisplaypollrasops1_putchar16xfs_reclaimcopyrightvigra_mmapsdattachxfs_message_wakeuptcp_timer_keepportal_inactivewsemul_vt100_cnattachtcp_mss_updatesvr4_to_bsd_sigactionffsfifo_reclaime2fs_cg_bswapdb_proc_print_cmddb_show_all_procsrw_enter_readpower_cdvunmapbufip6_sourcecheck_intervalfb_cookieroute_outputrti_deletevop_kqfilter_descsys_geteuidhostzeroisbroadcastprocfs_readdirchange_sign16_swap_bytes_bedb_output_positionicmpmaskreplmsdosfs_mknodin6_pcblookup_listenrfx_putcmapcd9660_specop_pzs_read_regip6_defmcasthlimsys_munmapsttymatchfilt_solistenvsnprintfmgx_getcmapwsemuldisplaydevprintsrmmu_cache_flusharplookupamd7930_halt_outputuvm_map_pageableproftimer_trampolinetvtwo_cdchainallocpf_change_a6sun4_cache_flushifmedia_baudrateedataxyc_startuvm_pagelookupudf_trans_poolfree_allocindirsoshutdownuserconf_hist_cmdnfs_writerpctcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablepf_state_tree_ext_gwy_RB_REMOVEtctrl_ext_statuseswsemul_vt100_scrolldownwsdisplay_getc_dummybpf_iflistPaste_availip6intrqptmwritend6_rs_inputpf_rtlabel_matchssstrategypmap_is_referenced_psoabortlinear16_to_linear8_bememerr4mmemerr4_4czx_cross_loadwidcast_encryptunp_inoxy_calogkqfiltersw_cdpfsync_insert_net_statesvr4_sys_setegidtcx_mmapuvm_tree_RB_INSERTdb_extent_print_cmduprintfsppp_set_ip_addruvm_page_printitamd7930_start_inputmainbus_canfs_pollsoftdep_flushworklistsys_issetugidinitclocksudf_hashinscd9660_mmapsd_reassign_blockszsstart_txcarp_hmac_generateif_detachttcompatsetlflagssetup_allocindir_phase2isp_controlsvr4_sys_auditsysnd6_cache_lladdrcatqsession_poolifqmaxlenipsec_get_acquireext2fs_specop_opv_descunp_connectuvm_pagermapinif_detached_startpool_serialopennodexfs_mount_commonvfs_mountedondb_expressionfc_lookupsemu_allocpf_hash_rulelinear8_to_linear16_be_mtspfr_destroy_kentryep_mii_readbitcgtwo_cdif_downndqbfilt_rndreadallocsysconsdev_prommodule_swiftVOP_GETATTRsvr4_termios_to_termioticket_altqs_activenfs_reclaimuvm_km_pages_headwihap_deauth_reqpf_purge_expired_src_nodespgt_page_allocnfs_advelf32_check_headerbt_setcolortcp6_usrreqmmu_has_holedb_historymodule_cypressnfs_loadattrcachelehwinitnfsm_rpcheadnfsrv_readdirtcp_rndiss_cnttrunk_port_ifdetachpmap_unwireipaddrip6_auto_linklocalbridgeintr_framecompat_43_sys_getdtablesizeuvm_pageunwiream7990_intrauth_hash_hmac_md5_96tcx_capfr_kentry_byidxsvr4_sys_pwrite64v8mulip6_mrtprotouvm_unmap_pzx_setcolorcdattachuserconf_devicenonidempotentin_localaddrsys_sigaltstacknfsrv_fsinfozs_majornfsrv_symlinkDES_versionsl_uncompress_tcpsoisdisconnectingrasops24_makestampBlowfish_initstateauth_hash_key_sha1wi_media_changesttyclosenfs_vgetnull_decryptsyn_hash2rttimer_queue_headptsreadses_cabridge_filterruledp8390_enablertredirectuvm_map_printitdb_read_variablepfr_destroy_kentriesdb_regsdb_stack_dumpstty_compute_baudttymodemdb_lbuf_endwsdisplay_defaultscreensi7mtx_enterkqueue_poolvntblinitstp4020_chip_socket_disableallcftablesudf_hashrem.divcgfour_caxfs_vnodeop_ppf_src_tree_RB_REMOVE_COLORax88190_mii_bitbang_opssvr4_stream_ioctlscsiforcelun_targetspmap_prefernfsrttonVOP_REALLOCBLKSregion_lrunfsrv_accesssys_setresgidsdebugsvr4_esigcodemsdosfs_sync_vnodesplassert_failtty_initwsdisplay_clearoncloseindir_truncpriq_add_altqudp6_recvspaceuvm_km_freesys_killp9100_ras_copycolszswritestart_nfsiouserconf_numberperflevelpfr_update_statsagten_getcmaprt_setmetricssys_getegidst_spaceam7990_getvndgetdisklabelhas_iocachexfs_fsyncpfr_create_kentryst_quirk_patternsdirchkipip_outputpipeclosealaw_to_slinear16_le_mtsext2fs_fifoop_entriesVOP_REMOVEsvr4_to_bsd_termiosufsdirhash_findfreeconsinitext2fs_dirremoveipsp_aux_matchuvm_vnp_uncachesysctl__stringxyopenbus_untmpffs_clusteracctnfs_timerconfig_detachsvr4_sys_pauseifaof_ifpforaddreeprom_updatecryptop_poolrt_timer_queue_destroydma_cdsunos_sys_accessrequest_cleanupwi_cdsd_cdxfs_make_dead_vnodenfs_createnfs_sndlockportal_setattrxfs_linkicmp_mtudiscipport_hifirstautosys_fstathmestopslclosecgfourteen_ioctlenc_xform_3desuserconf_enablesafte_matchgetpropintext2fs_vinitdb_endlpcryptodevallowsoftsa6_anysys_getprioritypfsync_request_updatetcx_cdhmeinitsparc_db_command_tablenfs_bioreadsysctl_diskinitnfsreqplbridge_listuvm_km_vallochandle_allocindir_partdonestp4020_chip_io_allocprocfs_inactivesys_unmountiommu_sctbtioctlapmkqfilternfsrv_getattrelf32_probespf_fragcachetcp_signature_tdb_outputin6ifa_ifpwithaddramd7930attachvgonelbridgeintrbwtwomatchsofreectrl_eventdb_del_symbol_tabledb_add_exprmbpp_attachpmap_removebpf_mtap_afnfs_statfsicmp6_fasttimoext2fs_removeif_clone_destroysi_vme_dma_startmyipbpf_setfuserconf_historyktrsettracevnodexymatchuvm_page_unbusyxfs_stat_filesyssppp_print_stringipsp_skipcrypto_unmarkxfs_pioctl_calltk_noutext2fs_mountcgfourteen_putcmapmif6tableBlowfish_expand0statecgsix_accessopsdb_symformat_elfcpu_sysctlcd9660_vnodeop_pcd9660_deftstampaudio_rintip_randomidpf_state_tree_id_RB_INSERT_COLORcd1400_compute_baudtbopennosuidcoredumpukphyattachvop_poll_desccddumpbstp_send_config_bpdudb_search_cmdsbppattachcs4231_trigger_inputtcp_disconnectvop_open_vp_offsetsuvmspace_execcbq_remove_altqsunos_sys_getdentsxfs_link_commondeallocate_dependenciessys_mmappf_anchor_global_RB_INSERTbootnd6_is_addr_neighborblf_ecb_encryptwsemul_vt100_output_normalunp_rightshostnameaudio_cddb_print_llinfowsdisplay_emulbellsadb_exts_allowed_inxfs_fhtovpme_allocfdstartext2fs_bmapip_mforwarduvmexpenc_xform_blfbtcham_attachesp_dma_resetsppp_ipcp_opt_namepmap_changeprot_pufs_diremptyesp_output_cbreinsertfinishdupcs4231_query_devinfoukphy_serviceqsphy_resetmemregattachdeflate_decompresspool_destroylogwakeuptdb_hashdl10019_mii_readregshutdownhook_listep_pcmcia_lookupip_dosourceroutesoread_filtopsbdevsw_lookupdisk_changewsemul_vt100_resetopamap_lookupsdoreallocblksstp_cdcache_revlookupbstp_designated_portred_destroysvr4_readdir64_callbacklerdcsrbpfread_filtopssoinitamd7930_getdevzsc_intr_softcpumatch_unknownVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protoext2fs_truncatecd_play_tracksscsi_do_mode_sensevirttimer_trampolineip6_maxfragpacketsdb_errorax88190_media_finizskbd_rbuf_lowatuvm_km_threadsppp_cp_inputzskbd_device_lookupttydebuglminscsi_probe_bussys_fpathconfpfi_addr_plpf_get_mssdvma_mapoutxfs_rootarpt_prunesoconnect2knote_poolcnopentslot_io_freescsi_test_unit_readyfdattachrmc_modclasszs_hwiflowarc4random_bytesnmbclustintr_sbus2ipl_4cvop_reallocblks_vp_offsetssominconnpf_osfp_listep_pcmcia_get_enaddrxfs_devclosepf_src_tree_RB_FINDpmap_enk4msegm_freelistledmaintrpcmcia_matchnchashtbluvm_vnp_synccgeight_capfr_unroute_kentrysvr4_sys_execveufsdirhash_checkblockwihap_assoc_reqinodedep_poolarpt_downportal_rootwsmoused_wakeupxfs_printnode_commonudf_accesspfr_ina_beginstate_regstrunk_port_checkstackingp9100_write_ramdacbpf_tapdb_lookupSHA256_Finalrasops15_putchar12wsmousedmii_phy_autonfs_mountrootmax_datalensvr4_sys_getrlimitufs_mindirhashsizemsdosfs_initvop_readdir_descwi_write_record_ioesp_cdext2fs_writestp4020_statintrlf_clearlockch_exchangenfs_udpsockdb_lastsymip_srcrouteip6_accept_rtadvpf_test_othersys_setregidpcmcia_cdxfs_unlockccdlocklemediachangeportal_statfsvinvalbufmii_bitbang_writereglo_microtimebestartpfi_ifhead_RB_INSERT_COLORsunos_sys_mmapnfs_mkdirsys_ftruncateaes_ctr_cryptah6_input_cbsoftdep_fsyncm_splitisp_donencr53c9x_attachfifo_pollkrp_req_queue_tailtcp_timer_initdb_tab_stop_widthxfs_setattrdb_putncharscarp_clone_createoclk_get_dtudf_find_partmapsfdc_wrfifond6_maxnudhinttcp6_inputip_mroutersosetopttcp_msscs4231_attachcache_purgebeqintsafte_temp2uKsl_clone_destroybpf_mcopyax88190_mediachangepcmcia_3cxem556_func0SHA384_Finalp9000_ras_initauth_hash_hmac_sha1_96pcmcia_intr_disestablishfork1am7990_ioctldb_activetslot_slot_disablevfs_hang_addrlistst_cach_camrt6statdead_writemagma_caufs_dirrewritecarp_set_enaddrinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputvlan_taghfind_last_setcd9660_vnodeop_entriestcp_rndiss_msbsys_chmodccdsizespifstcintr_rxprelist_removeffs_vgetinitprocbt2pmtsystraceread__umoddi3pfkey_buildprotoswnfssvc_nfsdsystracepollmbpp_cdgmt_to_dtsppp_lcp_RCN_rejcgtwelveattachip6_log_intervalnull_encryptwihap_auth_requvm_page_physdumpccdbufferpf_insert_statewsemul_vt100_nextlinenfs_readlinkrpcX_db_sym_initsyn_cache_timermbpp_cavt100_initchartablesext2fs_checkoverlapsolisten_filtopsin6_update_ifamyleintrstat_inode_bitmapep_mii_sendbitsvop_bmap_desc_udivreplacebwtwo_accessopssuser_ucredaltq_remove_queueqecprinttcp_sack_optionmulaw_to_alawsd_shutdownwi_shutdownmem_noext2fs_buf_allocdp8390_startsoftdep_disk_write_completesystrace_seteuidipcomp_input_cbdb_prom_cmdcs4231_trigger_outputwihap_sta_deleteep_pcmcia_detachstwritepfkeyv2_get_proto_algpfkeyv2_releaseRMD160Update_intrevarprequestkernel_mapwi_init_iozskbd_rbuf_hiwatdumpdevxfs_update_handleppp_dequeuebwtwoattachsppp_lcp_upcd9660_lockxfs_rmdir_commonietintxfs_read_commonchange_sign16_swap_bytes_le_mtsvfs_mount_foreach_vnodekqueue_kqfiltersoftdep_typenamesamd7930_get_propsimport_lifetimeip6_mrouter_donepriq_remove_queuewi_mgmt_xmitaudio_opencgtwelve_ioctlzeroin6_addrmemreg_castrncasecmp__guardin_ifaddrsunkbd_keymapdatand6_optionsafte_detachufsdirhash_findslotsppp_chap_initwin2unixfnmax_hdresp_dma_setupnum_inodedepffs_readinet_ntoa4tun_clone_createm_freetslot_cdzs_cavop_default_desccbq_add_queuene_pcmcia_dl10019_get_enaddrscsi_inqmatchfdesc_poolufsdirhash_poolvop_strategy_vp_offsetspool_page_allocpfr_kentry_pl2in_pcblookupbstp_become_designated_portfilt_pipewritecd9660_pollm_tag_delete_chainsvr4_sys_signalpool_head_slockipe4_initbzeropromcnputcxfs_opentickfixintervalmii_bitbang_syncufs_closemrtstatprocfs_validfilefixjobcpf_anchor_removeprocfs_accessdb_show_all_cmdsscsi_execute_xssparc_noopin6_addmultistat_ino_limit_pushrn_newpairvop_setattr_descdb_find_breakpoint_heremsginfopppfcssunkbd5_keydesc_ptsys_obreak__udivdi3blf_setkeyxdc_tickdesirednfsrvcachepf_routablesttystopsystrace_msg_emulmemregmatchcpu_classrfx_ioctllastddatepppoeattachromgetcursoraddrzs_set_modespf_rtlabel_addlemediastatusin6mask0swap_key_cleanupbpf_validatevaccessieinituao_set_swslotmbinitchange_sign8hypersparc_mmu_enablewskbd_default_bell_datascsi_readsafe_cmdsbpp_caxdc_submit_iorqsunkbd5_keydesc_sfamap_allocxfs_readdirVOP_LOCKMD5Finalstty_casbppopencgsix_resetwskbd_matchcp_timencr5380_initcgfourteenmatchsbus_attachcd9660_vget_internalsystracef_readlinear16_to_linear8_ledb_page_print_cmdpf_osfp_initializewi_intrcypress_cache_flush_allipsec_acquire_poollkmioctlvgetzs_conschanvndthrottleamd7930_set_portwinChksumfreeclusterchainmld6_inithardmemerr4mrw_test_and_setsunkbd_keydesc_sgdisk_initsvr4_sys_systeminfobeintrnfs_nameicd9660_fifoop_opv_descrip6_ctloutputnfs_getattrcachenetiopfi_updatend6_na_outputext2fs_fhtovptrunk_ether_addmultiext2fs_createhmeintrnfsrv_createwi_sync_medianfs_realignvfs_opv_init_explicitpipe_pollnsphy_caseminfobmtphyattachsysctl_dopoolcd9660_fifoop_ppfi_stateheadep_detachpmtu_expirecrypto_getreqtcp_respondsys_readvamap_cow_nowroundrobinuvm_map_createworklist_tailvfs_opv_initissignalhypersparc_pure_vcache_flushCopybuffer_sizenetclsktrinitheadercdevvptagname2tagpfr_insert_kentrysvr4_find_socketmbppreadch_get_quirksigmp_joingroupinflateIncomppfr_pool_getbeeintxfs_syncrandompolluiomoveled_cdmsdosfs_startdevioclf_allocdb_loop_countwi_intr_ackmfs_rootsizebpf_reset_dslinear16_to_mulaw_lepf_anchor_node_RB_INSERT_COLORnd6_dad_stopcs4231_readcarp_send_nauseloopbackuvm_waitpf_anchor_stacknfsfifo_closefilt_apmreadnexecsststartbetintpmap_referenceprocess_worklist_itemsys_bindax88190_mii_statchgclockattachxfs_message_wakeup_datacarp_addr_updatedloioctlrw_exit_writedma_gofindrootcarp_iamatchfpu_cleanuppmap_bootstrapipsec_auth_default_levelblf_cbc_encryptcputypsys_mquerybigadjkmeminit_nkmempagesnfs_sysctlipsec_policy_poolspec_vnodeop_entrieswi_pcmcia_detachfdsizeshm_last_freexfs_lookup_commonscsiforcelun_busesgif_clone_createfillinusemaprecvitfill_kproc2bmtphy_funcsipsec_common_ctlinputtdb_rehashep_media_changeipcomp_outputfilt_sowriteuvm_kernacccnpollcsys_linkadd_to_worklistlog_opensi_optionsnumnfsrvcachegettdbbyaddrevcount_initfragtbl124portal_vnodeop_puserconf_totdevvop_inactive_vp_offsetsrt_ifmsgrt_tablesqec_putrealitexpirepf_src_tree_RB_REMOVEunix2dostimeipstatsrmmu_get_syncfltnfs_initscsibus_capool_page_free_kmemcompat_43_sys_truncatecrfreecnputcin6_gif_inputxyc_perroripsp_delete_acquireip6_lasthdrdl10022_mii_bitbang_opsviking_cache_enabletcp_reapernfs_bmappool_sethiwatwsemul_vt100_output_c0c1sbus_printmicrotimexfs_update_read_credppp_deflate_draftsysctl_sysvsemncr5380_wait_phase_timostp4020_chip_mem_allocrfx_mmapuvm_swap_getaudiosetinfoepmbuffillext2fs_reloadif_detach_rtdeletecs4231_get_portnfsrv_getstreamcsefindelf32_copyargsisocharpf_frag_treexfs_message_receiveuvm_km_alloc1fb_show_screencdopentcp_usrclosedqec_cansphyter_caiommu_removeskipjack_backwardscarp_send_ad_allphysmemudf_checktagsunkbd5_keydesc_dexfs_rmdirpagedep_lookupwskbd_holdscreenintr_fastuntrapinferiorpfr_ktablehead_RB_INSERT_COLORxy_cdclusterallocrfx_loadcmapext2fs_fifoop_pcryptof_readxformswltsleepxfs_closewskbd_attachin_pcbbindisp_sbus_canfs_node_poolrtalloc2endtsleepwihap_check_txxfs_vnodeop_opv_descuvm_pageratopsigactssharesadb_exts_allowed_outdb_set_watchpointbe_tx_harvestnfsrvw_sortbpfattachif_detach_queuesitimerdecrvnddumpether_outputshmexitmbppopenexport_authauth_hash_md5crypto_kdonenfs_removebpfilter_lookupm_copym0pppoe_clonervm_physmemprocfs_allocvpprocfs_initSHA256_Transformiso_shipdirrnd_timeoutxfs_bmapufsdirhash_dirtruncicmpmaskpipe_ioctlpf_state_tree_lan_ext_RB_INSERT_COLORwskbd_enablecd9660_mountrootnetlckbpf_allocbufsxfs_unmountmsgbufmappedtctrl_write_dataxfs_data_validgetphysbufcdsizedb_symbol_valuessppp_lcp_check_and_closedb_evarssppp_ipcp_openufsfifo_closewakeupsoftdep_slowdowngetnanotimecgeight_accessopscompat_43_sys_sethostidiommu_cdtvtwomatchtcprexmtthreshprocfs_vnodeop_pkprintf_mutexsetquotastat_countprt_getifaslstartdb_malloc_print_cmdwi_get_fid_ioenosyscompat_43_sys_creatlockmgrbstp_tickrtlabel_name2idisp_uninitgetdevunituvm_vnodeopsvfsconfbe_tcvr_initsrmmu_vcache_flush_contextVOP_OPENcompwroffwsdisplay_console_inittedSHA384_Initpninek_casvr4_term_ioctlvigra_ioctlconsdev_ttybuckstringsvr4_sys_gettimeofdayscsi_interpret_sensepfkey_unregistersunkbd_layoutsext2fs_flushfilestrunk_ioctl_allportsmsdosfs_vnodeop_paltq_attachdes_ecb3_encryptpower_capromveclxtphyattachufs_readlinkdoscheckpathnfsv2_vnodeop_opv_descpcbmapaudio_readnd6_option_initmfs_initminirootuvm_km_alloc_poolpage1audiopollricoh_is410_swext2fs_setsizeprocess_set_pcin6_init_prefix_ltimessoftdep_change_directoryentry_offsetesp_outputprocfs_vnodeop_entriesnchstatscd9660_fhtovpmsgbufpsys_setgiduserconf_common_attrfd_dev_to_typefilt_ufswritert6_flushpppoe_clone_destroyuvm_mlk_callbstp_config_bpdu_generationtctrl_lcdpgt_page_freemmrwrfxattachffs_bufatoffah_input_cbpf_insert_src_nodestp4020_chip_io_mapfdcattachcpumatch_hypersparcuvm_errno2vmerrorsubkey_table_gencompat_43_sys_getsocknamedohooksmustek_compute_sizesnfs_quotactlpriq_add_queuerasops24_erasecolsif_detached_ioctllocnampstat_ino_limit_hitpfr_initializebridge_rttrimvop_close_descstat_blk_limit_hitbstp_enable_portfilt_tunreadtun_outputuserconf_showip_mtudisc_timeout_qpf_remove_if_empty_rulesetffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridamd7930_deviceprocfs_openpool_setlowatkmembaserip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachipsec_add_policysysctl_emulsttyopensys_sigprocmaskdb_commandnfs_renamerpcsys_shmctlpf_get_poole2fs_sb_bswapin6_if_upfilt_pipereadskip_spc_rightcompat_43_sys_gethostidsoreservepidtakendb_formatpfr_ktable_plmfs_pripf_test6vmeintruvm_mmapxdr_string_decodepf_osfp_matchufs_quotactlcgfour_cdviking_get_syncflttcp_newrenosparc_interrupt44cdma_enintraroundin6_pcbnotifyncr5380_scsi_cmdcrypto_threadstrrchrst_check_eodgetdevvphme_cddefrouter_selectamap_unrefext2fs_statfsbstp_set_bridge_prioritycompat_43_sys_sigveccrdupbpf_mtap_hdramap_wiperangecuio_copybacktickdeltaemul_svr4isodirinodb_strlcpycfrootschrtoblklease_checkscsiprintuserconf_pdevnamminphysacctchkfreqah_output_cbpmap_rmk4msw_3_leftovercgfour_ioctltimeout_mutexcd9660_specop_opv_descrtalloc_noclonepf_main_rulesetether_addmultinfsrv_rmdirsunos_readdir_callbacksvr4_sys_memcntlvop_mknod_descfdcstartudf_strategyxyc_ticktimetochipip6qffs_vptofhvfs_isbusyifunitcd1400_read_regdvma_endbstp_hello_timer_expirybawritetputcharintstacksi_debugcompat_09_sys_setdomainnamewskbd_detachcsedeletepool_print_pagelistcs4231_set_speedffs_fragacct_umulreplace_endsunos_sys_mknodsi_obio_intr_onsys_fchowndb_breakpoint_cmdwzeronfs_strategyvwaitforiocompat_35_sys_shmgetbootpathbe_ifmedia_updmii_phy_tickcs4231_writecd_read_subchannelextendfilelortrequesticmp6_inputprocfs_doctlxyc_ioctlcmdwsemul_vt100_outputuserconf_addnfs_openwi_func_iocreatedefb_setsizesbreleasedb_history_sizepf_cksum_fixupmsdosfs_islockedpflogoutputmax_linkhdrwsdisplayioctlalaw_to_ulinear16_lecryptof_statsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetspmap_is_referenced4_4czs_defspeeduserconf_hist_eoctslot_matchext2fs_getattripsec_adjust_mturtlabel_id2namesbdroprecorduvm_coredumpudf_ds_poolip6_sysctlmfs_mountrootsavacctppf_thread_createsusersvr4_sys_fstatsemtotvn_syncer_add_to_worklistvme_camemalliestarttrunk_media_changebstp_make_forwardingtk_ninsysfilt_opsufsdirhash_mtxclusterfreerootdevaudio_fill_silencepf_normalize_tcp_initpf_print_stateufs_ihash_slockm_tag_firstpmap_count_ptesmixer_closecdmatchmustek_trigger_scannerffs_checkoverlappfr_clr_tablespriv_regsdumpsysicmptstampreplif_detached_watchdogext2fs_fsyncnfs_ticksdoforcesys_fsyncpfr_get_astatsfree_allocdirectuserconf_add_readifconfamap_wipeoutuser_configcast_setkeydb_map_currenthme_mediastatustcp_outputtcp_rndiss_nextnsphyattachwsdisplay_emul_attachpfdatatopacketupdate_ledsext2fs_updatebpp_camgx_accessopsscanjet_ctl_readuvm_swap_initcryptnfs_accesstcp_timer_2mslpf_osfp_entry_pltbr_setne2000_writememffs_reload_vnodepf_tag_packetif_addgroupmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointudf_readlinkpool_allocator_freefilt_proceopnotsuppfifo_lookupxdopenffs_reallocblksnfs_removeitrootvprandomclosetimerblurbbstp_record_config_informationpcmcia_intr_establishuserconf_maxlocnamespool_reclaimbpf_sysctlxdc_cdufsdirhash_removetrunk_ether_delmultivflushpfr_reset_feedbackcddetachtcpctl_varsarptimernfsrv_dorectcp_reass_limitruaddm_copymallocdirect_poolam7990_initmouse_copy_extend_chardb_free_breakpointssa_hw_ifif_uppfr_del_addrswsfont_getflgchkdquotlesetauinfsnodehashtblcpumodcache_alias_bitsslopenne2000_ring_copycgsix_ras_erasecolsVOP_BWRITErt_timer_queue_createmsdosfs_ioctltdb_soft_timeoutsys_openseginvalrasops_pmaskinet6domainpgdeletesvr4_sys_hrtsystregionpf_matchsunos_sys_openuvm_pageidlezeroemulinstrwskbd_do_ioctl_scphtree_SPLAY_MINMAXdb_symtabs_divreplace_endpfsync_send_buspf_anchor_copyoutraw_attach_umuldb_boot_sync_cmdnfree_msgmapstrunk_rr_startether_ip6multicast_maxpipe_poolxyreadhme_mii_statchguao_initagten_mmapvop_abortop_descfpu_executeifa_ifwithroutepmap_changeprot4mspec_kqfilterdvma_malloc_spacepmap_page_protect_pnfs_renametcp_notifycd9660_tstamp_conv7hme_caffs_dinode1_poolcompat_35_sys_statrandomattachpfi_ifhead_RB_NEXTqec_translateses_psu2sensorsys_sstkdb_print_positionnfs_lookuprtflushclonedb_radixgetblkmouse_pastenfs_readdead_vnodeop_psystrace_prepinjectsppp_flushdl10019_stop_cardmouse_copy_endmaxsmapaltq_inputmfs_vfsopssoconnectwskbd_repeatnfs_writeswap_encrypt_initializednobufferscompat_43_sys_sethostnameromhaltrtrequest1__lshrdi3db_find_watchpoint_umulreplacektremulpf_pool_limitsxdc_xdresetnfsd_waitingtcp_identtcp_rst_ppslimrtrequestxfs_lockifinitcompat_10_sys_msgsyscd_load_tocunpst_recvspaceshminfoquotaoff_vnoderpc_callzlib_versionne_pcmcia_attachlebufmatchfree_inodedepraw_inputcd9660_reclaimtcx_accessopsnfs_nhinitfilt_logrdetachpfattachnd6_ifattachunpdg_recvspacepipe_closeaudio_drainstp4020_chip_mem_unmaptrunk_port_lladdrcd9660_inactivedesireddquotsoftdep_mountmsdosfs_rmdiruvm_km_getpagemsdosfs_fsynccfdataufsdirhash_endusefulportal_printffsbetickufs_checkpathesp_enablesppp_paramsspifppcintrpfxlist_onlink_checkdb_elf_lookupzsstartinittodrpfi_ifhead_RB_REMOVEm_tag_findxydkdriverblf_encadler32vputtcbhashsizecd9660_setattrdk_establishcache_printufs_quota_initz_freekqread_filtopspf_pooladdr_plvndlockaudio_closepcmcia_check_cis_quirksxfs_is_xfs_devcryptowritebioopssltioctlbpf_setdltpf_cache_treeipprintfsmsdosfs_statfslboltpipe_initsi_vme_dma_eoprasops24_eraserowsssclosesyncerprocpcmcia_card_gettypesemseqsxfs_vgetufs_ihashinsin_setpeeraddrccdbufsizeofwindow_inflatedb_readlinepf_rollback_altqwsdisplay_delscreenmbpppollzx_putcmapether_ifdetachtcx_promvop_fsync_vp_offsetsuserconf_histcurrndstatsxdgetdisklabelst_touch_tapenfs_bwritemsdosfs_inactivepf_add_thresholdhmeioctlxfs_open_commonprocfs_pollpanicstrwsdisplay_kbdinputaudioioctlscsi_delayext2fs_sync_vnodepppintrunpdg_sendspacesession0viscpyptmattachsystrace_answermem_pagexyc_cdxfs_mkdir_commonespstatsppp_ipcp_tlssw_1_leftoversys_msgsndsbus_translatecopyincomparamep_pcmcia_prodsppp_up_eventcd9660_defattraltq_addsunkbd_bellrtalloc1rmc_dequeue_nextqestopuao_swhash_elt_poolxfs_message_gc_nodesufs_ihashgetdes_set_odd_parityencode_comp_tne2000_read_hdrsigacts0ncr53c9x_dequeuefindblkmajorpager_mapntohlwsemul_sun_controlbmsafemap_lookupsorflushvigra_burnerttioctlarpintrqslpquettycharsvprintfsi_vme_intr_offxfs_advlocktdb_hashstatssyncdelaysparc_led_blinkffs_mountext2fs_specop_entriesicmp6errppslimSHA512_Update_intobio_scanpool_inactive_timelinear8_to_linear16_bepf_state_tree_lan_ext_RB_REMOVEdp8390_mediachangeencattachconfig_process_deferred_childrenwsdisplaywritekvm_setcachepool_cache_reclaimluphymatchin6_setmaxmtumsdosfs_rootmii_bitbang_sendbitsesp_write_regtqphyattachbpf_getdltlisttslot_attachprocfs_ioctlm_tag_getnfsrv_commitsb_lockpfr_add_tablesudf_unmountrt_labelscrypto_unregistersuid_clearacctresumettwritechange_sign16_lesvr4_sys_sigsuspendcompat_43_sys_recvfromswapdev_vpdp8390_resetvlan_set_promiscrasops1_putchar8wsemul_sun_attachbootpath_storeah_initxfs_getnewvnodedead_readufs_pathconffile_pooldb_boot_reboot_cmdvop_symlink_vp_offsetsunputcendeeprom_matchpcmcia_verboseluphyattachVOP_CREATEprobe_switchcarp_ifdetachxywritefbwscons_console_initacctsuspendvop_readlink_descuvm_map_referencespec_ebadfphtree_SPLAYsvr4_sys_lstatvigramatchnd6_recalc_reachtm_intervalpagetables_startpfi_if_comparein_ifinitfifo_closewi_pcmcia_activaterasops15_makestampin_pcbhashlookupapmread_filtopshypersparc_cache_enableipcomp4_inputsafte_cdcgfourteen_intrgettdbbysrcdsttadpole_register_extvideobwtwo_ioctlnfsrv_initcd9660_vnodeop_opv_descVOP_ABORTOPbpp_cdsw_camfs_vnodeop_pchange_sign16_swap_bytes_leswap_encryptcgeight_ioctlwsemul_sun_resetopqeresetsys_acceptnsphyter_statusuvm_map_entry_kmem_poolccdclosetrunk_lladdrwi_inquirenfsrv_setattrtcp_rst_ppslim_countmagma_softif_clone_listsys_futimesccdinitsdgetdisklabelxfs_vfsopswi_do_hostdecryptinternal_commandsunkbd5_keydesc_nlxyc_rqtopbmgx_setcolorsunkbd5_keydesc_frin_losingfddumpsppp_ipcp_tluledma_resetsunkbd_keydesc_ukVOP_SYMLINKcompat_43_sys_sigblockgeteblkmmu_pageinwsscreen_detachred_addqcarp_join_multicast6scsibusmatchcrypto_kregistervn_ioctlufsspec_readdb_show_calloutprocfs_readlinkpipespacetslot_mem_unmapip6_sendredirectsvfs_getuserstrshmforkcgtwelve_promcast_decryptddb_sysctlukphy_caitimerfixip_stripoptionsspifstcintr_rxexceptionsyn_cache_countsunos_sys_ustatep_vortex_probemediaxfs_message_sendnd6_timer_chne_pcmcia_ax88190_set_iobasep9100attachnfs_mountpvpooltcp_ctlinputether_multiaddrstart_cleanerxfs_returnzeroffs_blkfreeexit1xfs_mount_caddrsppp_lcp_tlfbdevvpiewatchdogfreefrag_poolifa_ifwithdstaddrpf_free_statesvr4_sys_waitsyssemu_poolpf_state_expirestslot_capim6statdb_watchpoint_alloctag2tagnamekernel_regtable_storein6_nigrouprasops1_copycolsscsi_mode_sense_big_pageauth_hash_sha1trunk_rr_detachuihashpf_frag_tree_RB_REMOVErijndaelEncrypttcp_keepintvlvop_reallocblks_descp9100_pick_romfontvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchsunkbd_accessopshandle_workitem_freefragwihap_sta_finduvm_km_valloc_prefer_waitsyn_cache_poolprocfs_pathconfqeioctlffs_allocpf_check_thresholdsegm_lrurompropdb_prevbe_mcresetsvr4_stream_ti_ioctlsi_obio_dma_eopipsec_exp_first_useplimit_poolip6_defhlimcarpattachgre_outputbstp_timer_stopunp_connect2systrace_findpf_testpool_prime_pagern_walktreetcx_burnerstclosechcloseproc_waitingsys_chownuvm_pagewirevop_lease_vp_offsetsufsdirhash_freeold_setgroups_funcin6_joingroupsys_munlocksunos_sys_mctluvm_anfreedofilereadvipip_sysctlvn_statfilepfr_detach_tablerw_exit_readwi_intr_enableip6_mrouter_settablefullbewatchdogxfs_mkdirtcp_maxidlepppallocmclpoolbsd_to_svr4_sigaltstackststrategycttyioctlmbpp_mstohzffs_vnodeop_pprocess_write_fpregssys_lstatfilt_rndwritenfs_clearcommitpppopeniso_uiodiripe4_inputimport_addresscttyopenamd7930_query_devinfospifattachinet6ctlerrmapshmctl1fifo_vnoperatesunos_sys_sysconfdisknamesdumploRMD160Updatemsdosfs_mountpf_state_tree_ext_gwy_RB_FINDp9000_loadcmap_immediatezstty_unitsppp_set_phaseexport_credentialsnullcnpollcrfx_burnerp9000matchuvm_km_initxddumpffs_sbupdatencr5380_pio_outudp_sysctludf_rawnametounicodeax88190_mii_bitbang_readpg_flushcachesystracef_ioctlsadb_exts_required_outvmmapbsyxyc_startbufuserconf_histlendb_list_breakpointspf_begin_rulesnfs_getcacheblksppp_inputnkmempages_minvop_mkdir_descledma_carpc_msgacceptedsunos_sys_mountcgfour_accessopsncr53c9x_resetmrt_ioctlcgsix_ras_copycolssys_sched_yieldvmspace0svr4_sigcodestmatchchmatchscsi_decode_sensettywaitscanjet_specialuvm_map_setuptcp_syn_cache_sizenfsspec_readetextp9100_ras_initzsttyifa_ifwithnetmemchrqsphy_statuscomp_algo_lzsncr53c9x_scsi_resetscsi_mode_sense_pagefpu_shrvt100_selectattributexfs_get_pagSHA384_Updatesunkbd_getledsproc_poolxfs_abortopudp6_inputttcompatsys_writepfsync_update_tdbswap_key_deletemap_forwmergedb_get_valuexfs_accessbstp_received_config_bpdusb_maxemul_flags_translatecd_set_pa_immedwsdisplay_maxscreenidxcnstopextent_print_allihashtblnfsrv_writegathersys_dup2nfs_asynciosppp_pickdb_inst_countdb_read_linewsdisplay_switch1xfs_devclose_commonsys_readlinkext2fs_sizebstp_disable_port__ashrdi3pf_state_tree_id_RB_MINMAXwsdisplay_burnip6_auto_flowlabelmfs_initpfkeyv2_expireeeprom_cdlf_splitifafreeVOP_STRATEGYtzsunos_sys_statrip_sendspaceudf_sysctlaltq_getqstatsamap_addtcp_freeqcom_attach_subrcgsixmatchdvd_authsppp_pap_scrxfs_dnlc_purge_mptdb_firstusetcxattachcdreadrasops15_initspec_inactivedp8390_stoppf_anchor_global_RB_REMOVEsvr4_sys_shmsysSHA512_Initsys_sendtospifstcintr_mxicmperrppslimgeneric_filtopsknote_dropzx_copycolstrunk_startin6_selectsrclebufprintiommu_enterzskbd_initxfs_node_findshmget_existingin6_pcbsetportnfsrv_nullpfi_kif_matchalldevsdp8390_rintsunos_sys_auditsysicmp_do_errorvmcmd_map_readvnmbpp_startamap_extendsigpropvmapbufvndencrypttrunk_link_activedehashtblsocketopsdeviombpp_sendtcx_intrX_db_sym_numargszs_maskintrnd6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readimport_authunp_markdes_key_schedcarp_hmac_prepareicmp_mtudisc_timeoutzs_loadchannelregsskip_char_rightttyread_filtopstslot_event_threadmodule_ms2drain_outputvop_lookup_descdb_map_addrgetinoquotatrunkattachfifo_ebadfscanjet_trigger_scannerscsi_do_ioctlwtab_alloccd_resettimedeltapf_altqs_inactivegreattachX_db_forallstty_cdsvr4_sys_sigpendingsemctl1xfs_root_commonsystrace_detachudpstatpf_test_state_tcppfi_allsetrootzscninitpfkeyv2_sysctl_policydumpercd_read_toccarp_inputcgtwelve_resetcdioctlsystrace_policyifmedia_addacctplxtphy_funcsskipjack_zerokeysvr4_sys_breakmttyclosesppp_pap_initsppp_chap_inputlogopenluphy_serviceufsdirhash_hashsppp_phase_networkbreadntcp_hdrszxboxattachpf_osfp_pltcbtable__xordi3frag6_draindosdiremptypfr_walktreeigmp_slowtimoifpromiscrtl80x9_mediachangepf_state_tree_lan_ext_RB_MINMAXidletbfdebugcarp_send_adtrunk_fail_detachfork_returnsys_getsocknamecd9660_lookupnfs_getauthvop_fsync_descep_mii_writeregmask_rnheadnfsd_head_flagsi_headbridgeattachuvm_swpkeyscreatedufs_rootptyttylesetutptcp_sysctlVOP_SETATTRpmap_kremovesigactsinitsunos_sys_creatvfs_findnameexec_elf32_fixupxfs_fhopenrt_newaddrmsgvop_generic_lockuvmfault_anongethandle_allocdirect_partdoneconsttyuvm_pagealloc_stratpf_test_udppv_changepte4_4cfdclosetvtwo_accessopsusermountext2fs_dirrewrite__ucmpdi2bridge_ioctlvn_closefilevfs_free_netcredpool_cache_do_invalidateip_mtudiscmld6_start_listeningtcp_signature_tdb_initpidhashtblwsemul_sun_opstcp_drainsvr4_sys_putmsgsi_dma_pollm_pullupsvr4_sys_preadbpendtsleepenterpgrppagedep_in_progressnull_zerokeycrypto_freesessionMPFailisp_resetwsemul_vt100_output_string_escpause_timercnbellpf_find_anchorm_copydataintrhandzskbd_txsoftprocfs_vnodeop_opv_descwsscreen_attach_synccd_setchanpmap_zero_page_pxdc_rqinituvm_cnt_headmtx_leavecpu_cafilt_signalsigactsfreestp4020_delayfilt_tunrdetachttymallocwsdisplaykqfiltersunkbd_keydesc_itmmioctldb_nextsendsigsunkbd_keydesc_debpf_ifnameeintstackcs4231_halt_inputvfs_busylkm_listmouse_copy_extend_afterfilt_ufsdetachvlan_ether_delmultilf_getlockieresetsolistenwskbd_compose_valuepf_anchor_global_RB_REMOVE_COLORip_ecn_ingressmsdosfs_bmapfifo_bmapaltqs_inactive_openrip_ctloutputsvr4_to_bsd_sigaltstackffs_vtblif_getgroupsystrace_findpidipmobile_sysctluserconf_morekqueue_ioctlportal_reclaimsys_wait4rip6_recvspaceamap_share_protectfs_sysctlfilt_sordetachpsignalwsdisplay_console_confnfs_getattrconfig_pending_incrsys_osigaltstacksi_dma_freeamap_pp_establiship_mobile_allowcgsixattachzscnprobeuvm_anon_initffs_reclaimbmtphy_cadqfreelisthmeresetzs_set_speedsysctl_sysvipcqzeroif_link_state_changepmap_virtual_spacesvr4_sys_fchrootbpfpollnumemptybufspfr_route_kentrybwtwo_cdupdatepripf_anchor_global_RB_MINMAXbmtphy_serviceptcwakeupp9000_ras_eraserowsulinear8_to_linear16_be_mtswskbd_cnbellnfs_printcompat_35_sys_fhstatruntimettcompatgetflagsvt100_decmodefbwscons_setcolormapqe_eintuvm_doswapencryptpf_default_rulewi_seekfilt_soreadzeropagenfsrvw_coalesceipsec_def_encpool_logsizeip4_input6pfr_ktable_comparepdevinit__iordi3dmamatchtslot_intr_establishnsphytermatchinetctlerrmapffs_specop_opv_descresetpriorityau_set_portenoioctlwsemul_sun_output_lowcharsudf_mountcgthree_accessopssigacts_poolexecsigsmachclk_freqzs_modempfkeyv2_getconfig_initgif_outputencstarticmp6_redirect_inputkrpc_portmaprw_enterpmap_enu4_4cst_interpret_sensecarp_join_multicastsppp_down_eventmixer_ioctlepresetpfr_ktablehead_RB_NEXTscsistrategynd6_ra_inputin6addr_loopbackttypendvprintin6addr_linklocal_allroutersuvm_swap_freepagesreserve_spitunpollpfi_buffer_cntsvr4_sys_accessqsphymatchin_revarpinputstrlcpycompat_43_sys_sigsetmaskX_db_symbol_valuesphys_availmustek_set_paramsext2fs_advlockknote_fdclosetslot_io_mapvop_lease_descsppp_keepaliveif_clone_detachpipe_rfiltopspfr_maskin6_cksumsunos_sys_execvstrncmppf_state_plcom_obio_disablevfs_opv_numopsxfs_outqdes1_decryptvfs_shutdowngetsocksvr4_sys_timemouse_hidein_interfacessyn_cache_respondxdmatchllinfo_nd6sbcheckreserveuvm_iopreemptzstty_stsoftmfs_printunixdomaindb_next_free_breakpointeeprom_uioprocfs_docpuinfouvm_tree_RB_REMOVEzx_putcharscsibusattachetheripstatsystrace_replaceaudiowritesysctl_sysvshmpf_unlink_statecs4231_getdevsyn_hash1ulminwihap_data_inputmsginitdb_last_symtabtctrl_requestproc0paddrrn_addmaskrombootbstp_set_port_prioritysunos_sys_wait4udf_quotactlbpf_bufsizeselscansoo_pollnfsrv_noop_randseedsig_filtopspmap_kenter_pa4mwskbdopenpfi_clr_istatsttclospmap_protect4mcs4231_matchpfkeyv2_acquireipsec_soft_allocationssparc_led_tobridge_addrulesppp_lcp_opt_namest_mount_tapenet_sysctlcom_cdsystracef_writepfi_address_addwskbd_do_ioctldead_ioctlpppasyncrelinqfill_eprocsunkbd5_keydesc_dkufs_dirhashchecksysctl_iflistep_read_eepromrasops_alloc_mattrvwakeupsystracef_kqfilterssattachsunos_sys_sigvecsl_compress_tcpif_clonersnfs_kqinitvgonetcp6_ctlinputdb_stack_trace_cmdcypress_get_asyncfltsbus_cacgthree_setcolorufsspec_closene2000devstcxmatchnd6_prefix_offlinkuvm_anon_dropswapccd_need_kvmdl10019_mii_bitbang_readwi_detachigmp_inputvop_ioctl_vp_offsetskmemusagenfsm_mbuftouioswcr_sesnumlf_getblockxddkdriverwsemul_sun_console_emuldatatcp_rttdfltcleanerprocportal_pollfifo_reclaimgetcacheinfo_obpsbappendstreamm_tag_copy_chainpmap_copy_page_pfdformatsppp_ipcp_RCRsowrite_filtopsstrncpycseaddrevarp_in_progressdb_disasmsdreadicmp6errratelimsys_opipelinear16_to_ulinear8_leep_statchgupdatefatsvfs_getvfsffs_sync_vnodencr53c9x_sensepv_link4_4cproc_stopzx_cross_waitprocfs_closedb_history_lastbpfilter_createsysctl_lockax88190_mii_writeregamd7930_shareintrlockfpoolwihap_disassoc_reqsi_obio_dma_stopnpmemarraudioread_filtopsufsdirhash_listhtonluvm_km_kmemallocsvr4_sys_pgrpsysp9000_intrin6_mask2lenvndioctlrmc_initsvr4_sys_mknodmrt6_ioctltcp_dooptionsdos2unixtimesys_sigactionzscnputcdeupdatpow_wsl_cloner__negdi2in6_purgeaddrtunioctlcpu_modelsystraceclosesvr4_sys_getmsgtbreaduvm_tree_RB_FINDcttyreadcd9660_unlockisp_put_gxn_id_requestsppp_to_eventuserconf_cmdswsdisplaycloserpc_replylkmclosembppwriteschedclockbpfioctlconfig_attachstty_paramxfs_dnlc_enteripsp_addresspf_state_tree_ext_gwy_RB_NEXTdl10019_init_cardep_pcmcia_enablebmtphy_statusmbpp_rwtdb_timeoutsysctl_filesys_semopdisk_unbusysvr4_sys_xstatsoisconnectedsystrace_msg_resultamap_clean_worksin_gif_inputdefheightcs4231_deviceetherip_sysctlVOP_PATHCONFdk_mountrootdb_run_modewsscreen_detach_syncauth_hash_key_md5_remreplace_endmfs_strategyppp_restartvattr_nullsys_getsockopthme_tcvr_bb_readbmustek_specialrasops24_putchar16frag6_nfragpacketstdb_initvlan_unconfigdb_linewildcardlehwresetin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlpmap_statshypersparc_cache_flush_allcpu_matchVOP_READLINKfoundfpudb_ed_stylesvr4_sys_utimesufs_seekshm_find_segment_by_shmidnsphyter_funcsmii_submatchktrpsiguvmexp_printwsdisplay_unset_cons_kbdmsdosfs_pathconfxdc_errortimeout_wheelbpf_m_xhalffdioctlaverunnablecd9660_getattragtenattachttyfreettysleepdp8390_initcarp_setrununp_disposechquirksscsi_inquireufs_getattrBlowfish_enciphervfs_exportlebuffer_cdsvr4_sock_ioctlamd7930hwintrfsrtonameuvm_km_pgremovesoftdep_disk_io_initiationpf_state_tree_ext_gwy_RB_MINMAXpfkeyv2_sysctlex_region_plpfr_ktablehead_RB_REMOVEpf_anchorsfscalenewallocindirccdmapbridge_hashwsemul_sun_translatezsenqueue_txip_optcopypf_altqssunkbd_keydesc_befrcarp_setroutevfs_registerpmap_rmu4_4csys_dupulinear8_to_alawmcllowatmii_printbpfilterattachpmap_cache_enableenc_xform_skipjacktimeout_todoswcr_initdb_lccd1400_write_regrasops8_putchar8cpumatch_mswsemul_vt100_scrollupsppp_cisco_inputudf_checkexppmap_clear_reference4mpanicsppp_ipcp_tldmsdosfs_lockseltruewsdisplay_console_devicebstp_topology_change_acknowledgedbpf_m_xwordepwatchdogautoconf_nzssoftdep_initializeipsp_skipcrypto_markncvhashtblunp_shutdownstackgap_alloccpu_confwi_resetext2fs_sysctlmark_ecngif_startcluster_callbackkthread_run_deferred_queuepfsync_bulkfailintr_fasttrapvop_lock_vp_offsetspf_tagssunkbd_decodelastdaycheck_execdb_max_linetcp_initsystrace_execve0pcmcia_attachdeferred_config_queuedp8390_getmcafipport_lastautoptmpolludf_unlocksvr4_setcontextmtty_attachnum_on_worklistcd9660_fifoop_entriescom_raisedtrnnfs_init_headpppgetmdb_last_commandsunos_exec_aout_makecmdsintr_initwinSlotCntvn_kqfiltersunos_sys_vhangupext2fs_syncproc_waiting_timeoutcryptoreadep_mii_readregstp4020_create_event_threadwcopycrypto_registercache_purgevfspostsigsys_pathconfrasops24_putcharsppp_lcp_RCN_nakgetmicrotimein_addmultimaxrasops_reconfigbridge_ifdetachmmu_3lsppp_outputipsp_acquire_sascsi_probedevpmap_page_protect4_4cesp_devtcp_templatenfs_commitmsdosfs_readdb_object_print_cmdam7990_zerobuf_contigtctrl_cdbstp_transmit_configcomopenzstty_softintsunkbd_keydesc_nlesp6_inputbcopywdog_autoncr5380_wait_nrq_timoxfs_remove_nodealtq_lookupkqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerfb_burnerxfs_unmount_commonSHA1Update_intwsemul_vt100_output_scs94cuio_applydefrouter_addreqin6_clearscopesppp_nullfifo_vnodeop_entriesp9000attachpmap_pa_existsespdma_resetaudio_free_ringne2000_readmemffs_setblockipsec_expire_acquirewsscreen_switchwaitinflateResetmemcmpwskbd_init_keymapudf_lockp9100_read_ramdac_uremmsdosfs_createcd9660_startdb_output_linecomstartauxreg_cdfbwscons_attachpool_allocator_kmemdb_examinepf_rollback_rulescfroots_sizedb_end_linetickadjvop_rmdir_vp_offsetspfsync_get_mbufpf_init_rulesetpf_rule_plpfi_kif_refsbreservevrecyclembpp_timeouthandle_workitem_freefilein_pcbnotifymissextent_printaudio_careserve_dumppagesblf_ecb_decryptcrcopydb_symformatsys_revokestp4020_map_windowip6_setpktoptionsstat_direct_blk_ptrssysctl_stringsys_rebootcompat_43_sys_lseeksvr4_sys_killpfsync_timeouttrunk_capabilitiesbufpooldl10019_mii_bitbang_writeswitchexitsunos_sys_otimesfdopenMCFailcpu_forkcompat_43_sys_getpagesizeaudioopenpfr_add_addrswi_write_data_iodb_print_ifattylistflush_inodedep_depsuvm_vslockcast5_setkeyxformswNXFORMSWdeflateResetpf_osfp_validate__bin2bcdttyoutputtvtwo_directcmapmodule_vikingsbpppollcd9660_tstamp_conv17vndbufplwskbd_calxtphy_statustqphy_cdcarp_set_ifpsemundo_cleartvtwo_setcolorcryptodev_cbudf_lookupep_pcmcia_enable1pcmcia_scan_cismbpp_hztomsfdcmatchclockintrrn_mkfreelistsvr4_sys_open64vop_bwrite_descvndreadVOP_READpfclosein6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimenfs_sndunlocksys_setuidtimeroksi_obio_dma_setupscanjet_attachstart_updatecgfourteen_caufs_quota_free_blocks2senditbridge_spansppp_lcp_tldcluster_writecompat_43_sys_waitrnd_event_tailp9100_external_videowsemul_sun_selectattributeuvm_setpagesizenfsrv_zapsockipsec_update_policyfpu_ftodtcp_xmit_timerst_rewindin6_recoverscopesunos_emul_pathsvr4_netopenmustek_attachmfs_badopufs_dirhashmemnfs_nullskipjack_encryptp9000_ras_erasecolsnsphy_servicefirstchildcompat_43_sys_fstatpf_cache_plpmap_enter4mtimer_cdch_positionbridge_ifenqueuetickmclpool_warnmsgdb_termpflog_packetmem_access_fault4mmmclosescsi_preventnumfreepagescd9660_accessmttyttybe_tcvr_read_bit1ffs_statfsxdr_inaddr_encodepmap_rmu4mzsnull_rxintcompat_35_sys_lstatrijndael_set_keyxfs_symlinkudp_recvspaceproc_root_targetsmttyopenudf_fhtovpsyn_cache_unreachuserconf_histszsys_getrlimitbpf_attachdicmp6_ctloutputsppp_qflushbridge_rtfindufs_dirremoveahctl_varsnumvndcinitif_attachsetuppipe_writevop_symlink_desccryptof_pollstat_sync_limit_hitsbappendin_pcblookup_listenrmc_queue_packetsi_vme_dma_stoppfr_remove_kentriesm_copybacknextgennumberipcomp_enableuvm_swap_puticmpbmcastechogre_allowfifo_advlockesp_zeroizeevcnt_attachSHA512_Updatedb_continue_cmdcarp_ouretherufsdirhash_lookupsoftdep_errorstp4020_event_threadtcp_signature_applyprocess_write_regsconfig_scantun_ioctlwi_get_nwkeynuidhash_maxfilt_ptcwdetacham7990_shutdownzx_burnersppp_cp_type_namefdfinishprom_inSrc_nameripsrcshminitiso_nchstatsnfsm_srvwccxyc_chainscsidebug_targetsnlineswdb_restart_at_pcdb_sstep_printpf_test_icmpether_ifattachfdcstatustunwriteinflateSyncsvr4_sys_sigactionxyioctlbridge_rtlookupsignal_initnsphyter_serviceptyioctlxyc_cmdffs_updatedb_print_formatzx_copyrowsnfs_checkexpdp8390_getmagma_cdzs_to_tiocmclear_inodedepsunix2dosfnspec_advlockfragtblraw_sendspacepfsyncifisp_copy_in_hdrxfs_pathconfnulloppf_find_fragmentam7990_meminitsttyreadp9000_ras_do_cursorpfr_copyout_addrbw_meter_chsunkbd5_keydesc_sgip6_ecn_ingresssystrace_insert_processsackhl_pooltrunk_watchdogencioctlsppp_dotted_quadcomdiagextralocunsleepX_db_lookupkernel_segmap_storeget_buffer_statusblf_encrypttdb_allocipintrsppp_ipcp_closegetnanouptimedes3_encryptmaxdmapaltq_removepfkeyv2_flush_walkerext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontrolbridge_blocknonipau_check_portsxfs_mount_common_sysq_to_bpfkeyv2_initsoftdep_process_worklistmountrootpf_tbladdr_removewsemul_sun_output_normalsafte_read_confignfsrv_setcredsyn_cache_resetdb_inputcharudf_vnodeop_entriesdb_boot_cmdsip_initreaddemsgctl1process_read_fpregscd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpf_cent_pllodirtypagesfindwin95sys_nanosleepVOP_WRITEtcp_update_sack_listcompat_43_sys_getkerninfostart_init_execputtdbpf_state_tree_lan_ext_RB_INSERTpmap_unuse_finalsppp_ipcp_upifa_ifwithaddrpf_match_uidstty_startsunkbd5_keydesc_ukprocess_checkiopermxbox_fix_rangesvr4_sys_getdentsstat_indir_blk_ptrsdb_write_cmdif_clone_attachwsmoused_releasehme_readsys_getfsstatbpfopencdstrategyrasops32_putcharbstp_set_path_costxfs_pushdirtynfsrvhashtblvlan_configkmemstatsnd6_slowtimo_chenc_xform_nulluvm_km_valloc_alignses_make_sensorsipsp_reffreedb_max_widthmntvnode_slockfilt_audiordetachstreadnv2tov_typenfsd_headcomwritemouse_copy_selectionipsec_policy_headsppp_pap_tluVOP_RENAMEoclk_set_dtcdclosecast5_zerokeysys_fchdircgtwelve_cafbwscons_initsysctl_ifqsunos_sys_exportfsbppopenalleventsrandompidportal_getattrfilt_ttyrdetachsys_ktracearp_inusevn_pollinet6swrouteswencap_findgwifadosdirtemplateslattachmainbus_cdspec_nfsv2nodeop_entriesdb_uvmexp_print_cmdspifstcintr_txvlan_tagmasksys_mincorene2000_test_memipcomp4_input_cbrasops8_putcharlastsecondswdog_timeoutsunkbd_bellstopwi_get_txpowerip_mrouter_doneaudioactivateffs_vnodeop_entriestcp_maxpersistidlesvr4_readdir_callbackspec_ioctlnewblk_lookupufs_initsync_vnodeop_entriesproc_reparentpf_osfp_getbstp_designated_for_some_portuvm_exitcompat_43_sys_sendfc_bmapcallspr_rmpagepfr_ktablehead_RB_FINDffs_initbridge_filtersppp_chap_tluzx_cadvmamap_extentnfssvc_sockhead_flagcluster_wbuildvigra_castpmatchuvm_initvigra_cdsys_ioctlnfs_renameitsys_xfspioctlsunkbd_keydesc_svif_free_sadlktrsyscalldb_dotquotaon_vnodetslot_io_unmapfilt_bpfrdetachwsdisplay_emul_caudf_startst_loadquirksicmp6_initrasops15_putchar16filt_ttywritepool_update_curpageaudioamd_cdin_setsockaddrptcclosetslot_resetpmap_is_modified4_4csunkbd_keydesc_dkzs_write_csrrandom_statepfi_dynaddr_updatenfs_advlockbpf_moveinacct_procwsemul_vt100_output_esc_spcostypevndbuf_poollastpiduvm_page_physloadaudiogetinfoptswriteprocfs_mountsensor_task_createipintrqepintripcpermgre_clone_destroyccd_softcsoftdep_workitem_pendingvlan_ioctlpfi_attach_ifgroupmaxproctslot_functionszskbd_cnpollcip_slowtimopmap_clear_modify4msi_obio_intr_offpagedep_hashtblnfs_setattrrijndaelKeySetupEncbstp_hold_timer_expiryip6_nexthdrrtdeletemsg__bss_startqsync_vnodespifmatchbeattachpv_syncflags4mpf_get_ruleset_numberauxio_regshm_nusedrpc_mismatchrijndael128_encryptVOP_KQFILTERpf_calc_skip_stepsukphy_funcssys_msyncvop_rmdir_descallocdirect_mergedeflate_compresswskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disablepf_change_apxfs_islockedsoftdep_fsync_mountdevinitmsgbuftcp_signature_tdb_zeroizexfs_symlink_commonconfig_activatememsetsema_initcuio_copydataptsstoppipe_free_kmemxfs_message_versionufs_getlbnspmap_clear_modify_pprocfs_reclaimphysiopcmcia_3cxem556_func0_cfe0nfs_realign_testin6_selecthlimdb_symbol_is_ambiguousaudiocs_cdxyc_resettrunk_fail_startmii_phy_delete_medianfs_cltpsockcrypto_kdispatchicmp_mtudisc_clonesppp_print_bytescgsix_caclass_cmpsodisconnectpool_allocator_oldnointrsys_setgroupsmainpmap_rmk_plxtphy971_funcsnfs_vfs_initprocess_sstepbppioctlpf_anchor_setupisp_attachcarp_ioctlpf_remove_fragmentrasops_init_devcmapipsec_acquire_headktrgeniopfr_clstats_ktablepfr_insert_ktablesip_flushdp8390_configrasops_mapcharnfsspec_closeaudio_polluvm_unmap_removetickdelayzsreadfd_typesinpcb_pool_initalizeddb_hangmanicmp_errorxfs_access_commonuvm_swap_markbaddes_set_keykqueueopsaudio_pintpf_addrcpyoldmon_w_tracevholdqestartdb_help_cmdsbppmatchsystrace_wakeupsl_clone_createm_adjalaw_to_ulinear8loadfpstatemld6_stop_listeningppsratechecksys_ptracescsi_free_xskmemlimitcompat_43_sys_setrlimitfilt_tunwritegre_softc_listncr5380_cmd_timeoutamap_copydvma_mapin_spaceuvm_rb_spacedevinnew_xfs_nodesysctl_kmemlocksirlf_findoverlapcs4231_set_portovbcopysvr4_sys_statcarp_proto_inputlf_wakelockdoclusterrazdb_sym_numargsvmel_cadumpconfwi_rxeofsunkbd_enableskipjack_forwardssys_shmatpf_match_addrfilt_rndwdetachwsdisplay_cons_kbd_pollcdead_badopoclockattachsparc_interrupt4mcalcrusys_unlinkblf_cbc_decryptdb_cmd_listrt_setgatesetpte4mdqrefsema_gettcp_ack_on_pushtrunk_port_createzsaddrext2fs_rmdirsysctl_intkqueue_closewsdisplaystoppfr_clr_addrsstrlcatifnet_addrssysctl_int_arrulinear8_to_mulawau_set_gaindisk_unlockpf_test_tcpep_roadrunner_mii_enableufs_ihashrempf_map_addrcttywriteoclk_get_secssvr4_elf_probesdmatchpagetables_endpool_chk_pageproc0ccdopenufs_renamesppp_lcp_inittslot_printext2gennumbersvr4_sys_mmap64rt_ifannouncemsgsoo_readhme_reset_rxcompat_35_sys_shmctltbattachufs_openbstp_set_port_statepfr_ffaddrxfs_message_installnodem_catidle_uzsstoprtinitprocfs_freevpncr53c9x_variant_namestqphy_statuszskbd_stsoftcluster_collectbufsepbusyeepromcpcbuvm_swap_inittcp_nowttystatsdb_trace_until_matching_cmdproc_printitpfi_match_addrdes1_setkeyunp_gcsys_clock_gettimecsefreeip6_hdrnestlimitpool_catchup_uremreplaceswift_hotfixfrag6_initpf_enable_altqbuf_replacevnodemsdosfs_vnodeop_opv_desclba2msfvlan_ifdetachtimeout_settrunk_list__subdi3pfi_kif_updatetctrl_read_datawsdisplay_resetprocfs_docmdlinepf_state_tree_id_RB_FINDntohsgetptep4mmsgbuf_putcharinet_ntoadb_boot_poweroff_cmdcgsix_ras_eraserowssd_flushcd_setvolext2fs_mkdirext2fs_direntermii_pollstatpfkey_registerst_erasedupfdopenchange_sign16_bexfs_attr_validnfsrvlruheadifmedia_list_addpidhashvfs_mountrootpfr_lookup_addrtree_src_trackingbe_cdsppp_lcp_TOuvm_totalbtcham_caencdebugpfr_table_countsvr4_sys_fpathconfzx_eraserowscs4231_halt_outputdb_unread_charcgtwelvematchdl10019_mii_bitbang_opstimestat_worklist_pushvme_cdstart_initelf32_olf_check_headerbe_tcvr_write_bitsvr4_sys_sigprocmaskpmap_copy_page4mtcp_mssdfltbt_putcmapuvm_swap_freetcp_rndiss_sboxsbus_establishxfs_lookupudf_hashlookupcgsix_setcolorpfi_unmaskzx_attachzs_iflushrnd_wseldb_look_charin_pcbdetachmsdosfs_vfsopspf_state_tree_id_RB_REMOVEienab_bic_4mcd_sizettycheckoutqpmap_zero_page4_4cicmp6_mtudisc_callback_registerdb_set_variablene_pcmcia_detachrnd_event_spacert_getmetricsin6_ifdetachcn_tabdb_search_symbolvndstartfree_all_xfs_nodesip_forwardppp_compressorszx_resetextent_createxdstrategybstp_timer_startbpf_freeddisklistslinear16_to_alaw_leswap_bytes_change_sign16_bexfs_revokeallocindir_poolsys_fstatfspfsync_tdb_timeoutpfr_ina_rollbackpfsync_inputsvr4_trappmap_clear_reference4_4cidpromm_injecttvtwoattachbusprintnd6_setdefaultifaceffs_isfreeblockccdioctlufsdirhash_uninituvm_map_lookup_entryxfs_fhlookuphztoBlowfish_expandstatevop_pathconf_descm_pullup2emul_sunoszscngetcdead_strategymtty_matchvif_deletektrcswspec_fsyncpriq_pfattachip6_optlenportal_unmountuvm_map_deallocateicmp_reflectpf_anchor_node_RB_MINMAXp9000_burnerpmap_dumpsizemii_phy_activatesunkbd5_keydesc_noext2fs_reclaimsvr4_add_socketffs_ballocsys_getgroupsuvm_km_pages_freesystracef_pollsvr4_stream_getmakememarrpfkeyv2_createip6_raw_ctloutputsoftdep_setup_allocdirectpf_rtlabel_removekernel_textufs_startxyc_errorcs4231_set_paramslkminitkinfo_vdebugnsphy_resetzstty_stintuvm_rb_insertufs_bmaparrayfragtbl8nfsv2_typepfioctluvn_sync_locksysctl_initpcmcia_function_enableaes_ctr_setkeycgeightmatchpf_mv_poolxyc_piodriverufs_quota_alloc_blocks2fc_fileextendsexport_lifetimefilt_sigattachVOP_FSYNCtslot_intr_disestablishmgx_mmapffs_sysctlipport_hilastautoarpinit_donespec_closecd9660_closectx_freencr5380_pio_insys_shutdowncngetcam7990_resetesp_dma_stoppfsync_alloc_scrub_memorypfi_instance_addprom_vstartgetcacheinfo_sun4cxfs_readlinkrnd_statesm_gethdrsunkbd5_keydesc_svvmeintszs_shutdownbridge_inputconfig_rootfoundzstty_diagzs_getcputcsysctl_rdstructtrapregion_lockedschedcpusematprintf_closesbappendcontrolwsdisplay_screenstatenfs_lookitupwihap_sta_timeoutsi_cdesp_switchsoftdep_flushfilespf_frag_tree_RB_INSERT_COLORipv4_inputm_getclrpool_headcompat_43_sys_quotaptsopenax88190_mediastatusncr53c9x_watchfpu_mulnfs_in_tobecommitted_rangesysctl_ptyncr53c9x_msginpf_tag_refvigra_intripforwardingdb_lexaudio_calc_blksizebufhashtblsyn_cache_lookuparc4random_statefpu_addprtactiveaudio_mmapksym_upcaseufs_makeinoderasops_copyrowsip6_process_hopoptsxfs_message_updatefidufsfifo_readsystrace_lckwsdisplay_set_cons_kbdpfkeyv2_sendmessagefifo_writefilt_ttyreadsys_getpgidcom_common_putccache_lookupaudio_clearred_allocin6_purgeifrijndaelKeySetupDecfree_msghdrsdb_boot_crash_cmdsystrace_forkle_cdnewdirremrijndael_encryptdp8390_intrstackdumpbwtwo_burnerrasops_do_cursorfbnodepf_state_tree_id_RB_REMOVE_COLORpv_unlink4mwsemul_vt100_handle_dcstadpole_bellin6_ifawithifpncr53c9x_donesunos_sys_sigreturnpf_altq_pldumpsizewskbd_set_console_displaypppoutputccdstrategystp4020_chip_intr_stringxfs_write_commontunattachpppstartextent_freeuvm_aiodone_daemontslot_queue_eventaddupc_tasksched_synctslot_slot_intrsc_err1comclosepcmcia_print_cisnewblk_hashtdb_add_inpsetsigvecmountnfssys_sendmsgbridge_rtdaddrvn_marktextsppp_isemptyam7990_readstrcmppf_print_hostsys_quotactlvop_close_vp_offsetsep_vortex_mediatrunk_clonerwdog_initrndread_filtopsbstp_enable_change_detectionisp_asynctcp_mtudisc_increaseulmaxin6_pcbconnectdehashpmap_page_protect4msystrace_msg_policyfreeluphy_cacarp_ether_purgemultihook_disestablishtctrl_brightnessbpf_catchpacketstrayintrffs_isblocksystr_proc_plrfx_getcmapdb_stack_trace_printpf_anchor_node_RB_REMOVEmgx_burnerpf_anchor_node_RB_REMOVE_COLORcgthree_ioctlcgfourattachuvm_swap_allocpagesuvm_aobj_pooltrunk_rr_port_destroypfr_insert_kentriesmouse_copy_extenddb_examine_cmdqsphy_funcsicmp6_reflectsetrunqueueudv_attachsettimertable_initpppdumpbhfsc_remove_queuedp8390_detachvop_access_descqe_tintmii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsxdc_perrorttyrubpfsyncattachrevarpwhoamitrunk_ioctlvop_generic_islockedauth_hash_hmac_sha2_256_96mgx_cdbufcachepercentwsemul_vt100_output_stringwsscreen_attachmfs_ioctlm_pulldownnewdirblk_pooldayyrpmap_initufs_rmdircryptodevkey_cbminip6_initconfig_detach_childrencgfourteen_loadcmap_immediategif_softc_listrawcbtcpcb_poolz_errmsgpf_addr_wrap_neqmgx_ioctlsppp_chap_openmii_bitbang_readregBlowfish_stream2wordudf_openswallow_zsintrscarp_prepare_adipip_allowsys_pollalaw_to_slinear16_beuvm_map_clip_endufs_makedirentryvlan_vlandev_statepf_normalize_tcp_statefulmodule_sun4ckcur_mulreplacenfsrv_getcachecbq_getqstatshme_putvnode_hold_listpmap_enter4_4ccgfourteen_loadcmap_deferredlastdosdatetadpole_powerdowntrunk_media_statusssopenufs_linksys_mkfifodb_cmd_searchifa_ifwithafhandle_written_mkdirpcmcia_parse_cis_tupletimerreg_4min6_leavegroupiminsddumpsppp_cp_sendsys_chflagsstp4020_chip_mem_mapbestoppfsyncoutputdelaysdstartpower_regvattr2xfs_attrinitiate_write_inodeblock_ufs1ch_get_paramsskipjack_decryptddb_regsbstp_received_tcn_bpduacct_shutdownvt100_outputuvm_km_putpagepf_fragqueuesoft01intrpmap_clear_reference_pxfs_open_validext2fs_vnodeop_pcarp_ether_addmultiuvm_pageoutpf_qid_unrefncr53c9x_timeoutpffindtypepdevnamesp9000_ras_copycolszshwiflowinodedep_in_progressqsyncwi_setmultififo_opencd9660_vptofhsystrace_replacefreewi_attachmii_phy_downuvmspace_forkraw_initsemundo_adjustknote_enqueueswap_bytesvigraattachmodule_turbosparcudpcksumtcp_sendspacedl10019_mii_writeregisp_startdb_maxoffmmuregionsffs_oldfscompatnfs_rmdirrijndael_decryptmaxlocksperuidpf_get_mtagin6_matchlenstat_dir_entrysys_madvisetadpole_get_videopfr_tst_addrstctrl_matchscsibusdetachxdr_string_encodesystrace_setegiddisk_attachwskbd_displayioctlncpusdb_cmd_loop_donexdattacharptfreevlan_ether_addmultisppp_pap_inputipq_lockeddb_show_arptabcom_detachbstp_root_bridgefifo_vnodeop_pvop_write_descep_isa_probemediavop_read_vp_offsetsmfs_startdead_printmii_media_tablewscol_whiteswap_bytes_mtstcp_rndiss_encryptxycloseflush_pagedep_depsttyprintfccdinterleavesigcodeespdmaintrdb_elf_search_symbolipip_inputpfkeyv2_parsemessagedb_delete_watchpointcomttyne2000_detectbuf_undirtysysctl_tstringrmc_dropalldma_setupnfs_unmountnfsrttmsqidsdb_watchpoints_insertednfs_fsinfofilt_ttywdetachxdsizeuvm_tree_RB_INSERT_COLORvop_unlock_descpool_allocator_nointrsys_sysarchpf_src_tree_RB_NEXTBlowfish_deciphermustek_readpf_state_tree_lan_ext_RB_REMOVE_COLORigmp_initpfsyncstatspmap_zero_page4mcgsix_ras_initmii_phy_add_mediaqec_fix_rangenfs_del_committed_rangeputphysbufnfsv2_vnodeop_entriesvop_remove_vp_offsetsMD5Initpfi_attach_ifnetqsclockregcryptodesc_poolbwtwo_mmapffs_vfsopssysctl_mallocwihap_ioctlfpu_ftoifrag6_slowtimouvm_map_hintcgtwo_putcmapwant_reschedppp_deflatephtree_SPLAY_REMOVEmsdosfs_mkdirkthread_create_deferredrasops8_initnfs_xdrneg1xycmatchzx_do_cursormbpp_recvexport_keymtty_modem_controlscsidebug_busesscsibusactivatezsparamnd6_timertcp_do_ecnportal_symlinkvop_open_descmsghdrssemexitqsphy_servicezx_fillrect__cmpdi2svr4_sys_ulimitcd_patternszstty_rbuf_hiwatraw_detachaudiodetachnfsrv3_accesscarp_addrcountcompat_43_sys_stataudio_writexdc_ioctlcmdlebufattachmulaw_to_ulinear16_ledomainnamelenmgx_cacd1400_write_ccrtslot_mem_freenfs_sendip_rtaddrfiledesc_initudf_initvrelewi_set_pmcallromprtrealloccheck_consoleapm_record_eventhme_mii_readamap_freebstp_ifupdstatusxfs_devopenin6_domifattachwsdisplay_cnputcpfr_ktablehead_RB_REMOVE_COLORses_matchpfi_set_flagsswreadcgfour_setcolornd6_prefix_lookupxfs_pollcddonesync_inactivexfs_uprintf_devicespec_printlocleanpagesarc4_stir.uremtimermatchext2fs_lookupmsdosfs_opendvma_cachealignext2fs_linkvop_generic_revokecpu_switchfifo_printfilt_sigdetachtcp_do_sackvigra_setcolorext2fs_renameesp6_input_cbipsec_def_authmii_activatettywflushcd9660_rrip_offsetwskbd_default_keyrepeat_dataclosefvop_rename_descpfsync_clear_statespf_state_tree_id_RB_NEXTcomioctlsoftdep_sync_metadatapf_setup_pfsync_matchingpmap_releaseagten_loadcmapif_clone_lookupudf_vnodeop_pgetmicrouptimemii_ticknfs_mount_disklessip6_dad_countuvm_pager_dropclusternfs_fhtovpfilt_generic_detachsensor_task_unregisterprocfs_symlinkpool_print1exec_aout_prep_omagicsppp_auth_sendpcmcia_card_deactivatenfsrv_fhtovpdb_breakpoint_listwi_pcmcia_matchksymsread.remcd_get_parmsespctl_varsnd6_ifptomacsppp_chap_TOamap_unaddshmseqscd9660_printif_congestionshmsegsnfilesepstatusindirdep_poolipcompstatcd9660_islocked__bcd2bincgtwoattachsvr4_sys_setrlimitin6if_do_dadrevarpwhoarewecryptodev_keypipe_kqfilterext2fs_openportal_vnodeop_opv_descacct_threadscanjet_readsoftdep_setup_directory_addmsdosfs_vnodeop_entriescgtwelve_accessopstun_switchmulaw_to_slinear8st_mode_sensefreeblks_poolstopprofclockdb_hangcom_obio_enablestat_blk_limit_pushbstp_etheraddrnullioctlcryptof_closeipsp_ref_matchportal_linkisohashparsediskncr53c9x_schedbstp_timer_expiredp9100_intralaw_to_slinear8wi_set_debugbstp_transmit_tcnbreadamap_lookupnetaddr_matchnfsm_srvpostopattripctl_varspf_osfp_addrt_timer_remove_allwskbddevprintksymsclosesbpp_cdsunkbd5_keydesc_escompat_35_sys___semctlsoftdep_setup_allocindir_pagewsdisplay_closescreenexport_identityxfs_checkexpsvr4_sys_creattctrl_catcp_usrreqdb_playscompat_10_sys_shmsysuvm_swap_needdecryptmfs_vnodeop_entriesnfs_getnickauthsd_interpret_senseudp_usrreqrmc_delay_actionifmedia_initext2fs_vfsopsext2fs_inactivedead_bmapdb_guessespf_send_icmpesp4_input_cbif_getgroupmemberssoo_kqfilterne_pcmcia_disablefpu_explodefifo_pathconfcpu_startuptvtwo_mmapquotaonpfr_setflags_ktablettcompatsetflagswsemul_vt100_output_dcs_dollaramap_refcompat_43_sys_lstatpfr_get_tablesam7990_putfilt_fifordetachdb_command_loopxbox_cafilt_fiforeadfb_free_screenfdexpandtickssrandommsdosfs_closehme_eintncr5380_intrext2fs_setattrxdr_inaddr_decodehfsc_remove_altqsysctl_clockratevn_rdwrnd6_need_cacheip6intrsys_msgctlsync_crashrw_exit_waiterssystrace_msg_askprocfs_badoppfi_buffer_maxsvr4_sys_sysarchuvm_pagedeactivatevop_write_vp_offsetssunos_sys_quotactlcarpdetachpf_find_mtagufs_unlockep_pcmcia_activatesvr4_sendsigtcp_ctloutputccdbufplmono_timeukphy_statusMD5Updatepf_anchor_global_RB_NEXTblktochrvop_create_descpf_purge_expired_statesifmedia_setpcmcia_function_initpmap_createuvm_map_extractnfs_readdirrpcnfs_msgnd6_prelist_addpf_get_translationufs_removeboottimecd9660_readlinkaudioamd_cacgthree_intrwsdisplay_set_console_kbdVOP_ADVLOCKdb_watchpoint_cmdxfs_onqbridge_updateqe_cdzx_erasecolsfrag6_inputsunos_sys_fchrootunpst_sendspacewsemul_vt100_output_escnfsrv_mknodpf_find_state_allptcreadpf_osfp_fingerprintrasops8_makestamptcp_rscalettwakeupuvmspace_freepmap_enk4_4cext2fs_inode_poolipsec_common_input_cbpfr_del_tablesswbufffs_ino_poolcryptopollmulaw_to_ulinear16_bevmes_camii_phy_statusmsgpfkey_initwsdisplay_internal_ioctlVOP_PRINTfdsharenfsrv_removebuficmpv6ctl_varsxfs_printinverse_regioncdstartcompat_35_sys_fstatpf_pabufsnapshotbstp_topology_change_timer_expiryclockfreqsppp_pap_tldfilt_generic_readwriteuserconf_disablevlan_ether_purgemultivrefspechash_slockiematchtun_clone_destroylewrcsripforward_rtbsd_to_svr4_speeddb_elf_forallvt100_ansimoderasops_lmaskfifo_nfsv2nodeop_opv_descdb_set_temp_breakpointticket_pabufsys_nosysallprocpf_tag2tagnamecdevswzskbd_cngetcnfsm_uiotombuftun_createstp4020_chip_intr_establishne2000_attachfree_diraddsys_mlockallvndsizegallant12x22pmap_rmk4_4cwskbdcloseuvm_sysctlwskernel_bgstatintrgetsnepstopsrmmu_get_asyncfltsys_fchflagsnamei_pooldisksortrt_timer_countpowerhook_disestablish__builtin_saveregscryptodev_opfilt_audiowritefpu_stofhme_rintukphymatchuvm_pager_putmfs_mountzs_cdmmumodhypersparc_get_syncfltip6_ecn_egressin6_gif_outputin_canforwardvlan_inputrasops_unpack_attrremove_selectionwsdisplay_shutdownhooksrmmu_cache_flush_allpf_state_tree_ext_gwy_RB_INSERTxycattachsrmmu_vcache_flush_segmentwi_pcmcia_attachrasops_copycolspmap_destroyscsi_mode_selectnfsfifo_writehme_mediachangepowerhook_listam7990_configetherbroadcastaddrprocfs_getcpuinfstrpfi_dynaddr_setupsunos_sys_unmountfdcpseudointrvfs_getnewfsidvndunlockudp6_ctlinputitimerroundudf_vptofhwdog_shutdownuk_cascsi_print_sensemmopenwskbd_update_layoutffs_inode_freeSHA384_Update_intpf_normalize_tcprtioctlipsec_acquire_pool_initializedzx_cdeptxstatprofprocsip6_inputtbr_getxfs_rename_commonxfsdebpagemoveroute_srcspeedup_synceraudio_blk_msigmp_sendpktesp4_inputpfkey_senduploop_clone_destroypriq_remove_altqcgeight_cdsunos_sys_fcntlifmedia_baudrate_descriptionsv_putcsystrace_msg_childipcomp_attachgre_clonerm_getptrviking_cache_flushufsvnode_filtopsccdmakedisklabelpf_send_tcpreadbufferspfi_skip_ifqecmatchuvm_fault_unwiresppp_cp_change_stateuserconf_common_attr_valext2fs_vnodeop_entriesipseczeroessys_getitimerhme_tcvr_bb_writebdoniceudf_allocvmerge_inode_listsetherip_inputcpu_configureip6_freemoptionszscnpollcptcopenaudio_alloc_ringmodule_sun4udf_syncne_pcmcia_matchwsdisplay_common_attachpool_page_alloc_oldnointruvm_swpkeysdeletedzs_attachrn_refinesmfs_statfshmac_opad_buffersockargswsdisplay_getactivescreenvmes_scanvop_generic_abortopstattachchattachsetregshandle_written_filepagepfr_prepare_networkepsetmediaufsdirhash_delslotnfs_rcvunlocksobindvmcmd_map_zerodb_read_charzstty_matchxfs_readnfs_asyncdaemonnfs_del_tobecommitted_rangevfsinitarcbroadcastaddrcnclosetimer_canfsm_adjdb_tok_numberrfx_setcolorrasops24_initsddonereplacemultcp_do_rfc1323ip_fragsxfs_remove_commonfilt_fifowdetachsvr4_sys_lxstatmii_phy_setmedialo0ifphostidpool_chkaudio_ioctluvm_pagermapoutcheckreplaywindow32ipqmaxlenktrsysretnam2blkext2fs_vptofhnfs_linkdefwidthtadpole_set_videoesp_wrreg1ip_maxqueuesysctl_ttyamd7930_halt_inputamd7930_set_paramsin_socktrimsys___semctlmmusegmentsext2fs_dinode_poolsys_mprotectrtallocpf_find_state_byidsunkbd_keydesc_usnfsrv_updatecachemsdosfs_reallocblksvop_readlink_vp_offsetspt_softc_lockwi_pcmcia_cazs_def_cflagpfkeyv2_ipo_walkbridge_rtflushdequeue_randomnesssyncer_maxdelaypf_normalize_initwsdisplay_getscreencs4231_allocdeadprocstart_reaperuvmspace_unsharesys_fcntlisp_prtukioctlpf_change_areq_clear_removevfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_createsvr4_termio_to_termiosuvm_map_cleanicmp_redirtimeoutccdiodonexfs_initqsppp_chap_scrpool_allocator_drainulinear8_to_linear16_lettyclosedisk_resetstatmfs_inactivemtty_paramicmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdep_pcmcia_disable1ip6_forwarddb_fncallme_freenumcachenfsrv_linklkm_nofuncintr_establishcpu_initclockswskbdioctlmii_downkinfo_vgetfailedbrelseext2fs_unmountpsratiosdminphysbe_ifmedia_stssppp_close_eventaudiokqfilterwsdisplay_switch3ttyoutDebuggerdevice_lookupuvm_map_psppp_dequeueinodedep_hashtblnfsrv_statfssystraceopencdminphysnumcleanpagesschedhzrip6_inputlkmdispatchp9000_ras_copyrowsfd_motor_offuvm_tree_RB_MINMAXtcp_totbackoffuserconf_basexfs_vptofhSHA256_Initlooutputtasklistwsemul_sun_outputrijndael128_zerokeysoisdisconnectedcpu_coredumpdvd_read_disckeyuvm_aio_aiodonecrp_req_queuesystrace_attachsvr4_sys_sysconfigss_set_windowcrypto_freereqclrbitsdb_boot_dump_cmdvndshutdownufsdirhash_initstp4020_chip_socket_enablepcmcia_card_intrmii_phy_statusnfs_repheadzs_hwflagspfkeyv2_dump_policyfdwritepf_anchor_node_RB_INSERTcommajordl10019_mii_resetle_cascsidebug_levelxfs_devcrypto_newsessionp9100_accessopsgre_sysctlsoclosemfs_bmapnfsrv_pathconfwakeup_nsys_connectptmreadbuf_daemoncarp_outputsys_nfssvcintr_sbus2ipl_4mvmeintr_establishufsdirhash_buildskpcsvr4_sys_contextluphy_funcsdb_leipv6ctl_varsroute6_inputcgfourteen_burnervlan_startcompat_43_sys_mmapvop_read_desczstty_rbuf_lowatcluster_newbufsys_socketpaircnreadbwtwo_catctrl_init_lcdfdcretryudp6_sendspacedounmountuvm_swap_allockthread_create_nowwskbd_pickfreealaw_to_ulinear16_bess_identify_scannertcp_ackdrop_ppslim_countdb_elf_line_at_pchmeattachpool_cache_destroyprom_vendchkdqchgttspeedtabulinear8_to_linear16_le_mtsledma_cdkqueue_readzx_mmapcgfourteen_cdpmap_copy_page4_4ccd9660_mountst_mode_selectufsdirhash_addnfsrv_renameuserconf_maxdevfork_tfmratelxtphymatchpv_sizeah_zeroizewskbd_activatewsdisplay_cons_pollmodepfr_sin6wi_media_statuswsemul_sun_output_controlnd6_purgecarp_multicast_cleanupshm_pooldb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdiszerodevtrunk_inputpfsync_sync_okcgtwo_cacpu_spinupcarp_clone_destroyauth_hash_hmac_ripemd_160_96vop_advlock_vp_offsetsscanjet_set_paramslf_freesys_fhstatsparc_ist_unmountnullmodemwihap_sta_deauthsystrace_setscriptnamememreg_cdsunos_sys_ptraceif_attachdomain1raw_recvspaceccdunlockpfi_ifspf_disable_altqdiskerrwi_startptyattachcd_cdwsdisplay_screentype_pickudf_bmap_internalpf_qidscompat_09_sys_getdomainnamewsdisplay_addscreen_printdb_machine_commands_installsunos_sys_ioctlsun4_vcache_flush_regionsys_preadne_pcmcia_activateuk_switchmgx_loadcmapkmem_mapcd9660_check_exportconfig_pending_decragtenmatchqsphyattachcpumatch_sun4soqinsquediskstatsauxregbiscdes_ecb_encryptswap_key_prepareudp_inputieattachnchrtoblktblvigra_loadcmap_immediateihashrn_search_mresettodrpmap_protect_pufs_readdirsys_flockarc4random_initializedspifsoftintrlkpvspec_badopcgtwelve_cdmbppclosemsdosfs_linknode_has_propertymustek_minphyshfsc_add_altqpfr_ktablehead_RB_MINMAXicmpctl_varsigmpstatsppp_proto_nameudf_bmaprwindow_savevn_initialize_syncerdpf_check_proto_cksumsafte_read_encstatcd9660_quotactlpmap_dumpmmuicmp_sendwrite_user_windowsrasops1_erasecolshme_reset_txufsdirhash_adjfreepfi_get_ifacesvop_bwrite_vp_offsetsbsdi_stringsopenpromclosetime_uptimekrpc_callsowakeupses_cool2sensorinsidecgfourteen_resetsystrace_make_msgpfr_nulltabledb_putstringsvr4_fil_ioctltcp_clean_sackreport_edatatctrl_bellmttyreadmouse_copy_linesigactsunsharetimeout_hardclock_updatespppattachrijndael128_decryptpf_match_translationttkqfilterrfx_castpattachwaittimem_tag_deletecd9660_ihashremepinitxfs_setpag_callip_fragmentsys_statfscarp_send_arpSHA1Finalexport_flowrawin6pcbtablescanjet_compute_sizespool_cache_invalidateslinear8_to_alawp9100_burnerkprintfdevice_unrefrc4_keysetupcgfourteen_setcolorscsi_startvnode_poolin_cksumdeflateInit2vnode_free_listpfsync_tdb_sendoutfdcioptcp_savetiuvm_pagereallocncr53c9x_reselectbsd_to_svr4_termiosuvm_fault_unwire_lockedklist_invalidatepmap_extract4muvm_km_createthreadipsp_process_doneaudioprintpool_printitpfi_ifhead_RB_MINMAX_endgetpropdes_check_keysogetoptsoftdep_freequeuearc4maybeinitp9100_ras_do_cursorfdprintzs_write_datatun_softc_listdb_deletewatch_cmdsoftdep_load_inodeblockwsemul_vt100_attacharp_intimervlan_clonerpollscandomaininitvflushbuftime_secondip6_forward_rtslioctlsppp_lcp_openpfi_dynaddr_removewskbd_get_mapentryinitiate_write_filepagevndclosenfsrv_slpderefsbcreatecontrolsys_mlockpf_cachequeueinitfpstatefpu_xtofdvd_read_structzs_get_chan_addrportal_vfsopscompat_43_sys_getpeernamencr5380_abortvdevgonehtonswrite_all_windowssunkbd_keydesc_sfdb_show_callout_bucketbucketkqueue_writesys_syncnfs_readdirplusrpctrunk_port_ioctlaudio_selwakeuppf_addr_incfddkdriveripsp_process_packetcominitsunos_sys_rebootie_mapzs_enablenfs_pathconfmb_mappgt_allocatorfpu_newnannfsstatsenodevffs_mountfsslinear16_to_alaw_bein_delayed_cksumsrmmu_pcache_flush_linein6_is_addr_deprecatednfs_rcvlocktslot_intrwsemul_vt100_edzsioctlpf_ip2keyicmperrppslim_lasttrunk_clone_creatertstatttvtimeoutncr53c9x_intrspeclisthbdwritencr5380_reset_scsibusvndattachsppp_open_eventVOP_INACTIVEswap_decrypttcp_syn_cachepfsync_setmtuwsemul_vt100_translatesoftdep_deallocate_dependenciessunkbd_keydesctabfd_do_ejectwihap_sta_is_assocprocfs_lookupkputcharsys_getsiddb_trace_until_call_cmdRMD160Initss_gen_quirkscompat_43_sys_sigstackrasops15_putchar8trunk_port2reqfileheadvndsetcredrc4_cryptxfsnextvnodeidcttypolltadpole_get_brightnesssys_swapctlpfsync_pack_staterasops1_do_cursorbd_reqsvr4_sys_pwritest_patternsch_patternsspifstcintrin_selectsrcmsgscpu_exitfdgetdisklabelhmestartbpfilter_destroyunp_attachch_moveimport_credentialstcp_syn_bucket_limitpty_getfreesys_renamernd_rselpfr_get_addrspnozz_cafrag6_nfragsip6_log_timepf_flush_fragmentsxdcattachrtalloc_mpathcd1400_enable_transmitterufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnms1_cache_flushsys_shmgetlebuffer_castp4020_queue_eventsbflushipsec_require_pfsswapdevwsdisplayttyrominterpretsysctl_intrcntvn_readfilt_ptcreadah_massage_headerspfs_vlockbwriteleavepgrpqsphy_cdagten_accessopsuvmpageropsuvm_page_initudf_closestatminufsdirhash_movewihap_sta_alloccast5_decrypttadpole_set_brightnesspf_match_tagsi_vme_intr_onwsfont_locktcp_timer_funcsipqent_poolbufq_default_addif_attachdomainpfr_set_tflagsaltq_pfattachicmp_ratelimitinvalhashsegm_lockedieintruvm_km_page_initrttimer_poolipe4_attachax88190_mii_readregtdb_soft_firstusepfr_clstats_kentriessosendsema_pooldosetrlimitrn_initxycintrbufq_default_getloopattachdp8390_watchdogukcloselkmexistsnfs_hashlockzs_matchled_scRMD160Finaldb_listwatch_cmdtslot_intr_stringnfsm_reqhchainlengthprocess_read_regsau_get_gainesp_dma_gopagedep_poolrn_lookupuvm_map_reserveudpencap_ctlinputstate_listallocate_copybuffernum_dirremuserconf_show_attrsys_execveencoutputfdallocwsdisplayreadstp4020_chip_io_freemmu_reservemon4_4cudf_vnodeop_opv_descscsi_doneespmatchnfsspec_writechkvnlockhw_sysctltrunk_clone_destroydb_siftingxfs_readdir_commondb_look_tokentcp_syn_cache_limitconsintrnumvnodescryptof_ioctlcomreaduvm_pagefreecompat_43_sys_acceptpf_frag_tree_RB_INSERTie_cdportal_startcgsix_burnerext2fs_inode_allocswcr_encdecpmemarrwsdisplay_switch2db_examine_formatin6_pcbbindcluster_rbuildreapercompat_09_sys_unamecoredumpfilt_kqueuetvtwo_resetmalloc_roundupnfsrv_readep_mii_syncled_capipe_readaudiostartpifioctlsys_utimesdb_symformatssun4_vcache_flush_contextlkmenodevpmap_is_referenced4mwscol_blacknd6_storelladdrsunkbd_keydesc_sv_nodeadrip_initsocreatesystracef_statcgeightattachureadcbppwriteufs_setattrrijndael128_setkeylogpridoclusterreadregion_freelisthandle_workitem_removecast5_encryptsys_exitsystracef_close_uremreplace_endsbtrypf_state_scrub_plnfs_decode_argspmap_kenter_pa_pm_applymodule_unknownswcr_processcryptof_writefree_newdirblkpppasyncstartamd7930_trapsadb_exts_required_indb_watchpoint_listeeprom_givealtq_disablecd_playsys_clock_getrespmap_is_modified_psyn_cache_insertbridge_rtupdatespec_bmapttystats_initmustek_rewind_scannerne_cdncvhashpool_cache_destruct_object_remreplacesvr4_sys_utimefd_motor_onbstp_acknowledge_topology_changend6_umaxtriescarp_set_statetag_unreffindzsienab_biccarp_suppress_preemptpcmcia_intr_stringcbq_add_altqnd6_debugpf_hash_rule_addrfpu_itofstdumpzskbd_rbuf_size_divwindow_deflatedb_delete_temp_breakpointpf_src_tree_RB_INSERT_COLORsunkbd5_keydesctabcpu_cpuspeedudf_vgetget_random_bytesrfx_cdmagma_attachSHA1Transformmrtdebugesymcrypto_invokeosreleasevndiodoneVOP_RECLAIMpf_empty_poolturbosparc_hotfixipcomp6_inputgre_inputpflogioctlspec_nfsv2nodeop_phmematchtcpqe_poolpgrp0filt_ptcwritewihap_timeoutuserconf_changegetpropstringmakefstypedb_paniccddkdriveruvm_anon_addwsemul_sun_resetuserconf_helpufs_advlockicmp_initmouse_movereluvm_growcsecreatevfinddevam7990_tintfd_cdsavefpstateif_detached_initnfs_falsedopowerhookspfi_ifhead_RB_REMOVE_COLORah6_inputbw_upcalls_chimport_udpencappf_test_state_icmpether_delmultivfs_op_initptckqfilterdb_history_currrn_mpath_initheadpppinputpf_match_gidgif_clonerrpc_auth_kerbexec_sigcode_mapsys_gettimeofdaynbootpathipsec_soft_timeoutipsec_policy_pool_initializedtrunk_fail_attachviking_pcache_flush_linevcleansystracewritecgtwo_mmaprasops8_putchar16cd_getvolsplassert_ctlpf_free_fragmentcgthree_cdsys_getresuidsys_fhopendos2unixfnscsibussubmatchrtentry_poolxfs_select_wakeupfilt_tunwdetachuvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsystrace_getcwdsys_fchmodvop_strategy_descmtty_startpmap_clear_modify4_4cuvm_unmap_detachvop_islocked_descamd7930_get_portwskbd_srcopsuserconf_common_devsema_releasestartipe4_zeroizeskip_spc_leftstp4020_iointrst_identify_drivexfs_message_rpcppp_clone_createvn_isdisksys_selectsvr4_sys_llseekcryptoattachvnode_free_list_slockxdreadzombprocxfs_inactivelogreadrn_mpath_capabledead_locktcp_issfc_largedistancezstty_rbuf_sizesrmmu_vcache_flush_pageclock_careset_vifregsnfs_add_tobecommitted_rangesys_setitimerisofntransnd_prefixclear_removewsemul_vt100_resetext2fs_specop_pvfs_unregisterseminitvndstrategyvt100_setnrcswap_key_createsppp_ipcp_RCN_nakselwakeupzstty_rxintffs_reloaddb_set_watchpointspfi_table_updatecnwritepfr_clstats_ktablescompat_43_sys_killpgdb_show_panic_cmduipc_usrreqzstty_txsoftnd6_na_inputrtl80x9_mediastatusdb_next_free_watchpointvflush_vnodefilt_rndrdetachmulaw_to_slinear16_lescsi_scsi_cmdin_gif_outputah4_ctlinputrip6_usrreqin6mask96sloutputcoldah_outputdb_clear_watchpointsbutton_eventunp_scanexec_aout_prep_nmagicp9100_loadcmap_immediatevlan_clone_destroysbappendaddrbpf_maxbufsizesemutotesp4_ctlinputextract_entropywsemul_sun_initufs_islockedcypress_get_syncfltffs_unmountfifo_inactivene2000_detachsvr4_sys_fstat64sys_pwriteisohashtblppp_timeoutsppp_ipcp_RCN_rejwihap_shutdownmmu_install_tablesuvmspace_allocrevarpinputcd_pausesoftdep_setup_directory_changehashinitttstartoldpvecnfs_removerpcipsec_keep_invalidsystrace_debuguao_detach_lockedmagma_matchsystrace_prepreplnexpireprocfs_printtree_idqec_cdsvr4_sys_execvsdopentcp_tracemii_phy_resetsunkbd_rawip_getmoptionsdp8390_mediastatusin6mask32__moddi3disk_countpfr_mark_addrsnfsrvw_procrastinatedead_openmsgpooldb_list_watchpointsuserconf_attrbmtphymatchicmp6_redirect_outputroute_cbvop_revoke_vp_offsetsva_nullreadeppf_print_flagslxtphy_resettcp_slowtimoqematchcd_play_msfdqreletcp_newtcpcbcgsix_intrsys_fhstatfszssoftprocfs_vfsopself32_load_fileamd7930_commit_settingsbstp_ioctlsys_getpeernamepfkeyv2_sendccdintrhfsc_getqstatschange_sign16_be_mtsportal_pathconfudf_rootpfr_validate_tabledb_eqnamefdc_cascsi_strvisbpfwritedoingcachesys_getrusagepf_state_tree_id_RB_INSERTpf_rtlabel_copyoutp9000_accessopsrasops_initipcomp_output_cbcryptoioctllevelhardxfs_devtoname_rses_attachss_quirk_patternsnd6_prunesl_uncompress_tcp_corem_getbsd_to_svr4_sigffs_truncatemii_attachnfs_replyhfsc_pfattachttylclosemd_diskconfpfi_ifhead_RB_FINDxdc_resetpool_allocator_alloctcx_ioctlin6_ifremloopchar_typeeeprom_vancr53c9x_debugpagedep_hashvn_closeamd7930_closeexport_addressin6_createmkludgediradd_inode_writtendoclusterwritesvr4_sys_rdebugwsdisplay_cfg_ioctlcachestatsffs_writebremfreefilt_sowdetachnd6_initip6_maxfragsexpire_upcalls_chlimfreexfs_devopen_commonmachclk_per_tickpfr_set_addrssvr4_sys_alarmpfr_get_tstatssoftdep_setup_freeblockscarp_master_downdb_show_regspflogrtrequestetherip_outputportal_lookuppf_osfp_fingerprint_hdraes_ctr_zerokeyuvm_km_free_wakeuprootvnodeifmedia_ioctlzs_read_csricmperrpps_countuserconf_modify__one_cmpldi2ufsdirhash_newblknewblk_poolcd9660_ihashgetsafte_attachnfsrv_writemii_phy_detachbstp_root_selectionsys_shmat1zs_disableprocfs_statfsmbtypescgsix_cd__muldi3xfs_message_invalidnodexfs_stat_devicedb_qualify_ambiguous_namesip_mtudisc_timeoutprocfs_rootvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesbufinitsvr4_getcontextskip_char_leftcpu_exec_aout_makecmdspfi_dynaddr_copyoutscsi_quirk_patternsuserconf_linessunos_sys_sigpendingnfs_truedeflateInitlimit0ep_mii_setbittcp_sack_outputuniqdosnamedb_recovertvtwo_capmap_writetextext2fs_mknodvttoif_tabdb_delete_cmdfifo_nfsv2nodeop_entriesbgetvppgrp_pooltcx_resetxfs_dead_lookuptbconfucred_poolvmel_scanpf_state_tree_ext_gwy_RB_REMOVE_COLORswift_get_syncfltnfs_startdes3_setkeyarp_maxtriessensors_listpf_begin_altqcd9660_bmapax88190_mii_bitbang_writebstp_record_config_timeout_valuesacct_processportal_opencom_obio_attachufs_dirbadentryrasops24_putchar8logioctlpfr_create_ktablestrlendb_machine_initrasops15_putcharcs4231_query_encodingvop_abortop_vp_offsetsnfsv2_vnodeop_ppfr_ktablesfifo_kqfilterwsfont_initxfs_createwsdisplayparampool_page_freeespattachah4_inputcopystrbridge_broadcastfpu_ftoswdog_ctl_cb_argsys_pipesunos_sys_setpgrparp_rtrequestext2fs_reload_vnodesppp_lcp_RCRelf32_check_brandwi_cor_resetnfs_getset_niothreadsudp_initbstp_configuration_updatevmes_cdbt_getcmapproc_trampolinesys_rmdirudf_ioctldp8390_disablecompat_43_sys_gethostnamecd9660_vfsopsinflateInitallocbufsocantsendmoreproc_zapvop_revoke_descmainbus_modelpf_set_rt_ifpep_pcmcia_disablexfs_readlink_commoncdactivatenfs_merge_commit_rangesether_inputuvm_vsunlockzsnull_txintlockstatusquotaoffarpioctlffs_fifoop_pkernel_pagtable_storep9000_mmappf_ncachefs_posix_sysctlaudio_init_ringbufferulinear8_to_linear16_beif_slowtimoep_pcmcia_cadb_load_countudbtablewi_setdefppp_softc_listchange_sign16_le_mtsufs_printfb_unblankfatentryzskbd_cdzskbd_catslot_mem_alloctctrl_attachfdctimeoutpppoe_clone_createwi_update_statsncr53c9x_abort.umulmf6ctablecarp_startdrop_earlysys_statdqgetin_baddynamiclineswmsdosfs_symlinksys_symlinkicmp6_sysctlsvr4_sys_vhangupcgfourteenattachclfreecompat_35_sys_semopconfig_found_smnfsrv_readdirplusalaw_to_slinear16_lepfi_kif_getrpc_autherrfdreleasedb_line_at_pcuvm_swapout_threadsknote_attachmax_keylensppp_lcp_tlstbinputdp8390_ioctlgre_wccpspec_nfsv2nodeop_opv_desc__assertif_congestion_cleardb_put_valuewsdisplay_emul_matchin6_prefixlen2maskesp_input_cbcompat_43_sys_recvmsgLfsbailpcmcia_megahertz_xjem1144_func0_cfe0tadpole_set_pcmciaudp6_outputcn_devvpcom_activatewi_get_debugxbox_cdmaxfilesuvm_pageactivateufs_dirhashmaxmemin6_addr2scopeidsystrace_scriptnameip6_sourcecheckvop_access_vp_offsetsffs_mountrootnfs_add_committed_rangetprintfuvm_map_pageable_allesp_initdofilewritesystrace_injectesp_rdreg1ipqdl10019_media_initmfs_doiomsdosfs_strategytimeout_deldma_resetwsemul_vt100_elxfs_dnlc_purgeif_delgroupspec_strategyxdc_startuvm_pglistfreenfs_attrtimeonfs_bufqpv_changepte4max88190_media_initnextsiblingxfs_uninstall_deviceext2fs_readbstp_supersedes_port_infosl_compress_setupsoo_statstp4020_calc_speedwskbd_cnpollcpf_altqs_activeesp_glue1pppreadrusage_pooldisk_detachpf_purge_threadsw_0_leftoverstrchrsunkbd_keydesc_ptxfs_renamesi_obio_dma_startxfs_dnlc_enter_namescsi_sizedb_deleteisp_initbeioctlcrypto_driverscompat_43_sys_ftruncateiftovt_tabtcp_backoffcarp_iamatch6sppp_pap_my_TOsys_chrootprocfs_bmapcompat_35_sys_msgctlexport_sazssoftpendingicmp6_redirtimeoutbridge_initenc_xform_dessoisconnectingmtx_init1pf_test_state_otherwsdisplay_pollcvop_link_descpfi_kif_unref_divreplaceaobj_pagerpf_tagname2tagstopenchopenuvm_tree_RB_REMOVE_COLORpromcninitMD5Transformmld6_inputacct_startsvr4_sys_xmknodcs4231_commit_settingsvop_link_vp_offsetsdt_to_gmtbpf_d_listsoftdep_worklist_busysyn_cache_cleanupip_pcboptsfc_purgefb_pfour_idifmedia_delete_instancebe_readsoftdep_update_inodeblocksys_acctss_cazs_write_regccddumpep_media_statusdb_single_stepicmp6statqcopyinflateEndpfr_commit_ktableccdwritewsevent_pollmap_backmergesys_profilvmcmd_map_pagedvnnfsm_disctin6_pcbhashlookupsystrace_exitwsdisplay_cdsvr4_sys_fcntlbpf_detachdVOP_UNLOCKsyn_cache_initvop_readdir_vp_offsetscd9660_wchar2charip_ecn_egressbridge_send_icmp_errether_ipmulticast_maxmouse_copy_extend_worduvm_init_limitsukphy_cdin_pcbconnectdevoutokaytocloneVOP_POLLVOP_IOCTLvlan_clone_createwant_aststatvarsafeprinumccdaudio_init_playcgeight_mmapsys_rforkluphy_cdlenocarrierdma_isintrswift_cache_enableprocfs_linkuao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectiommu_camgxattachuvm_vnp_terminatepool_cache_putbridge_fragmentxdc_cmdz_allocsensor_task_threadwtab_destroysys_getpidnd6_defifindexunp_dropptscloseuvm_map_advicetcp_mtudiscsvr4_sys_opentimeout_startupudf_vfsopspppattachsi_capf_normalize_ip6rn_addroutepf_find_or_create_rulesetsdactivatenfsrv_errmapread_dsfielddb_print_sadb_elf_sym_numargswsscrollbackchkiqchgbstp_message_age_timer_expiryshmsegdvd_read_manufactconfig_activate_childrenmulaw_to_slinear16_be_mtszsnull_softintkrp_req_queueremrunqueuepfsync_sendout_mbufxyc_xyresetsoo_closesystrace_redirectnfs_kqfiltertcp_recvspaceah_sysctluvm_metertctrl_read_ext_statussubnetsarelocaltcp_ackdrop_ppslimportal_readdirudf_node_poolnfs_requestlinear8_to_linear16_le_mtsoldmon_w_cmdnd6_lookupprocess_domemviking_hotfixpager_map_wantedviftablebridge_bifconfzx_promsys_getppidspif_cdmii_anarxfs_update_write_credVOP_READDIRdomainsses_refresh_sensorsxfs_uio_end_lengthspif_caireplacesys___sysctlaudio_calcwaterledmatcheeprom_attachextent_alloc_subregionin4_cksumpf_src_tree_pldb_putcharisp_intrneedbufferaltq_add_queuewsemul_pickin6_ifattachsoftdep_worklist_reqppppktinqewatchdogtcp_rst_ppslim_lastwsdisplaystartisp_get_ct_hdrsi_vme_dma_setupptmioctluvm_rb_removeahstatfree_xfs_nodeptcwrite_filtopstickfixsvr4_sys_utssyscd9660_initccdstartipsec_soft_bytesnselcollemul_elf32numdirtypagesm_tag_unlinkbufhashmulaw_to_ulinear8msdosfs_lookupspec_pathconfxdc_startbufmountroothook_listpfi_detach_ifnethook_establishqe_ifmedia_updzstty_txinttcptv_keep_initaddrmasksys_chdirsvr4_sys_fstatvfs64ktrsetchildrendb_unread_tokenext2fs_diremptymotion_eventssstartsppp_chap_tlduserconf_cntpflogifmouse_zaxismfchashsppp_lcp_closeep_default_to_mediaext2fs_inode_freepcmcia_ccr_writedb_find_variableip6_rr_pruneudpencap_portptmclosebematchsbcompressclk_wenabledirrem_poolmsf2lbarijndael_set_key_enc_onlycdevsw_lookuplogsoftcsys_adjtimewrite_dsfieldnd6_outputxfs_devioctlpfsyncioctlssminphysvop_kqfilter_vp_offsetsnative_to_svr4_errnoamap_splitrefwskbd_do_openktropspf_qname2qidcryptof_kqfilternclruheadvndwriterasops_alloc_cattruvm_aio_biodonern_initheadnfsfifo_reclaimvop_generic_unlockesp_glueuvmspace_sharert_timer_addroute_usrreqdeextendu0sbus_matchrasops_erasecolsnfs_readlinktcp_dropsppp_detachicmpstatnv3tov_typeudpctl_varsfdreadip_mrouter_getm_prependvop_advlock_descwsemul_vt100_output_scs96_percentnfsrv_readlinkcd9660_pathconfax88190_stop_cardxfs_create_commonin_pcbrehashxfs_setattr_commonin_arpinputxdc_cascanjet_set_windowsbppcloseufs_accessin6_embedscopeif_alloc_sadlpf_state_tree_lan_ext_RB_FINDrfx_initializegetcacheinfo_sun4unix2winfnncr53c9x_get_ecbgifattachfpu_divwsfont_unlockoclockmatchreassignbufip_freemoptionsnetconms1_get_syncfltcgfourteen_accessopssohasoutofbandspec_vnoperatevop_ioctl_descddb_initswift_mmu_enablend6_dad_duplicatedsoftdep_change_linkcntfifo_vnodeop_opv_descmsdosfs_fhtovpnfs_inactivepim6_inputxfs_message_installdataipsp_spd_lookupether_crc32_behandle_written_inodeblockpgfinddvma_freevop_lock_descbeinittcp_ackdrop_ppslim_lastrqinitsvr4_ustatrasops_cmapswcr_compdeccd9660_ihash_slockpf_test_fragmentrasops1_putcharip4_inputtcp_inputsysctl_dumpentrydkcksumpmap_mapwsdisplay_cnattachpfkeyv2_policynd6_gctimerncr53c9x_initcd_switchiptimerip_inputaudiowrite_filtopswi_set_txpower_mulreplace_endnd6_setmtupf_normalize_tcp_cleanupnfsrv_cleancachedb_last_non_spaceudp_ctlinputmii_detachpool_sethardlimitn6expireip_freefvnd_softcaltq_pfdetachkernel_regmap_storezsharddb_show_cmdsudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdeflateEndprocfs_dostatusdevice_refffs_syncuvm_map_submapnfsm_srvfattrvndopencnioctlses_temp2sensorufs_vinitvmel_cdpool_primepgrphashtblsystraceattachsddkdriverktrwritesys_getpeereidpfi_clear_flagsinodedep_lookupcarp_hashifmedia_matchstatclockgetnewbufdvd_read_physicalrw_enter_writeuvm_mlk_hintsppp_lcp_scruserconf_argbufsunos_sys_unamess_patternsMD5Update_intm_tag_copyqe_mcresetst_readsbus_cddb_value_of_nametrunk_port_getprobegettun_clonermsdosfs_getattrprocfs_setattrdb_find_breakpointcounterreg_4mcarpstatsm_devgetwritedisklabelses_read_statusgettdbbysrcmsdosfs_printkernel_pmap_storesttyattachwsemul_vt100_opsxyc_submit_iorqstartprofclockpf_modulate_sackcs4231_freeleattachnsphymatchsys_getresgidprocinitrmc_update_class_utilmsdosfs_readdirdead_ebadfsun4_vcache_flush_segmentobio_cambpp_matchnfs_symlinkpf_frag_plopenpromioctlsoo_ioctlred_getqsvr4_sysentamd7930swintrnumdquotforkstatwi_card_identzx_ioctldl10019_mii_statchgnull_setkeyin6mask64db_lbuf_startqec_getsoftclockaudio_initbufsvigra_accessopsmfs_openportal_badopreaddir_with_callbackupdate_modifierdb_breakpoints_insertedswdevtblf_decryptdisk_lockah_attachieioctlsppp_chap_closesbwaitudf_transnameufs_reclaimpf_tag_unrefnswitchdiffsdwriteauxio_regvalprocfs_donotexfs_install_deviceshm_deallocate_segmentmemnamefpu_ftoxp9000_setcolorxfs_fsync_commonfilt_logreadsysctl_rdquadcarp_optsuvm_vnp_setsizevmcmdset_extendsys_lkmnosysip6_use_deprecatedimport_keynfs_setattrrpcuserconf_hist_intextent_alloc_regionsys_mknodraiseext2fs_mountfskill_vmcmdssvr4_ttold_ioctlppp_clone_destroyesp_dma_isactiveufs_mknodsbinsertoobknotesunkbd5_keydesc_jplf_advlockpffinddomainfreeah_enablepf_src_tree_remove_statewi_ioctlnfsrv_rcvprotection_codespfr_insert_ktablesunos_sys_ostimeswstrategyuserconf_pnumget_sa_requirescsibusprintrtl80x9_init_cardstp4020_attach_socketbstp_make_blockingsys_getpgrpccddevsdqhashtblaudio_defaulttvtwo_burnerwsemul_vt100_console_emuldatasonewconnsb_auxio_regufs_direnternfs_reqqpffindprotocom_obio_cabold8x16_iso1zsops_kbdbridge_clone_destroycluster_readuvm_swap_initcrypt_alltcp_saveti6wsemul_vt100_inittun_wakeupnchrdevsppp_phase_namenfsrv_lookupshm_find_segment_by_keyqsphy_cashmmaxpgsx 8`@#`1"" $@``T@.#(1b@`"@H*/+.0"c$  0  " x."  *." |!`." @㿐@l.!)@2"0#,`)L@ 3))" 3)10%0/)+0)0-)'05)7.90 ;0#t@}b@@( $(( c @ (!p@ ͐M!p 2%c @8@ ĐL 2@ ܐP@@ːx`#$c4b1   @'.x? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1?)@"h1?㿘 #@(1)@"x1㿘@E " ܒ㿘 @b㿘.#(` @e. "`0 #t@ #( $#(㿘.c( ? "c(.@c`㿐%.@6?41!'@?)@\"@  2'0)1a@R")11#.b!@ 2b 20!@"')b @>"!'@Ab 0 0#t 2 0"x㿘0x` 20."x#,"`"`"`"` "`"`" @`  "ct? 0 t ?0x 㿘  ; < 㿘 . @@<   @1"&  ?  㿘. x`0@|0c$  $  0. c@" 0"#,JJ`  -2*@0#,@ (*`J@ @ *`  .cP0"# J  *@J` )*@c$ 0`"#,``*J@ -& @00 *:  c` d a #(J@ s #(J@  #($#(#al @ ##(J@  @㿘@ . x`  @W`x$` $`%00#$ `( $ 0c €  #̒`$` $`$@ ) @$"02 @ǐ $`&` 2!00.` @"@} ) @ #0"@.` @Ԑ.` @ϔ . "` x.`  $$ 㿘#0c$`   ``*  `c$   '@`2`0`,6 * '@ 㿘  & `& $& (   € " '@ 㿘 ` @+ 0#$ `( ( @0@ 㿘   2  @ $ ?/`$ *㿘0#$` `0`4 㿘0#$` `?`8 ? 㿘  ,`)@N#(?@ `?㿘 ,m`€s㿐0$ ` #$    #$O!. x#?  `$ *$`P x`/`$*O O /O㿘㿐0#$ `      O ? X/O O /O㿐0#$/  0T@㿘  㿘0#$`t€㿘@.@e㿐0c$    #$X#$ p@X. x` . #`#`` .   Ћ@+@ `` bb* * * * * *30c$` `€ 0 )H @@c$|@㿘0#$` !.`@)@Nc)@c )' c@ ) @cȀ   !`!N@J@2J`N` " 2 㿘0#$` €) 0#В@ 㿘!.#ߖ ??" #.㿘)/ ̀ ?N  @  0"""$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` )@ː#+  " * @7 $`0 "$`4 " @N$` @ 2 &  %  *@  㿘#/`̀  @ 4 "$` & 4$`́㿘. |*`@ .* 8@!̘ ..!T        * P@i` `. @ . |8 <?*  И آ&@  ` . а@㿘?(.,10\&#$ H L` T ` X P d l$ p  t @/ .@㿘0 c8@i 4 4 0@ ct*@ xG * #8@  #8#8@ 8?@?# @!a%#8?@?# @!a#8?@?# @! a #8?@?# @ *0 `*#8@ @ϐ @㿐`*@Ð @?@ %?# @! `  a `  `  @`@`쀢 *@?  ?# ! ? ?# !!*` !*@!*,@`@2,@`@} `@Ē`Z*`  @p@ ` "`,@?`` A*`,@` ,``,``,``@X``@`@5*@ @  -*,@ ,` ,` ,`  ?`@*@* @-``? ? 0"c4* @!@K& @  ` @  ! ??#2   @A :d뀤 '@`,    6`,`  ̘D  "`,= x*@`,*` 0ct@ & *@ 0'@ E   2 `, "`,`@"'@`, @ 2`,*@!? P# 2H  C*!(*!0*!8 @    d d @ "@  @@ @X @ E   :    *"@ @X!P   @@ "  @$" `,   @` %   0 d"#0  "  40ct@  *@,!X0`0, * @m@0ct@ ~ *@!x00ct!* !@0ct!*!0ct!*!@ i @0k`0@ `7E    @ " `("L@ 5 1* ? )*!!*!8 @Ր    d   @ @` ?$ @ @E  `0Ѡ (0*@!0c0 4 4&` &`6`*@r6`,@? 0"c4*'@@! 㿐` @*0@Oฐ`@@༠@ * @ @ݒ@x` * d, `0 200@"x @Ð* @ @' ?  "? 6"?% 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`@@$,`& 㿐   <P @5 40*:  8  20 @8 0<D @L@ @  Ȁ)n 2; @G0$  " @g  d  *  0 @g$ $  $@&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @  " *@B<@@` ڐ2 ``@Ӑ 㻀@ː Ц @ &`@@$`   `  @2 %\F!T@  0@@eg0   @$ t,   $@  'a L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@, W(  2LL@@5 $H  E;@t%( 8@l"@2 0 K䰒 *@O`  d*  0` @KO / ' 'ݒ L@  @   0@+ @%@" Ё㿘 &     . @ "  @0  .  "  @0 @@  а 㿐 @ @&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  "`"`"`:`8㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  p[ j1!1a"'А $  $ $ ''X@Ғ 2V?.a??"a4` $@!#`"#@ #\ @  !0*@W!;?#0#lcp@#l*`4cp' @2 `*@>""?1'ܠ 1a"@~܀ ?1"(1`x(@t܀  ?1b@܀ ? ?  M1 1a?@G 2B?@@> 29?.a0?"a6 l"&#`a#@b#\ @    0 H"ct''@( ?@I ?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ x.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ ( ( @ `  -``( ( *"8@     2` * @h *`  * +` **` +   h  (@ g@ e@ `-`  ` րϰ    *` *   *  M `/  M /" M MJL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` *   @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐^  [ @4 U  @P2 *@    @ t,`  ( 6h" 1  '"@@''   b 4  @   " 'w@ N@B< 22&     ":?"   ? @ : ` :?  $"`"`"` :`8   㿘  ,  ". /.".+."&  "!"..S 0N L ?I 0F @͠L@ *L0: 07 0pؒ  @ Ő@ q 8 'p@ t    $ #`a#\b` @  ? 0 H "ct؀`0@   "#t?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ ($` 8 @ mt$`     h #`ab`$#\ @ ? 0#t x 0  &,& &&& D& &(&$@ ;㺈 ` ($ a b????#\#`  @ ? 0#t `  dh@ d .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @L ,? L `" H0"#t?@T@Ք0 *"@@ 0 H"ct?㿘@Ȑ .0 "ct!0"!6 & 2?0cx"cx0 "!"0" ?㷈0#x#x` *@ ǐ"h N  m `/2N N /" N a  0 ] @H x  <$N O  N  /  .ؔ A.0 0x" 2;x@ @  $+  (@C;@?O`/ x@/ x@+ x  @$ x N  x&`  @ x@  x㿘  "& @ x&  㿘' #0!0%*@    ? ct2  !l @   ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  .0؄( 4 "`8"` <"`@"`D :`8 㿐\@?<6   '?'?@ ?1p '?` '?`@"p"?'?Đ #`#` #`#`#\ #`c@$ #@? 0` @``2*"@"0 H"ct?㿘!0$#t@I 1 p@ 2?`2 ?`*` $#t"@h ??"@?21t0( 2  2 2 *?1 t # t t0("# t" " " 㾐a"@2 o'Ô?'' "p #\#` ""   C   p'–0 !0#t@d?*@" H$#t8G8G8H88H88H 8G8H88H8H88H88H88H88H88H88H88H88H88H88H88H88H88H,8H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88H88G8H88H88H88H88H88H88H88H88H8H88H88H88H88H88G8G8G8G8G8G̝㿘`Y1!*` €1*0"1*-#1**#(1*'#@1*$#P1*!#h1*#x1*#1*#1*#1*#1+ 1+  1+  81/+ ДP@ @ Ё//@**@"㿘#//!/"a$a \P'P'T'X@W$!a! *`2*& +@* hJ?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 `b\4 `4 #\" .@U +@ ? 12a a2  a @ 0. ? @ .??"b $`㿘. @k 5㿐@0!"#t  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` ."    1`'"'ܐ@,ܖ@ژ( @?+ @:x@ް yހ( (  s?@n?2l?2` 2g? 2c?2``<`]@l 2Y? &U?``  2M?` &@ǐ  4 & ` 2>?` "6`` %+@ 0? ,  $ $ ' '`'''4 @.  ?$$ $ $ $ $$ $ $ $ ` ??㿘\   )0 <++`%#t(?@ @`@,`4 2 #t   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘/!1,@  .  @{ 0,@@ "@p  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "< N ,N`$* `.! ؒN*`? @ . ɒ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` Y+` ??㿘X  @,   .b@%  "` ?` ?7/.8 :  0 *@ `  *@`*@`/*!8" @ ` ?  2  㿘/aP'H'L'P'T 'X @"aP@H+@!4㿘+!㿘1"0 , @` @ , 㿘@@n㿘@ 㿘 D " ? 2  H10 L&#t@e  $ #t `$ D?$ @ L$ ?$  @`$㿘אԐ* А* ̐?. ?$`@㿘."  , @     & &"   & T`?& & S`?   2?  ?B& @     `* ??w?2? o  e  "  D Z   D  ?& @㿘@h?7`5@ X/!T. `%"   >`P>@>`>`>`>` >`(>`0>`8>`@>`H+ ?@, @ `@ &`L&@Z&`H0 @ ܐ`@ X@ɐ?㿘 0 "ct?1"0. @ /. !T @  L@@ X@㿘/!T.   @?? ?2%  ?% @%   T "<   8 @a    "@"% %% %  "  @* 4 0#t`% D " %   &   B @ B = = % DW  D  L!0$#t@ % #t % D L%@* '% @  P@Z" % P  P ?% @ @   @+  = =   @; % P @ 2   D 2   2x T  P@)"  % P&㾘 0 1"0- @/@8!T-  `T @?2*$`(&$`" ` 0o l0k @ F`2.``)  @ ?V @ `L  <`P<@<`<`<`<` <`(<`0<`8<`@<`H+ ?@ @$@$`L$`H`4 `5`@1`@ f )`' a !ɒ: @0  [d 4 `0 ["ct??.ⰔⰖ ? * `:```? .b "b"    .Ⱀ?"  Ⰰ@ @   @ *0   @ *`㿘1. "0 @  @  0 $"ct2  " @      @ $0"#t`0 "#t?㿘1. "0@ @  0 "  0  [ :@B: ["ct? ?   ` 㿐1"0 @  `  ` 0 D"ct$@$`$` '? 80@`` / "`J .`)$@&$`  ܨ@  0"@ € ` ` ܦ `" ` @0"#t$@?㿐1. "0 @@  0 ,"ct" @ * 2`      0 "ct B< ' 0 "ct&?8f8gL8g8hP8hP8hP8hP8hP8hP8hP8f8hP8hP8g8h8hP8hP8g\8hP8g8hP8hP8h,㿘'H'L'P'T'X"Ē@ H㿘"Ē@8N@`N@`%` N@`|`!p*` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈+!(@ @,@Ԑ  ?L?㿘."` /!d+ a@J@ n#!dl  (.#@ ."@  'h@@B`@ `   +$!Hƒ  .א 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hb4 j4 h"$@#\ ./? hl'l+Ґ!p ` `4` 4`  $4`㿘.Q(㿐g0-"#t(2*?@ 2&?`(2"?`&2?`  @??.#.*@ *`@ `u  ??㿘@ /`(+`&'` # `Y   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  : : *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  8~8888888888P888|88l888x8,88$88d888p8x88 ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8 * " <" 8 㿘 N 12:?@ 5?2 (1? $ "x$ ($ 0 , 2 ("$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 +-ሒa  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4>  ( 2   $ * $ ($ 0$ ,  (&@@    4"@  ($ 0%$ , 0" @8 4   "@@   4"@ ($ 0$ , 0 ( $ 0$ 0 , (@@$ , 㿈 ɺ $ Ŧ  "? 2  2? 2  $   8< `!\*` € ` $"&  @?*``` * 4 D  y-  u-4 $  m * $  @! $& 8  $ ¢ "k&  @?*``` ?c4 4 *` , $& 8   $   & & & &$<$8  @ $& 8 $`";&   `$@4 $"0&  @?*``` $4      -4 $  $ $"0&  $4[ `$@` 4 "&  @?*```?c4  -$@   $@ Ā88 ܒ@%"@$@@%'@"&  @?*```  a$`4  $d4  $\4a򀢠 $$hh\@-" p"&  @?*``` h *@*`3 $h4\ hp0lT-"(*`0  $h $T$L$l @"   -c"0-"0&  $ $$h`dh :pT * ?L * @@7`񀢀7  "N&  @?*``T*?L * @@7`񀢀7  @   ".&  @?*`@ ` $@4h*`3`i$h !  @   "&  @?*`@ ` $@4h` *   45 @   "&  @?*`@ ` $@4  4h @   "&  @?*`@ ` $@4  4h`d Q?? ph?*`2`?$h`dh *QT "0 $L$T$ll` pT@H -` l*``p$P$Xd  @7X y- $T * ?L * @@7`񀢀7  "t&  @?*``T*?L * @@7`񀢀7 - + 7*@* 7 2` "H&  @?*`` 2 L* @@7`7$@4$@4$@   z$ @ u$2-  $H$H @   "&  @?*`@ ` * @? @$@4 $@  $X * ?P * @@7`񀢀7  "&  @?*``X*?P * @@7`񀢀7 ` , 7*@* 7 2` "&  @?*`` 2 P* @@7`7$@4$@`@4 $D `$H$H @   "&  @?*`@ ` * D? @$D4 $@ ,D"@i $u&D"0 4($ ""@@ @&@8"$@% @?.@``@ 2 $H  C.@$` 6`8  ":&  @?*``` &@B > $@Β&@$& 8?c4 4 *` , -"0&  b$   $ ?M?& & && $8$<(   8   ђ  $3?  '  B& @B > >   $ @z"@$& 8 <@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?  ` .?`   @. @+  ?[   $? ( @ 4"@  ( $ , 4 "$ , $   " ? $ " ? "?" "`0  @  @0#   ( @#@㿐 P?`$ 2`0J 2 < D?   h <  8 " * % <%% 8  ;*  8  <2`?% 8 % <  % h@```@ @B  " %`%@=` h?` `3  =`=`  % "? $ 2 ?   <`?㿘 `"h?`$ "d?`("`?`, 2`0Z? 0  2 4Q?   $ * `( `0 2 @`0`,€?0=@' >`> `> `0> ` > `(> (`0> 0`8> 8 L%0@ ,@zА" ?%0@$`L PzВ"@ e0@ $`P l:А" ?%0@$`l $ * 4~$`4& $ 㿘?4`c @@c@@ ? @ ? ` " ?@@`?c@? @ܒc* @! F?"P  ![@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ ϲ`##񀦀ðL(7@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ β`" !?@@`!?J#F#. @㿘?!? @#   0##6`6 ? @#  @& & 8& #…8& 8& . @'X'D'H'P'T /```0 TH) @ ( 6T  ?, "?8 2P @ // 70 0P&@00P T:     + "  *   /`.  b``(/`  D X 2?7   ``0@`  DH) @ (@(0@X6 0  HD -X '--h⦲!}'-?$' P( D'      ?e ° ? 'X) '@ /67/. @/7 `/7, , /`7 @(3`0,626  ( 5@FX*`H(@ X" '@ @ + ,(& *.``@ . & 4`D, @eE P- (P(P#8z0 @//+` '7  P  /7 (3.0626 ߀P  T&@.$%- $h     "@(  /h ( 00? # . 0. 㿘.# `1/!h㿘`._ # `G8/!h@6  * `@@  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6  ` /!h@6  * `@ 8`  `2`` 㿘  $ 㾘;;n # '  x*`"``*ߒܐ`ɐ.6 > ʐ`.6 > ޒ㿐    b`  ?   b`  `V  $D`  $$`$: 7 y  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  -#x4@   "  d`]4 6 6 ,@ ,  @  "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d , 6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@%!>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x dvma_mapindvma_mapoutboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenode %x property %s length %d > %d Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.2read header: %s ELFunknown executable format %d+%d+[%d+%d]=0x%x boot: short read read phdr: %s Can't find entry point. %s%lu+read text: %s +%luseek to section headers: %s read section headers: %d %s%ld [lseek symbols: %s read symbols: %s ] bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_read: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.2.30123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %s`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@ 8% 8(8)8)8)8*D81x86d868888$888>8@8A8A8A8BD88 88 888 88 (8888888x8p   8p@` 0123456789abcdef/8ư8x8x(8(88X8X88(88,8)8@68PC8N8W8xb8`q8v8888T8888@8@8088x888 8"\8$8+t8+8/'8//80`888889889F8:S8<4`8<8Bm8Ey8C8Gd88H\8H\8888I8J\8J8K@8 8R8SP8T$8888U8U8U8P8V48Vx88V8WL8W8T8`@88a8a8bd8c(8d8e8d8i$8iT8j$8j,8o<88mH8m8U8mLd8o(x8m8mh8m8nt8n 8m8m8n8nP8nD8nh8n8n8n8n8o8n8o8oP8o,8rh88pH8pdU8pxd8rTx8p8p8p8q8qL8q(8q8q@8q|8qp8q8r8q8q8q8r08r$8rH 8s ,8u88t8H8sU8sd8ux8t(8t8tT8u8t8t8t8t8t8t8u8ut8uP8uD8uh8u8u8u8v(,8yH88wH8wDU8wXd8y4x8w8wt8w8x8x,8x8w8x 8x\8xP8xt8x8x8x8x8y8y8y( 8{,8|98`D84D88D8LK8 [8$d8Ls8h}88D8(D84D888(8\8v8 8x8|8@8888`@ 868e 8& 8. 8:8D@G8P8GdY 8g8Hp8DT8888U 8B8I8 8h8881x 8t8a8Q\888}T 8l884)8o/8+98@C8bdJ8R 8Y8a`8|e8|m88$y8o 88T$88 8p8h8l88 8RP 88-l8h| 8 8 888 &8 3 8l98G8dM8]S8X8`8uf8(p8x848x 8x8 8 8$ 808.8{8>8$8 8A8A#8 28B;84C8K8VR8P\8fd8Om8Xw88$8V48=8 8c( 8Ő8oP848BD8zT888Z 888888+t#8-87 8x?8)H8Q 80W8U] 8pl8K@t8y8U8sl8/H8 8@8)8i$88k8% 8 08QH8A 8 8L 86d 8 8o %8Vx -8 88. J8h U8, c 8( q8 {8sl 8v 8t 8/ 8  8 8 8 8p 8( 8*p 88 8SP 8\ 8 x 8p !8f )8V$ .8l 3 84 88) B8 P8 V8 f8 k8( t8iT ~8*D 84 8 8$ 8o 8Y 8T 8rp 88 8 8 8 8 ( 8z 8T 8Z|  8, $8 2 8 788 E8 N8D `8` egcc2_compiled.open_countnetif_promfilestore.30bootstore.31prom0_fakesaveechopv_putcharsun4_idprom.86dtabstringbuf.96promdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.109elf_execaout_execelf_seekread_inodeblock_mapbuf_read_filesearch_directorypnmatchdirmatchnfs_getrootfhnfs_lookupfhnfs_readlinknfs_readdatarpc_getportrecvrpcebuf.24sputcharsbufsbuf_endsbuf_lenrarpsendrarprecvbuf.39numberdigitsetherbuf.30paniced.24gz_magicget_bytegetLongcheck_headersstoppos.36arpsendarprecvLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9Lmul_shortwayLstdfixedtablesupdatewindowsyncsearchLetextcrc_table_emptyfirst.24make_crc_tablecrc_tablegf2_matrix_timesgf2_matrix_squareputchardvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopyloadfilecd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenrpc_fromaddrrpc_portstrerrorrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openerrnoocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodeinflateGetHeaderfile_system_cd9660promvecssymxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbootfile__ashrdi3crc32nfs_statinflatePrimenoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpcd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypecrc32_combinedomainnamelenprom_open.urem.remrpc_pmap_numxdr_inaddr_decodeobp_recvdvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumgetpropprom0_xmitadler32_combinekdoprntexit_divesymufs_writegetpropstringstartfile_system_nfsbcea__moddi3arpwhohasufs_stat__muldi3netif_closeinflateSetDictionarystrlenopenreadether.umulhdrinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freecloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefree