pP fr4D$@p"D$("D$t4p"D$uP"Vj=h"u@h"@Dž1F,^.t7\SF@0u ;u F.uN$ PL"PP\c u f.fbD7.€fT7. PjVBЃj i4jXj!V@ЃhjV@ЃjVЃFCH@E9r{4tC8@`K4uUS8‘RS8`ᐋS8@VS8‡ S8‡"C8 utۋS8e[^Ð%s: WARNING no command for scb %d (cmdcmplt) QOUTPOS = %d U WVS}G-xtS C@(SWK<je[^_ÐUVSM] 3@ lAࣀ@f|C@tA\CFAH@CAHX@ҡ#At[^%s: failed to allocate DMA mem for %s, error = %d %s: failed to map DMA mem for %s, error = %d %s: failed to create DMA map for %s, error = %d %s: failed to load DMA map for %s, error = %d UWVSEEEpt`7F@@F@sCPs3hwQ8VHeQ8WIi}u;y4tQ8y4uQ8‡ A8tۃy4tQ8HBVy4tQ8fIBW}ujY4uCQ8‘@Q8WIEQ8†6Q8‡"A8 utۋQ8[^_Ð%s: target %d synchronous at %sMHz, offset = 0x%x %s: target %d using asynchronous transfers UWVSu}uEEE H x BuE<I8CSMW;Eu ;UI Et1᠃}tU Ex4t{@8UPဋU Bf#f}t*UBtU f BfUBp E E@4Eu=EP8BjhPSR(jhPStRjhPS`Re[^_ÐUVSMY4uQ8 | A8@ } u:t1u Q86u A8@6tu Q8?A8@6ty4u Q8A8@y4u Q8A8@Ãy4u Q87A8@7ЃVAt tBPЃPRSu e[^UWVSu} ]ME‰>^ N ^F EFBu^NfF[^_Ð%s: brkadrint, %s at seqaddr = 0x%x U WVSuN4u V8‘ F8u/FPtVЅ1V8’ttF8ƀVt^4u V8’ F81tGt|u V8bF8@bȅu V8cF8@c P44"FPhV8qt SVt SVe[^_Ð%s: ahc_alloc_tstate - Target already allocatedUWVSMU F]4}BuGt U]t9tAPhXypjjhkÃu 1tPhSVefǃ{sEjVjW MyhS@ lA@UM@Ћ#At؍e[^_Ð%s:%c:%d: no active SCB for reconnecting target - issuing BUS DEVICE RESET SAVED_TCL == 0x%x, ARG_1 == 0x%x, SEQ_FLAGS == 0x%x %s:%c:%d: Warning - unknown message received from target (0x%x). Rejecting %s:%c:%d: Target did not send an IDENTIFY message. LASTPHASE = 0x%x, SAVED_TCL == 0x%x %s: Issued Channel %c Bus Reset. %d SCBs aborted %s:%c:%d: Missed busfree. Curphase = 0x%x %s:%c:%d: unknown scsi bus phase %x. Attempting to continue %s:%c:%d: ahc_intr - referenced scb not valid during seqint 0x%x scb(%d) %s: Interrupted for staus of 0??? SSTAT2 = 0x%x DFCNTRL = 0x%x SSTAT3 = 0x%x DSTATUS = 0x%x SSTAT0 = 0x%x, SCB_DATACNT = 0x%x ahc_intr: HOST_MSG_LOOP bad phase 0x%x data overrun detected %s. Tag == 0x%x. HaveHaven't%s seen Data Phase. Length = %d. NumSGs = %d. sg[%d] - Addr 0x%x : Length %d TRACEPOINT: RETURN_2 = %d ahc_intr: seqint, intstat == 0x%x, scsisigi = 0x%x U`r"PShH=EEp W]E4uW8“ G8P4u W8 G8@ Ph\Ti 4uW8” G8P4u W8G8@Ph!\ i 4uW8° G8P4u W8 G8@ Ph@\hST4u W8G8@Át+t#Sh\thW#\WV}u]4uW8¹ G8ЋGH@ЁuPURWELJTLJp2uLJTLJpMQWjWPE E_4uW8 u.G8@ u"W8W8=%W8%G8@t֋G8H=4t֋G8H4uW8G8@_4u W8¹ G8ȅu W8= G8@=E؋GH@1p"9EtF p"9EuCp R @P4t"h\fCp bR s$Cp$4uW86 uG8@6 t \\Ph]4uW8W8†G8@PU Rh]leO4u!W8‘W8‡"G8 utۋW8e[^_%s: Spurious SCSI interrupt %s: Someone reset channel %c %s:%c:%d: parity error detected %s. SEQADDR(0x%x) SCSIRATE(0x%x) TagSCB %d - Abort %s Completed. Bus Device Reset%s: Unexpected busfree %s SEQADDR == 0x%x %s: ahc_intr - referenced scb not valid during SELTO scb(%d, %d) Unknown SCSIINT. Status = 0x%x ULWVSut%~4uV8uF8@tEBEAEEN4u V8 F8@ tkuV8V84 V8B4BN4u V8 F8@ uV8V84 V8B4BEA}AuEBuFPhphbV4UuV8¹ F8ȋ^HCD9s+CЉUB@t}u V86F8@6|E t']SFPhhbjSVVN4u V8=F8@=E܅uV8V8 F8@!DžtF8@ ^4u V8 F8@ u@uU1p"9tA p"9uMq"}tMAp &M 2u V87 F8@7%PEPFPhha~4u V8F8@P^4u V8bF8@bȅu V8cF8@c PEt"hh`tATt(ƆQ/V84!V8’"~4tދF8P4~4tڋF8ƀN4u V8‘ F8 W,N4uV8uF8@u V8=F8@=Eԅu V87 F8@7؉]mtt GFUEAt tEBEu V8$2 V8$2}Ԡ#lH0X w t MxUBp J huhPM@Phh^jjWSEPEPVJE0}t?UB@ t3jh؃PEPMQR{V t UB@,jEPSMQEP]SjhijSVqE }}tKU tPjjRM@$PEPEPVIUBp I FPh,i]1p"9EtG p"9Eu^4u V8bF8@bȅu+V8c(V8 uV8’ F8@c P4t"h@i0]V ~4uV8V8$ V8B$B~4tF8@ ~4tN4uV8>V8F8@>tF8~4uV8¹ F8ȋ^HCD9sCЉUB@u E}u[QWFPhiC\V8V8 V8 V8’M tPjjRU@$PA@tBRM@PVG ~4bF8V~4RF8@ ~4NF8@ ~4JF8ƀV5V8 AV8’BUBp F Whi[~4tF8H ~4tF8ƀN4u5V8‘2V8‡9V8‡%F8 utېV8e[^_Ðahc_intr: AWAITING_MSG for negotiation, but no negotiation needed U VSuE X x Bu[CE8CЊK8Kuu}ЄtCPVRWt@CEEPVHCECPEPRVuuVQh sTe[^ÐBus Device Reset Message Sent Abort Message Sent ahc_intr: AWAITING_MSG for an SCB that does not have a waiting messageSCB = %d, SCB Control = %x, MSG_OUT = %x SCB flags = %xU WVS]}ǃlǃhG{4u S84LdžlEjjVt$jjjjjjWVUV84] jWV~4uV8 V8 $V8$߈ ߃~4tF8@4~4uV8V8  V8B Bjj jh@$PA@tBR@PV<EPG PG PFPhxREe[^_ÐUEǀhǀpǀTx4uP84 @8@4ÐREQINIT interrupt with no active messageTarget MSGIN with no active messageUnknown REQINIT message typeU,WVS]EEPS`{4u S8C8@Tsw t Zhuh@{LS8 @%tT{4tڋC8@ @ƃQǃTǃpbS8 @%S8 )QtO{4tًC8@ @{4t֋C8@ {4.C8@ +S8 @aS8 e9lu/ǃl{4uS8S8  S8B BhH9lu{4tC8@ @{4tC8@ {4btHǃpQtholbǃT.`p{4u S8C8@1EPE PSvtGǃpht:{4uS8S8 "S8B BS8 p{4tC8@ {4uS8C8@huh{aJK4uS8u$S89C8@tlu1tVǃT{4tƋC8@ǃpK4u S8C8@S8BS8B 9lu(uS8BS8B$S8B$BuS8BS8B  S8B B{4kC8lXPloK4u S8C8@uS8BS8B$ S8B$B`p{4uS8S8UC8@9EPE PSJ&pu[ǃphtH{4tC8@䐐{4uS8BS8B  S8B BǃTǃp|u{{4uS8BS8B aS8B BTh{'HlS8Xl%lS8Xl S8 1t1S{4t C8@R)S8RS8R{4tC8@Re[^_UVS]11<wA;hs@X<uD ;E u)D D}t 9lv 9lv[^Sending SDTR! %s: target %d requested %dBit transfers. Rejecting... Sending WDTR! Bus Device Reset Receivedahc: got target mode messageU,WVSuEEEEX x Bu[<<`H"$ăppppXlࣃppp0XXppppppppppppppppppppURVSE%pauuEEMQV pbtaqcEdEEEPVǁSEPWVb jjjuuWURVjjV tM;M+džldžhuuVUAdžlEEacjjVt8t/t|EPUB PFPhhH1Ntu1džldžhSVAdžlEEjjjSMQV[ jjjjjjEPV }}GEEPVaGEGPEPRVdžldžhuuV?džlEvjhGjURV~V1EMyuhaBE}t)džldžhƆXEE}t}u džhEe[^_ÐUWVSu^4uV8¹V8ҋNHIщUuV86 uuV8R6 eEPB UuV8¨EV8҉U}u&uV8Y<V8RYV4UuV8« V8}uV8ª V8 ˃}uF8 N8 ߃}u V8 V8R}uV8 V8R ك}uV8 ȉEV8R ʉU}F8V8<V8;V8:V89V8« V8ª$V8©+V8/V83V87V86N8I ]GKEP$+Ut{H9|srJD ȉKEH у}V8B<~4F8P;~4F8P:~4V8J9~4N8~4N8~4V8~4N8Q~4N8Q~4N8Q~4V8Z[^_Ð%s: %s on %c:%d. %d SCBs aborted U WVSu] ushjC PC PV.ǃjjjjSV jjjjjjSV/ }t&} WC PC PEPFPh@Be[^_Ðno longer in timeout, status = %x U WVS} w^ WtG B W GWhHb[]~$tAF tMA@ lAࣀ@VEP?@ӡ#At'U NVUR_>V$ MqTt Ve[^_UVSM1ېy4t>A8y4tA8q4u=Q8 :Q8 ސQ8뾐Q8"A89u>t܋A8ƀy4uQ8  A8u CN[^%s: cannot malloc scb_data! shared data%s: unable to allocate tmode_tstate. Failing attach Twin Channel, A SCSI Id=%d, B SCSI Id=%d, primary %c, Wide Single Channel %c, SCSI Id=%d, %d/%d SCBs %d SCBs %s: Host Adapter Bios disabled. Using default SCSI device parameters %s: Downloading Sequencer Program...UV8?V84V8XF8@0 ؉E uEEU9UEAF]~%tEBGم}])ˉ€}BuU[ǃj W贆t tG "G G N4MuUV8 F8UD ظMfE؋E؃u.ڃpE#E ¸u%E&}uUV8p F8UDpE܋MPSVG }u6G 4t,EغEtRSVɳG tG } tG G GUEfMffǀEE9E-UffdžFHH~4F8HA~4F8PB~4F8PC~4F8HD|~4F8HE~4F8PF~4~F8PG~4zF8PH~4pF8HI~4nF8PJ~4jF8PK~4fF8HL~4fF8@ ~4bF8@! ~4^F8@" ~4ZF8@#~4VF8@$~4RF8@% ~4NF8@&~4JF8@'~4FF8@M~4BF8@N~4>F8@O~4:F8@V~46F8@W@tS~4)F8ƀ~4&F8ƀ~4&F8ƀ~4&F8ƀ~4&F8@>~4"F8@?~4F8@4JtZ~4F8HXVVh1e[^_ÐUlWVS}EEEO q @E lAࣀ@VTU9~\t"Mȉ @ѡ#AgՀ]tPS JF`f@CuV8 | -F8@ }"FPhV̈jjj@PEPUUREPV 2SVK ~4uV8 F8jjj@PUREPURV t^N4u3V8 0N8E7V8:F8EMtŋF8U䈐~4tƋF8PF~4tV8;V8&V8M~4tV8BM`r"PShHN4u V8‘ F8 uwtOV8_SVCp < s@Ph AV8‡V8‡U@ҡ#Atofe[^_ÐU WVSuEE~4u V8N F8@NEU1EFW8ENG8X>E4tG84uW8¹W8ސG8OH:QDrADPPh`qQ4ƒURhEPURE PV tEPPWÃM]4uW8º0G8 jjjUREPUURE PW GHExE4t"G8U􈐐4uW8¹W8EݐG8؋OHA4AD9s0UREPUREPU RV t WEGH@E9Eetkދ[EPUREPEPU RVx tҋF@uU P,F@ P @Fu fDB`NVW6E듐4G8UEe[^_ÐDisconnected List inconsistency. SCB index == %d, yet numscbs == %d.UWVSuEEEN4u V8? F8@?E}$t>uV8,F8V8/~4tF8~4uV8¹V8ސF8NHQD9rRPhV QƒjURURURU RP tLE} tSEPVÃ&]~4uV8º F8؃}u2$]~4uV8º F8؁}$t~4F8Ee[^_ÐU WVS]} M{4t C8K4u=S8º:S8ސS8 .S8BC8tЋC8ƀSgtC{4tC8{4tC8򈐺-S8ºS8?{4tC8P?e[^_ÐUMy4uQ8¹ A8ƀy4uQ8@Q8º Q8B@y4uQ8Q8@Q8B@ÐU WVS]u }K4uS8S8"C8Et݋C8򈐐K4u)S8º&S8 *S8>=C8tԋC8ƀSu[{4tC8P>{4u S8$eS8$YS86S8º:S8E={4tʋC8{4tƋC8򈐺{4t‹C8Ue[^_ÐUMy4u Q8 pA8@ py4u Q8 A8@ y4uQ8’ A8ƀUVSu~4uV8V8$ V8B$߈BN4u"V8V8 "V81F8tߋF8ڀj>~4t͋F8V~4uV8V8 V8B Be[^ÐU^8àE[V8»^V8¼AaF8Ee#EftMtF8U~4tV8~4tV8AEЋFH@E9Em~4+F8M̈e[^_U WVS]{4tZS8s4u S8‡ C8tEu/S8,S8‡릐S8 C8@ȅtS8 Bs4uS8S8$C8@EtS8$B{4u S8C8@Ss4ufS8cS8 gS8EhS8$kS8mS8pS8BwS8†vC8@ȅtS8 B{4tC8UP{4tS8$B{4tC8P{4tC8{4tC8@{4tC8ƀ {4u S8C8A^~e[^_ÐU,WVSu} G8,W BE芆8Bu GFG @ttWVrucjW A8BuBQBPEPS]S莉jSV"FHxEw t G f@  G f@ e[^_U,WVSE} _ KEA8uEB8u GFsʀ}BuQjEPG @PVQEP#Ee[^_UUM zTuJXBTt BTHJTTQaicaic: probing for aic-chip STACK futzed at %d. AIC ID: %s chip revision %d U%d UWVS}_ C E"thQ"tCPwGPh`WUREPÃuG,{$GC,G tK(C C%wSw.GC G CG$CC5@ lAࣀ@CUC Cu R5@֡#AtZHUu1Gs,WEPt)S)s,WUR| t S)e[^_aic_minphys US]"th\{<~C<Sn]aic_poll U WVSu]F@E~D"thRtC}u W u G t VTE @t1h{Kue[^_U WVS}E w@WDU@$@ Xu$у؉$؋UBu]ȉE@u]`ȉ E@`u]ȉ E@u XUEXƇ[^_Ð%s: reselect with invalid selid %02x; sending DEVICE RESET should call debugger here (aic6360.c)%s: reselect from target %d lun %d with no nexus; sending ABORT UWVSu$"ЍBt?RFPhh "@hu@ȈE] Et6@$P f}URUtB$P f9zuff9Bu݃}uCPEPFPhD,hw "@_hzMQt A B UB MQ AƆE)۸f $Ex(}LF@VDut BR 搐 *UB(@t&F@VDutԊ B MAAA 1y "F@VDut݊ B: "F@VDut݊ B e[^_selecting %d:%d %d:%d busy idle U WVS}G@EwDu V F _|C$H Q)$QrZ"tRAPhSt C B C S CSW"tRAPh"[Y"th.c}u V F }u V F }u e[^_requesting sense UWVS}] C$EP UR)Ѝ"thojS!BUBCC C E4CC K(FC(tJf!F;u SWHSWG|Ct G|SP C_|W|S u We[^_aic_done resid=%d sense=0x%02x error=%d UWVS}u ^$C EP)ЍE"th{,uLF(@t C,<t C,-~uFC(FCXVWDFC(K"tBC(tPhC,uC4Ph PhF(tUJUf!B;uLJƇW^ VW& sVW5ES e[^_ÐUS]M A(tQuA Qt A B A Q A[aic_msgin n=%d imess=0x%02x %s at line %d: assertion failed %s: %d extra bytes from %d:%d message rejected %02x %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: reselect without IDENTIFY; %s: unexpected MESSAGE IN; sending DEVICE RESET U WVS]C@EsD"thTu )1 }uV F t t,C@SDut3 B~e}u'V$ ʐ .FC@SDutъ B  }uVFGu<t<u$< ~0u'9tj}uV V(F}tF(}uV V F}tF Fy}uVuf"tPWh`Lu%hCPhWhy$G P)Ѝ $tp`AG(ƃg &C@SDut׊ B( R"tPhjC@SDut B BƃAAAAA m CPhh( "@t:h CPhD"@thC@SDuq B|7CPhh  "@tihlPSm VV(`CPh"@thC@SDut B}tF(}uV V F}tF F}uVu"tPWh`e[^_aic_msgout retransmitting %s: unexpected MESSAGE OUT; sending NOOP U WVS]{@sD"thtt`FtPF(ui 9uC"th1t(F(V(묍V뜍)Vƃƃ ʈ H+$du&hCPhhs@$@ @ ƃ  ƃ vƃ  jƃ ^ƃ KV @V CPhs"@thƃ  uV F t tAxF @V @0PV@4uu tF @t̋P@FIFt uVuIF e[^_%02x%02x %d> extra data +%d UWVSE} P@U@DEEE"tDu ƒ uF P}u U UBPh$}cuF }BE@}"UB}uF.f}uUE URUE(t݊E O}Em}t@Uff@Ufo吉UfoUUnU]"tSh/E]~+}{Uffكσ~B}dE@Ȑ}bU߃}XE@}}}tfUB}uU u 퐋uF t}t,E@"h4UѐU뙐U.fUBUU }uUE URUE u-t؃}uU u ŐUB tE }u UUBȃ}uEU BU QUB"WU/qUB wUyuF ~9)M}tE@ }tUB""tQhAY}tuF/}tE@ }tUBEe[^_>%d UWVSEP@UpDE"t7uV F P}uVFPh$}u VF}u VF}u VF}uV.^F.R}u VEVUE0tEtAEm}t@V} ffm @V} fm㐐}u>V;V} fm|VV} lVFUU9vE]"tSho)]]~'}tV} ffE$E ]~:}hF}fV} ] }[FE ui}}uY}u VF}u V u F t}u VF"th4}u V/F/}u V F }u VFEe[^_aicintr sstat1:0x%02x %s: SCSI bus reset %s: SCSI bus parity error sstat0:0x%02x %s: target mode selected; going to BUS FREE reselected backoff selector selected %s: selection out while idle; resetting selection timeout %s: selection timeout while idle; %s: BUS FREE while not idle; state=%d %s: unexpected disconnect; sending REQUEST SENSE cmd=0x%02x+%d dataout dleft=%d datain %d target_stat=0x%02x %s: unexpected bus phase; resetting UWVS]C@ESDUt4B"th+J}uU EUŐUR U"tEPh5E t5CPhD U A bUCPhX}tE@ uCC@SDut B: "C@SDut݊ B!}uU E UR U"tEPhs}}*CPh} E@ U "thv"thMu&hCPh(hǃC|FtC|p S|C|B }u U UBƃ$E@q"tht;CPhzhm "@Ihu&hCPh0hF$H Q)Ѝƃ~(} ƃ F(@tƃ0O(If BGGG G$@u/O, `r"Mb)RWhnƃUUU }N"tht;CPh$h "@hLu&hCPhh}0E@}.U}*E@ h#cG$@,EUB2UUU `U UU/CPhGPhe "@h }>E@2}6UB}2E}.UB `}*E@ }&UB}"E@/ƃƃU U}tE@ t(x"au&h:CPh|huICPhoPhC "@thVSRF$@,u&hlCPhhS֋FFFtp B ǃu&hwCPh`hAU }tUB EZ}uUU!UB$}t܊UB=@gv==t[=t-L<<Sƃ<Sƃ"tIu$hCPhhqƃF HPPhS)ƃhc"thS+)ƃ"th+S)ƃ@UB(Ou%hCPhh*}tE@(}uUUB UBA}tE@ "tAPhQƃCPh/"@thS?QVh芣VS'U)UƃSs}tՋUBe[^_ÐUVS]u F,N(@;uGC@SDut B [ 搐VSC|Ft C|VP Fs|S|V u Se[^timed out AGAIN U WVSuF$@ x P袹 h @ lAࣀ@F(@th'hsF$@,VW @ӡ#Ate[^_,%xRESET UVSuF$p F$@ uG1;^ }/thN3PhPC;^ |уhhSe[^acb@%p xs=%p flags=%x dp=%p dleft=%d target_stat=%x US]s(s$ShMCPssh8S]ready list: nexus: nexus list: UVS"0hb^|tSo[uhot PBhwtS[ue[^Ðaic6360: SCSISEQ=%x SXFRCTL0=%x SXFRCTL1=%x SCSISIG=%x SSTAT0=%x SSTAT1=%x SSTAT2=%x SSTAT3=%x SSTAT4=%x SIMODE0=%x SIMODE1=%x DMACNTRL0=%x DMACNTRL1=%x DMASTAT=%x FIFOSTAT=%d SCSIBUS=0x%x UVSEp@XDuSCPu SCPu SCPuPh$u SCPu SCPu S C Pu S C Pu S C PhduSCPu SCPhWuSCPu SCPu SCPh uSCPu SCPhe[^nexus=%p prevphase=%x state=%x msgin=%x msgpriq=%x msgoutq=%x lastmsg=%x currmsg=%x tinfo%d: %d cmds %d disconnects %d timeouts %d senses flags=%x UVS]PhPPhPPPPh1 ss3Vh$CPshP}F~ɍe[^advUUM }uz|u'z|uB|tB|HJ||Q4tHAÐUS]K|tABQ{|u ǃ[Ð%s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d UWVSuF8jURj}Wjhh?P@$ЉÃ tSFPhF8jVDRh?uWP@,ЉÃ tSFPh$nF8VWCPhdCCPh/[xffC^Ct"Cl"fCbfC`CHCHCLCPCPCTC|SuTj sDSuCPh4, tj PCPh$jhCXPS ]ÐUEx<~@<P0Ð%s: adv_scsi_cmd, more than %d dma segments %s: adv_scsi_cmd, error %d loading dma map U,WVSE@ EP UJ8ME5@ lAࣀ@B|9EuR!EJ}WUt9t@ӡ#At`Yj]S}WjWE E@EPUREug}t-5@֡#AtMA,'j]S}W5@֡#A5@֡#AtUE艐BM艁ˁØ1҉߉ E艀UBM艁B]K}與CCCUBPfkPfVtf@jjURF\P_.dž8(tfHh;XpfHhe[^_/ (default %s) UWVSEEEtfFu(VffE%VfV fVfUԖ"EE#t>jss EPW}thI<荐sS UMyUE PufjfF EPuEu V fF f4<"hK<7URWe[^_(unknown/impossible media)/autoselect default %s%sUWVSEEtfAuQfQfAu!QEf'AEUtӋf@pE4"EE#t;}thI<֎vȎF Ejvv URU MyUE  <"==t=RPh=f47EPWVe[^_ÐU WVSuF4E CtuSfuFtBu SffCu S1ffCuSffCFuu S?ffC?uff@1ɐu1 1A~܊F<w1ɐu TDA~(u PffHhXu PffHhuf f@uS C IyuG@S̐fG@̐fCuSxf fCxuSpffCpuShffChVmp V u S ffC uSHffCHVUB4 @fB4RLe[^_USMY4uff@u'S4f}t f"S4f}t fA[ÐUEp RÐU WVSEtfFuDV fAVfV f;Vf8EfKF ؀7tf^ tfFhUtf@} E $pCCCDCCCDCt< fF fVfHtfF6E@L@}^@%EVWF7uUBL@LE@HsCx(tUS SSp(EC CCSVEPpPf,@u*<8u)<0f빐<@8tqu[<0 u^<0fZl %<8 Љk<@0 @t<f@0W@t<l % ЉA8pp@<f@0e[^_U WVS]{4fG2ttnt@u <$ <@$u9FtvFGP|F|tutufg4ǃx@u< <@ u`uO<$L %<$ ЉS<0fV<@$uG@t< % ЉA$@t<f@0e[^_U WVSu1F4EAGtPGE@PSЅ}C $)ËEf@2;t@ut Ef`4e[^_xl%d: transmission error: %x xl%d: tx underrun, increasing tx start threshold to %d US]<XfN<$@}E2nEPQPh:1@t<f@XSOR@t<@B$@t<@-@<-@ %<$ Љ</<^̘f<`f<Hftt2@]< % ЉA$@W<@/Et3^f=w&tċ<f@H@tÐ<f@0@t<@@u< <@E}]ÐUWVSuEF4E#<h؉f,D;Et͋<hfX`uHt‹D@t8EXHVU;ZHu VV3ut Ru V VtE@TVtjVVF }Ɔ\VaƆ\@u<f <xUt RЋEe[^_ÐU,WVS]EjuV~{4Pt Eu샻@<f@1ɐuFE샻@u< <A~EGLEUUGX@t$<f@@uO< L<f֐<f[<f6<@ }tEP@tŋ<f@\u5`r"ShHe[^_ÐU WVSEu}H~ tAF EU V % ЉE  F G6~ t?u5@ xAࣀ@pAuj5"h襛à ËpA5@֡#Atu{tQfC@ xA@fAࣀ@Ћ#At;{CS SfCjj Ãu JEx`5@ xAࣀ@=&Aujj&AS t!+$A @ |AC &A5@֡#AtzC t#CKC(C$C,C0CuSsUrjR?UBC CR]E S % ЉAUR UQ UE P LU UPU 1e[^_ÐU WVSE1E|uDSS |u&UJ5@<0f|k|F|FRVS}t%Mq  % ЉuUB(tvP(|t]tA{ t*LS % ЉC AGt { t?uƋEU B L@1[^_ÐUWVS}EE7W4/MM< +fW4Bu LJBERPV}t EMAEEG(tUrPSЅ}C $)ËJM<u)ЃDO5}t"UHMA AfG2e[^_Ðxl%d: initialization failed: no memory for rx buffers UWVS]C4EE=@ xAࣀ@SPt U}u(@7<f@(S@<f@XSh'蒱 @<f@1ɐ@u<<A~1Ƀ@u<TH1f<fDHA~уS7ulQPhܨ##S <fO<Xf<(fRu_S]</f<jFPPFEPl>vS8 fΐS8f0C8@tNUM f Q{4tϋC8f@j Nf{4u S81f C8f@jُ EE9Ee[^_ÐUWVSE8<pEUt*BMu ǁBE@EuE&~ t:M]V % ЉUF E6~ t}u5@ xAࣀ@pAuj5"hwqà ËpA5@֡#AtIQtQfC@ xA@fAࣀ@Ћ#AtQCS SfCjjÃuMQCEx`5@ xAࣀ@=&Aujj蛥&AS t!+$A @ |AC &A5@֡#AtPPC t#CKC(C$C,C0CuS臬UR{sMqjQUBC CRN] MEHUPf@8wt f@ @MfA `Ef@2l"UB@B fB M@8u48UB(tMQP蔘Et 8~}t@'G8@tIt_4uW8uu W8 G8@ e[^_ÐUWVSuF`Vh)Lle[^_U WVSE`XE1}u' ߁% ‰" ߁% ‰ UDŽDŽBUrdždždž1[^_ÐUWVSE`EMX1s}jWEP7u 7h?u# ߁% ‰" ߁% ‹MT EG?~Eǀ1e[^_Ðdc%d: no memory for rx list -- packet dropped! U WVSE} UX5@ xAࣀ@pAuj5"h1à ËpA5@֡#AttQfC@ xA@fAࣀ@Ћ#AtgCC CfCjjLhÃu#U8Ph 7W5@ xAࣀ@=&Aujje&AS t!+$A @ |AC &A5@֡#AtC t#CKC(C$C,C0Cu-U8Ph Sl7CC CC C CjSGwEP@ts sE`U S % ЉGG1e[^_ÐUWVSu E@ueXUDjSv#EPWUROWЅ}G@$)ǃUXE`EhSpM9tEtu?;u K;ttK)UD9sÃEPWURVEpSEUe[^_ÐUWVSuh1ۉX<8}%QЅ}A@$)C? <8|݃@th#1[^_ÐUWVSE4EUhX~‰UE`EUځ?EP@tA%=t3t U@tVVEPUځ?Ef}TUBL@tBXEPVUR]tVЅ}F@$)EP jEPjBPUBPJÃEPVURVЅ}F@$)ƃu E@LIjStUBH{B(t SPVjSsSWEPHv EX<uUhe[^_UWVSE}4fG2E`EU;\4XMA%H=@tFEdA9 uf} PE`UM:u stf},GTtGXtGXuEPL xWXGP]u`3tPg3UdUBy0)‰UME;\t"MXEEU`}tfg4e[^_ÐU WVS]=@ xAࣀ@C4EQtY(u$( $@(9utƃ;;uj%=u\u Vr;u;VrF$t)F(t;Et P>5`r"Sh 胍=@ס#At e[^_dc%d: TX underrun -- using store and forward mode resetting increasing TX threshold UWVSuEF4E@4uq(u$(u$@(t V'1$81,EO$8X(tË$@8$(*$Etы$x(t@t8UZHVEE;XHu V/Vut VtdVdtO(u$0틖$0 $B0 B0($$@ 8PhK9<t<u VQ(u$0 $X0?T=uKh4(u$0틖$0 $B0 Qt'hR蚶$02@Th]h(t̋$X0(u#T$0틎$0 ؉$B0 TB0(u$0틖$0%$B0%B0ǀt;EXHVU;ZHu!VVku tVV (u$( $x(($@8Ut REe[^_UWVS]EEE} w Pt\U9t }Ud)ЃEX A}u!qG ߁% ‰QMQЅ}0)‰UE?97Ud`U XL@P tEXLQtXLPtd@~XLEXEU1[^_dc%d: no memory for tx listU WVSE 85@ xAࣀ@pAuj5"h}#à ËpA5@֡#AtMtQfC@ xA@fAࣀ@Ћ#AtCS SfCjjYÃ`5@ xAࣀ@=&AujjW&AS t!+$A @ |AC &A5@֡#AtfC t#CKC(C$C,C0Cu*S^U8Ph-衱7)swjWhGC CW\^E 1e[^_ÐUVS]E3;&C5\EPtEPVuEPuVt4UBu EEK5eC(tuPuJE0`u>Et1@u ǃE@}4E\Pu'(u$ $@fC2e[^Ðdc%d: initialization failed: no memory for rx buffers UWVS]{45@ xAࣀ@ES S39 <t<u6(t$7$1)$(t狃$9<t<u"(u $4$%(u$$Pt)(u$ $ <tat. uy(u$~$o(u$̀X$̀G(u$@0$@(u $ $Qt=(u $0틓$0 $B0 Tu8(u$0틓$0 $B0 o(u$0틓$0%$B0%B0(u"$0틋$0T Љ$B0 TB0(u$0틓$0 $B0 B0(u$0틓$0%$B0%B09B<v (u$틓$$%9u8(u$틓$ 7O$ 76(u$틓$ < $ < (u$0틓$0?$B0?B0(u$0틓$0$B0B0S78PhtFS 5@֡#AF<X %$ ЉX %$ Љ$8$($@S(C$X % ЉA(;$X % ЉA (7$@8(/$@((u$0틓$0 $B0 B0S(u$0틓$0 $B0 B0($@EP|aLSG4 @fG4 5@֡#Atg5`r"Sh |e[^_ÐUVSEV a9uVЃuRSm ƃ;1e[^U WVSE} V,a9uVЃuWGF(GF$Ge[^_UWVSu E8@U xAࣀ@EPVW4UREPT]Ã~U@ҡ#A2i w$1i  i t0i tpc5i 86i(,CEH4Uxu"W}EPUR聻 W[EP4td%@f=@uIuWIQ%@f@uItW%-@u(LJTW@t WUB4H1k1i uEPUR0dEPURe[^_ÐUEPUVSEU tz% tiQfӃtu܅tfAufuftfh N. 1e[^ÐU WVSEu u&F"FIGEȋUf tfGuft F% F#[^_UWVSuF0E@U pAࣀ@u S1f fCuSffCjd- u S1ffCh- u 1ffuf f@EuEL0U2DE}~хu S ffC uff@u @ff@t ufuu S C pVBu1ff@UB5tuSffCuffuf f@uS 3C 3UB4 @fB4RCE@ЉE#AEte[^_%s: large packet discarded U,WVSEEUMA4%@f@oE^1ҐS uUeM=vEPh/oE@Tt*CUu ǂCMSEfI ؉fI;w E<)UuΉMȃEtf@}t f}uW G uj[* Ku݃}uWG|}u W  G G UfB2J5WjW@fhW1fkWnEWqW1W1f4fN}tG}tfG@}tfG}tG}tEGMt'Cu ǁCE]tw}usK WfosK WffS t}uCOD CDGu}u W1ffGE}}t}G}fG}u W  G G }fMfA2A(tURP?4MAPEPJG}u WfGfe[^_Ð%s: receive interrupt on empty fifo %s: successful packet caused TX interrupt?! UWVS}G0EUu1Sf }tfC}u S ES U}uS C MM Eu1HS S  }tC Et}tC UBLMtJ}uSfCf}'GPh`3ΘfES `WMt7e t}ufu}tfMfa4fA2Ew}tC }uSfSS`fC}t߈C}tfC`}u SfsGPh3t1ffffS 1fMATtE@Xsf@}nfkf@t}ufu}UfMfA2E}BC e7f@}uSff2CƒMQX‰QXtɋf@Ef@2U tWbW MQ>M}uS ȈES ES ʈU}tMK e[^_Ð%s: can't allocate cluster for incoming packet UWVSE0EUU}}}t Ef@}uUfUfݐUJ}uUffE URfUfEŬt }GLjtfE5@ xAࣀ@pAuj5"hBà ËpA5@֡#AttQfC@ xA@fAࣀ@Ћ#AtCC CfCjj;ÃUS}}{ {5@ xAࣀ@=&Aujjl9&AS t!+$A @ |AC &A5@֡#At!C t#CKC(C$C,C0CuESX@E@LEPh7Z EfȋUfm%s}tߋEfȋUffEt-eU 2}uUUfp}GE@H@(t SP,EC CCSVURL }t}uUfu}t}f}u UfUBfe[^_U WVSuU 1@E pAࣀ@2i w"1i  i t.i tn]5i 46i((?Sǃ+N4UxusSBEPC0P֥ V4ЃAf@u!Sf4S t/@u*SIǃSSzui1i uC0PURNC0PEPPǃ4u3SQ1#RPURVYǃE@ЉE#AEte[^_ÐUVSu@ pAࣀ@VqV @ӡ#Ate[^%s: device timeout USECPhd=j݋Sn]ÐU WVSuuGEȋUffGuG EȋUG uE1ɉȋUf f@uGE1ɉȋUf fGu 1fffFb[^_%s: device enable failed US]u1t'SЃtCPhd>юǃ1]ÐUS]t tSǃ]ne%s: where did the card go? %s: setup failed U,WVS]E싻 E苃ESZ‰u#CPh?*WEƃ\ HtI]ǃHǃGǃxDǃTH1ҍB~ t@`h} uFtAEPjuVjEPEPWEPO1҃ Ѓ}t0 B~}"GuuuStCPh+?p@ `le[^_ÐUgd2fd&4QEP.ƅethSjW,WgdSWhpMUE}$ Rһt{u. t)ƒubGG1I)ƒu:u1Gt t"EPWQEPWQ[^_RAM diskfictitiousULWVS}] hhT?h@V|?? ??? u ?djhPh\?fX?jhPhl?i??f?f?? ?|? Љ??f޻?T?T?WEVػ?WEVSafܻ?jVShpM}$ Ru1[^_ÐUVS]E pjV5d"tǃ1 e[^US]M A=߿w9s BAǃS.ǃǃǃ]rd_idleU WVS}"jh=R5"W6ƒt׋C$C$1ҋs ϋG@9u fG4 t]QjV-PjW à tfft\RjV#CQjW辴Ãtu fuPjV-uW;J@O􋅠P5t';tf}RjV,QjV0#ÃRIDžPt9=t Ru F(t;FX~ DžF,DžOF,!t%PjF,RPW--à DžtAFXuEt PelPjF,RPW,à DžBH u#F,BF,0 1;HA fٍC!9PP49u :.t t9fCQ! 9y!@\S!PRQ uP@tRP @T N,@tRP BT N0PF0PPSRM ;AuPSPxDžV,F,;*F0V,9%H9tDt P[iPjщSQW)à !@HN,uDžF,V(t PhA@tQ0Wst RQ F0upA%fftuF,F( hQjW 'j9F0PPv0wD&à tRhWKfQjWÃ輮믐F09Fu NgfG49~P9V0PPv0wD<%Ãg>t fuQjW%A@tQ0Wq1x[^_U WVSu^xFV O tMQjwPSebà tu=fFNtUF#GBHVE1e[^_Uh@jj95xr"FA0@1ÐU WVS}5ܞ"E #@At5U ;Pu$;xuXVhS u u1e[^_U WVS]ܞ"E{ s#@A Ѕt!9pu9xu *utZKEPjjC4PO1e[^_ÐUEHttJ@Ðcd9660_inactive: pushing activeU WVSEXx=d"tf{4tShԍ FWjSl#f~xu WjSZ1e[^_Ðcd9660_reclaim: pushing activeU WVSEX=d"tf{4tShtmVSp F tP衫F +A `A5@ xAࣀ@ = ~j:;AAuAA8B5@֡#Ateǃ1e[^_ÐUVSU] EE1BtfCx@fCxfǃu7Kt+Rt#EPjIډЙRPs#E tppHubF uKyF @uKx@FuKx FuKxFuKxF@uKxF ‰S|VF ‰1ufKxmC|ǃEt Pae[^U WVSu EE1u>Nt.]St#EPjIډЙRPv "E xHur^`SG=PuSG PFpPG Pu F`VdFpVtFhPGPuFpVtFhVl1u(FpPEP/FpVtF`VdFhVlEt P`e[^_ÐU,WVSE} lXHMHMHMHM@EG1Bč @))C E身*E)2)y)эpQ)DR})))؍98) U@M)‹E)ЋU E0Cu[^_ÐUU B$fBxU WVS}u _G|{t_ thPSjhPGt`PSAhQlA`QdGpPSt_thPSjhP蠄Gt`PSAhQlA`QdGtpPSAhQlApQtfe[^_ÐUE j0uÐUVSMu QYB B B ÍQ I B B B u  ˉf[^ÐUMU A #BB@u  RQUVS]u KSA A A ‰VK S A A A ‰V VKSA A A ‰V[^ÐUIEEE_1282IEEE_P1282RRIP_1991AUVS]u {uaC t uS uj h&CPu4{ u5j h0Stj h;St1 fe[^UWVSEUB \!uCEPM A\SE!PC}u6MEPA A A ‹M A;HtU BTXދMEE @Z~u=]{t!8uC8FuU RVC EM yEFv ƍF9sU ztrBtkrz;~}`J ZF9Ku9wEEPjvNWv tP u!EM q pHy#e뇐Et P(T]{t$EC uU RMQCЃ{u܋Ee[^_ÐU8E UEЉUEԃh"EPuÐU@VSuE MU]EMfEU]ExfEP\F D!PF!P#"}wEPV`e"PEPVne[^ÐU8U EMUEffEEMEh "EPuSPUuEPURWVE;p tVtVuVjYPu `UZ)PR.y VjYPu`E)SPyjpLPEP^URGDPW1h[^_CD001%/@%/C%/EUMQ]SW7Et P>UMAxf "Bp$bbbbbbU|ABHuU̪ABH]SEuyÃtFEEǀU|&ABHuBu]UZMH]9CTuEH0EU1e[^_UEU f ABA\B1UEP@x@ubxu\x uVx$uPx,uJfxuBxuxtBBpHw9$$,,$,, 1ÐU1ÐU1ÐUUBr BPq|AxP肓ULWVSEEċPUpMAFAFAxfFfFA|FF A`QdF$V(AhQlF,V0ApQtF4V8FDAXFFyXbMypU@ xAࣀ@ЯAujjh蹆ǃ NjЯA@ӡ#Atf}ȍEȻXEEEEEEUċBE]MЉMBEB EEP u+EFF+ A `A@ xA@ = ~jW00AAuAA8z@ӡ#AteF@F<UB@F BXFHFLUBp1e[^_ÐUMC#GEQHU];Gv QExuT5@ xAࣀ@ЯAujj hsyà ËЯA5@֡#AtEYWEPSUREx+ A `A5@ xA@ = ~j S9{-AAuAAZ5@֡#AtXu&-u-UzREPS®E+ A `A5@ xAࣀ@ = ~j Skz/AAuAAZ5@֡#AtWEE])CEE)B1e[^_ÐUS]s s,ses]ÐUS]s ss5s]ÐUUJr Pr4PqÐUUJr PB P4Ppcd9660_strategy: specU WVS}_K\EApwh!CP9CTuVjCTPjsPQhƃ ts4C0C0SF3U{TusA) `A@ xAࣀ@ = ~j?6k7AAu A AA@ӡ#AtoH>_M+ A `A@ xA@ = ~j?EPzj8AAu M艈A AMEB@ӡ#AtGE P<Ee[^_U WVSE0t ҉ MU@=wq=w6 w0AApA@PA=wA=A{A=wmЯAf=w1= w0A=wKADpA=@w5PA.=wA=wAA=wаA@ xAࣀ@u"jj?M@Pzfǃ Nj@ӡ#AtLFvPWEpV,Ur+A `A@ xAࣀ@ = ~j?V@h9AAuAA0MAAB@ӡ#AtEExe[^_ÐU WVS}?1;_s%1G@ t PaC;_rGw+A `A@ xAࣀ@ = ~j?VJg4AAuAA0GGB@ӡ#AtDe[^_ÐUVS] {tkCu[CuRjs 8ƃu >C  PsVsCPEp { tFV@и1e[^ÐUVSu] Ctfch jj%PCPv }{ ubVjF0j jC1RPsss j0u5Cu1)jPSC%PRv e[^ÐUU Jt6bB  Pjj%PBPEp zu1ÐUSE] C8C<ߋ@@0%C@C9CrCPC@SCS@K<)щ+S8PS8P@ @@C9Cr CPC@SCS@PS@[<)ӉX@ @@1] swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonupdateU VS A5ܞ"^h")h [C芁9h4AFt@ A54AF 4AdžAเAAAtHAAF@5AFDAA0)A0)A54)AF,F1Ɔ dž"jhAh&Vh0hXAVhhALAF8Au‹FFf@ FP@fv@"ft@P@x@T@ȵ@`@d@ܵ@h@@FA1Ƀ1ې,0AĭAAAAv8A@菦"t[Sthb5AH=@5APhh@PB Ѓth-h@X@f@4VjP\@NPATAHALAAAAA`AdAdždžV EPjjjVAM thyuAgPhu0gP{ h jjhDiSth)h$jjhTAST]SkE3CPjs4@ T/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d UXEEE@EEJEEP@t%uhlsPhb uYXÐinit: couldn't allocate argument spaceexec %s: error %d init: not found no initUuU@؉Ft 1MYTK,t9S4t9PdGC1<C4UVt$0EjREPF tjHP4euCXtPƃ% ܞ"C`A`$9v‰Q`fǃ04MAHPr34+A `A5@ xAࣀ@ = ~j4{;AAuAA844B5@֡#AtS, StC B S CSLt CPBPSPCLjCpCPJHC0O({+A `A5@ xAࣀ@ = ~j*sn4AAuAA8CCB5@֡#Att P@+A `A5@ xAࣀ@ = ~j)S0AAuAAZ5@֡#At! "<uLuGuFt<K,C4UVt#0 EjREPaz1s[Leu ]FuJjhc(h MQ\"3CXVS+jVl<Vg` E1e[^_ÐUSM] 9YHt5QLtAPBPAPQLCTALt CTQLPPKTCTAPYH[UujjjuUujjj uUE t$t t u-$@t@ tɀujjQuprocppwait U WVS}Gp tr"A"9|u9|h-#mjV t*_Kt9u;CpvjV#4h 5d"-Eu 5@ xAࣀ@ࡰAujj)h8{à ËA5@֡#AtMA=4@t A=A~3CƉ%- ))։5A""9A1" 4AkAAPA;"z9Q4t዁9Pt֋A4;A~ 9"~"@;A~ 9"~"Iuu  h+A"C1AC44ACt4ASP 4AC 4ACK4# A|@C8t S8P<A#C4 |@#S4S} } %X"1ҋN9u 9vVX"1\"1ҋN9u 9vV\"1ҋN 9u 9FvFV 9u G9FVG9u9vE)Ⱥ)E)غ)ʁ%jMQPREp R|r"N9u 9vV|r"tr"N9u 9vVtr"N 9u 9FvFV FGFGF G 1e[^_ÐUE jpEPR]ÐU uE@ 9B A-$$_________________________________A^P9tCO9t<@9t39t/5ANp9tX9tW9t9t @9t9u1[^_ÐUWVSE EUR$U8wwxt tu ]MyMUCCU셂tCM셁uKU셂tKM셁 tK@uUB,tKMA.tK CuK!Cj EpS蟣u-UBt!j SP"uSWMQ 1e[^_ÐU WVS]}S$M I桀@ Aࣀ@M Gu wG%} u*GtK,c,G t{4tK.c.Gt  !G@t  ! Gu  !Gt  !t Ч"tu!} t !?u ! @@#At聻[^_US]1ҐЧ"ttJ B~[U WVS]s$tZuQU!ЉEЧ"t}t !0udž dždždžc.[^_ÐUVS]M U1@ Aࣀ@t"t =t#5A% )A!I@@#At [^UEU1pauseUSEM X$ jhdh(S$t]ÐU VSEu X$u Ftj PPuxu1nj EPRiuZEt t D%}~'EEE 1 e[^U WVS}u GEVv ~NPqÃuavSEPWFuDFt PS_1/tt jjRjjR jPvWe[^_UWVS}u EWUE}tO4A{4~1C-u+9t'VSEPWtEt VS[uftPuXXt={4~-C-u'VSURW4tEt VST[@u1}ue[^_ÐU WVSE}u}h؃P Xt&CH9tP9t@9t 9t9t9uE PS[@uJP{Ãt7t&CH9tP9t@9t 9t9t9u U RSge[^_ÐUEtPFtju PÐU WVSE} ut(Xt!tC,t WS[@ue[^_ÐU WVSuUF$EM IF-t~uvF@<uuRU RU4@ ЋE UtA!} tЧ"t EE(U RVe[^_psignal signal numberUWVS]M Ivhh_E 4Ч"C-t Eft EIEu7Et ~ƃ tx t̉t }uR{1H@E Aࣀ@C1<t <t~{,C,t }}!E f0CH@,ujPSC-} tdt$}u !։}tJ{ltTC1Zt !։H{ltB{,}EPRjQ/ƃPhu؍[^_ÐUj uQNÐU WVSu} ]hV>^u EFwGwl$tXtdtdtdtXtdtXtXtdtdtdtdtdtdtdtdtdtdtdtdtdtdtEF EFe[^_U WVS}1WU} 7^u7O;] v] Wt tLtEt juS6UR袏SEP61t,OuS6UR SEP6Au%)^)__W ])] } ~ 9e[^_ÐUVSUu ~tF T{u HFݐFt tR3A} KNFV 1e[^hashinit: bad cntUSEhuR9 9~uu P19} @9|EKЋ]ÐUjjj…u1-EBE B AtPABAÐUMtABQÐUS=@u Ats CЃu]ÐUjjj…u1-EBE B AtPABAÐUMt ABQjQUVSuAts VCЃue[^ULWVSu EEE~t&E2PUB0hÃVB v REP6 ÃEH wt$Hxpxxxxxxxxxx z} uEE<}5w-p%8ND; -FV tjEPR^Ã!FjuPHu ?=?t)?jSc?=?u?}tjuvEP8ỦUăEPvvỦURvFHPEP׉à FtG}tURPEP?=?t?h?%uF tjPUR蔊É؍e[^_UWVSME }u]ttt RJ%@$Tzzzz{${4{H{X{d{{(|T|t|||}||||d|{|||}{|} }}<}T}X}\}`}4}d}hh?"hp?hF yht?h?SVWohxr"htr"URh|r"hAEEPURSVW…A}}9E}E x4t EA1hh@URSVWS…tfubE AXhh'AURSVW#…t6u2EA(XAEEPURSVW‹EXA=VWr.jhHAE PVW VWHPAPkVWha jjjjjVWh"URJh":h"UR.hhX)ASVW^KPChT"EPSVW?j'j#jjAt8a0tp SVW=-e[^_ÐUVS]MU} t EHw}$}}}~ ~~ ~8~hL"h@RQS+Fj1h*@ P8"A5@)Ɖ PhRQS-e[^UVSUM ]u1t9w Ct}t 0tjRVut jVSwe[^UUM 1t9w +}t tjREP臅ÐUjuuuuu u&Ujuuuuu uU WVSu] 1҉у}t} 9stu }tE;Er y}tJt.U 9s%\D2MQV蹄‹} \E QURV虄ƒu }tMQV}W‹E0Ѝe[^_ÐU WVSU] 1}хt 9 s )}t  tQREPƉe[^_U WVSUM u}]1t9s :t 9]v'tSRW跃ut SWVAe[^_ÐUSME U1ۅt9s *}t tRQuQÉ؋]U WVS]]E 8uPA  U yw E hjShl!AtQ+]U  ?5l!At$'vۃj(SV軂u؃(6u+]E 1e[^_ÐUWVS}E UxDžtDžpt Uptu?t 4ADžl{1 H$ข ̂G9C4UG9B?C,@ P G9BlCSG9Bu{pve|VSh8xPSX hx8PV3u{xpDt[luh+ADžl݃}tx+EU9tv t¬ E1X[^_ÐU WVS] E@ C{UrB{ 0B1<t<u+ǃǃ ǃ$ǃ(FEP @ $(2UBHt @48 ǃ8M@<@f@A,t5CP t+BlDBxtHHB|L ǃDCxЉdM@ 9Hu dUtjPPPfǃ\ǃXfǃ`fǃ^j CPhPrƃsjMtPQƃ{EH11҅tAPQT|e[^_Uh?h`h?h ?hh ?h?h ?US] ܞ"tB@ Aࣀ@t  @ҡ#AtJA|@ `r"gfff)RS;]ÐUWVSEE A҉U=t&Au=&A4AC1<wChX" ECh5@ Aࣀ@du USdShCd1EChCdUS`M1K`S 1vU;ܞ"tA{1u;C,t5 8t%S؁ S藁  5@֡#At•[h(A5`r"URe[^_ÐU WVSu^` A ׋9v F`KBt:Jt,Í1ÅtBuՉ^`Ve[^_ÐU WVSMU ܞ"Ue=@ Aࣀ@=0p"u =At<@ࣀ@Ћ#At蝔=@ס#A胔KlEǃ%AAu A AZ}tEPCpP=}tdC, C,t"u ЅtS<1t{lt SWC1#{lu E1C1C@@ A=@ס#AtuC,€S,t%C,u#x}tCpP6}tYu/tC-u Ѕt Sh1t&S$Nt  1e[^_ÐUVS]5@ Aࣀ@{lt${1uS S#K-5@֡#Atre[^ÐUVSUܞ"5@ Aࣀ@=0p"u =At:@ࣀ@Ћ#At5@֡#ASlǃǃE %AAu A AZC1C@@ A5@֡#Atr[^ÐUVSu@ Aࣀ@Flt4%A9At 92u9quQFl@ӡ#At[^ÐU WVS5@ Aࣀ@E%AE9ClCl9_uW{1umv SǃC1C,tS|C,uhA_뇐A|@lڋd5@֡#Ate[^_ÐUVSܞ" 5@ Aࣀ@S~{C@@5@֡#At讏e[^Ðpreempt: cpu_preempt not yet implementedUVS5ܞ"}thpG: @ Aࣀ@VzF@D!@ӡ#Ate[^ÐUWVS=ܞ"]S虽dAS)`Au)} @BN?B~F_K9Lu9wFK 9u9Cwj W](jWMS C9 u9CvSX~'Gxt uƇ W||"AWzh`A袼e[^_ÐU1ɺAAAA~setrunnableUVS]5@ Aࣀ@C1w!$ଐ༐ଐhXK8C-t!f0t0H SC1C,t Sx5@֡#Atv SKǃC,uhA#A8sA|@e[^ÐUM A`TP 9vЉˆ A9sA|@US]S`B$9vЉC`S1v ]UVSM5@ Aࣀ@PAPA)É]]BQ)‰ЉC} MC@BQPATA@ࣀ@#At{UHAHACLALA=?B~BHALAU`A`ACdAdA=?B~B`AdA5@֡#Ata [^ÐU VSu >u8]S蘹EEMS)ЍAjvQ:qe[^U VSEu 2R@0Ҿ>t ~j]SvqucEEuKMb)‰V=A~-MPA9uPA@9|PA9} V1e[^ÐUVSU 1:t 3Jt)Eʚ;ؙ=`r"ÍEXjQP pe[^nanosleepU,WVSE E܃j]S0pƃEE}KMb)‰WW5t O@ Aࣀ@ӺPAPAEBGG=?B~ EGWVƃu@ӡ#At览Vh{h h$?ƃu#u1U܃z@ Aࣀ@ӡPATAEU@ӡ#At3EU)‰UUB)ljB} MB@B}}BEEEMR)ЍAjEpQ[nue[^_ÐUVSu 1>t ]Sbj6S!n uVtjRhlr"ne[^Ðdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds U$SE] 2R@0'tjEPRmStjEPRm;tnU~~ Rh==A~CPA9uPA@9E|+PA9}PA)Ph5(EP{tEUlr"pr"1]ÐUWVSEU U2R@0"j}WE0lM)ʉ)Ѝ O; \"~hr" hr"ștȅ}ۡ@ A@55A 5A@@ࣀ@Ћ#AtUZtAC)щM)ʉ)Ѝ)ƉwjSWdku1e[^_ÐUWVSM} ~ @ Aࣀ@EE􋑠UMuPAPA9u F9| PA9}EE]PAU)‰UFM)ȉE}t^tjEPSjKFFtuVW)]EEP7uS't @ Aࣀ@􍷨VMu}tBPAPAMBEE=?B~ AMEEPHPPV EE􉇜EE0OE E E E @ӡ#At1e[^_UVS]jSu"uǃǃ5@ Aࣀ@=?B~BPAPA9uA9CPA9~7PNPPW 5@֡#At' 5@֡#A7-e[^ÐUMwA|=?B~ ut dr"9}Q1ÐUSM] A 9}Qu)(@BA JQA )؉A 1ۃyut:9uyt%QAQ A )؉A y@BA I A 1[UWVSu} E@ Aࣀ@AA+EMB+FAy MA@BU9u G9A}9} >u~uAAVE@ӡ#AtE[^_UWVS@@@AAA"A1r"9}C $A1ېAt APA ADAF9|[^_ÐUEU MPH @ÐU WVS]} 5@ Aࣀ@Ct#t AB A@Q CAC @t-AQ)‰9~AC AY& u@C@@5@֡#At~[^_ÐUSM@ Aࣀ@At$t AB A@Qa@ӡ#At}[ÐU@tAR)‰Ѕ1U WVSt AB A@AAƒQyq t+At AH A AAA@ӡ#At|V׃@ Aࣀ@Ӌ @tAQ)‰ЅI@ӡ#At|e[^_timeout table fullUVSu @ Aࣀ@AuhlF't CB CAC @ѡ#At |u uSKVSe[^UVSuU @ Aࣀ@ @t_9quS9Q uNtABA@AaAt AH A AAA u@ӡ#AtD{[^USE] 2R@0{u 3]U)A)A)A(A,A(AAAAd"h"AA`" Ad">>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d U WVS}] tSwE]=l"t=Cphea)f{ u hxCPh{:)tw URw.xuCph}$w URw@Љƃ=l"tVCphƣ(;w~$tGt jP耛EGwtjUR`e[^_>>> %s probe won >>> no winning probe U,WVSEUEE EEU1} tU B @x EE=Atg{tUC ftBffv8sf>|/U 9B uSEPf>}ԃ${uu=l"t,Et@ph'hs'Ee[^_U WVSE} tU B @x E=At}{tlC ftYffvOsf>|FU 9B u'}tSRu؃PE PU҃f>}${uue[^_ÐU,WVSE} UEEEUEE$"f=$"|B\v"W`v"puVEPf;}Ee[^_ unsupported not configured U WVS}u ]VWu}tSVPWtGPV4p"%1e[^_Ðroot device %s not configured UVSu] SVjuVhA%1 jSPjee[^ÐUSM ]K ~(Kgfff))0 у K0 [%s (root)%s at %sUWVS}U tG @x t ֋^ ӃSW(ƃCEUV4f{ uC9FufCfC F,AF,A0N ,AV~uFPh"$,GPFPh $}tjEPU҃AtD{t2M9Ku!C;Fuf{ ufC f{ ufC${u΋RuEPVWUBЃVqe[^_config_make_softcconfig_make_softc: allocation for device softc failedconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %sU,WVS} GE;/wh jj3趒ƃu h<3VsUB~ F(f uIW VG9}AMyt8<t0FPVWH9}Ext<uGFUzщMOv]EP[E)Í;vh|WFEPUrWSMDPEPWEF$FUz 9ۅu 9~MYjjPjEutPh@)SEPrt$SEPU22WjM1W UEVM<tEPhF,e[^_Ðconfig_detach: forced detach of %s failed (%d)%s detached U WVSu1N y{t Vu!{ tE PVC Ѓ-tU PFPh\\v"yt<9yu-fy uA;FufA fy uQF@9ufI$yuŋVt FB F,AVFVgVE uFPhV41O9}:u @9}<t;Guj7脑G1e[^_ÐUVSuF 1^(zu - u F(jVBЅt^(e[^ÐUVSuF 1^(zu - t$F(jVBЅt^(e[^Ðconfig_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureUS]{$uhjjj΍ƒu hܯZE B )AB)A]U WVS})AtH3C9x$u6t CF C)ACsC ЃjS蓏 ue[^_ÐU WVS}u 1(At Z9z$uVRuڅue[^_ÐU WVS}u 1(Aڅt?Z9z$ut t#RR-te[^_ÐUSEU 1ۅ| ;P}u1C(u1ۅt S؋]UE@,ÐUS]C,PS,u"C xt S@ЃjSF]ÐUSE]Cu CP荳ACAA]UVSUu B$u F$p‹^@;Z@sYz$tYJ$B@9A@s!J$A@9rCuAT9FT|9ʃz$u/ʃz$u#J$A@;B@r9ruAT9FT|ʃz$uߋB$F$r$[^ÐU1ɋU9s f3 9rreadwrit%s%d%c: %s %sing fsbn %d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)UWVS}MuWDE)‰U]athQEXEG0%t RuPEPU Rh*Uҋ_T < ShA>}|]ShDU҃Wt 0@F%0@;<@B@@@B@D@<@ 1[^kernel %sassertion "%s" failed: file "%s", line %dUuu uuhx9%s: table is full Uuhj|panic: U WVSu] =AtSVh4?A4?h;SVh$WaU WVS} @ Aࣀ@uZuVjjjW0@ӡ#At6T=AuVjjjW 9e[^_%dU$S]jjj<Sh]S }tjjPC;ujjj>}]U WVS}@ Aࣀ@u VjjjW @ӡ#At]S=AuVjjjW `1e[^_ÐU WVS}u ]=At "tu"tÃt/t+SW}t;"u "tite t`t[=AtRABLBZCB 9vىJJ|9|BB;BuHJ;B |Bt="ut W"Ѝe[^_ÐUܞ"B,t.@ xtE Pj@ p juXÐUUB,t@ xt @ 1UVS] +A `A5@ xAࣀ@ = ~jSs0AAuAAZ5@֡#At Qe[^ÐU WVS]1jt"{tjs тts EPjVWu  e[^_ÐUEPjuju ÐUVS5|"|"E Pjjjuà =AuX5|"؍e[^ÐUS|"|"u jjjuq =Au |"]ÐUS]EPSjju 6]ÐU WVS}5|"|"uWjju à =Au5|";1e[^_ÐUUE t,DEEPREPju‹EÐUUE t(DEuREPjud‹E%qo%qd%qx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad baseU\WVSE} u}tEEEEUUEEM<%tf Eԃ} u'}t E9E UMBUAMEPU RMPAMU<%tuM9m AMEEEEEEEEEXr$<P\v         D,x(h8DHP0} EURU܃EMqjEPU RMQY EUBÉUJM<u VSh'< u VSh+<VSh/EPE}}tJEԃ} u#}t E9EUGBUMQE PPG?u EU:BUO‰!! Eԃ} u(}t M9M>UE<}t,iEPU R<}t,PgAEԃ} u}t E9EMAMEPU RW'EM9 EE8 ~ EU: M9AM}Eԃ} u$}t E9EbU>BUMQE Pj>}E MEURUЅډUЀME+M ME*u#EEx}̃E1EU|BЋM MEȃЃ v}̃wEkM؀V1U|BЋM MEȃЃ v}3M@E8lu@EM MUU܃EMAEMEب tEUZr3MuM@tEEXEUBÉ} ۃE-M tEUBMԉHMuEب@tEUBMfEUBMԉ|MEب tEUZr.MuU@tEMY EEX11OEUZ1E3MEx&EMIM܅uED}|:EPjUR蠐t+E܉EM9ẺE}ܰIMMU tEMYq)EبuM@t EEX EUZ1kEK E3M tEEXp*UuEب@t EUZ EMY1Eبt tMEM̉Mą|eEE܉ u }twrM܈$P0M܈ uEب0IM0Mjj VS袅0M܈jj VS蹅Éօwu wM܀0E܈BM܉؃UM܈ uE\}ܰIM-EE!}UU܊MMEE];]}]Ā}tC Eبt;]}EEE؄uG})9} u}t U9UM AMEPU Rj RO}t>} u$}t M9MEˋUBUMQE PEPyUtw} u}t M9ME0@EURM Qj0} u!}t E9EKUMAMEPU RMQE%=uJ})<} u}t E9EU0BUMQE Pj06O}+}9} u}t U9UM0AMEPU Rj0OmrN} u"}tM9MthU܊MBUAMEPU RMPAMmsEبu})߉Oe} u"}tU9UuEGM AMEPU Rj :O} u}tEMEԍe[^_U WVS}u F =vju WYO@ Aࣀ@FBF B FBW1@ӡ#AtA1e[^_ÐU WVS}tnEHS9U rZE )c $;CsDƃV*tPV+uE C{EH-|@e[^_ÐUWVS}u G, tu}to_A9r_)Ɖa EUE$;AsAƃj]SV'uUfUjVS6't Wze[^_US]U MECE؉SK C;s@;r[ÐU WVS}u ~,1ɍW9t"~ t9~у9szuu)12Z)PRBP&@ YA)1؍e[^_Ðrmfree: map '%s' loses space (%ld) UWVS}uE_]S 9uTE ;(C u 9S)PCPCPX%@E 9usM 9}(zu C)RPS%sU }tE9~];s {;;]tCC9uU Sh;t sE ZU;E :Pwh8E)RURP$@ E Pwh8e[^_?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaaddU WVS1ۃ=\v"tk]tv"""\u"f<0t""09~Af<0u"E$$C\v"M<u؃<u ڃ$Z\v"t" "[^_--- more --- UVS1"tH;"u+hY"h;"qtQue[^ÐUU"࣠";"} A@" %dUWSuhhAkA߰ы"D ;"s=߰эAPAPS%"߰ "I "e[_ÐU塠";"}ƀA P"У"%d0%o0x%xUUBv#" t'u"RhT RhQRhX%s*FOUND***UNKNOWN*UVS]\v"`v"phfv"wO$$8H$HFPhQV-hGh7h'e[^Unknown devno (max is %d) %3d at root%c disable ??? %s UWVSu"9~Phl\v"EVhVh}E pv"f;u:h](EPhFPwE| f;uҋUB f|f~ f hhEx pf\u"t=\u"\u"4u"hF7 f<uăhe[^_ÐUWVSM11 9-uGA90uPAhs2hh!h hL hhߋ8e[^_ÐUVS15"\v"P$F;t t"e[^%s US1ۉ"4u"ChK;" t"]Unknown routine /%c/ UWVSEfEUU1ۉ]";"Etv"Ex0Uf9\u"} u,EPiU 9u` E}et }dt3}st(S/S#PpEPhd6}u-Ff\u"K}uE$C;"$"e[^_Unknown attribute UWVSfEfEfE]CfE< t< t< t uC< t< t< t1;"O4u"эQE9uRVEPouEfEfEE;"~f}uh G;u jsjuVSsujsVEPhe[^_ÐUWVSEfEu]Ect "=\v"6E`v"EMzэA;E M QrEPnftLfuUfv"ft6ft0f\v"UMf9TD ftfu|kdt6ctMetft2@MQCEP$3UR #EPPhd{E$E$EM\v"ct "e[^_Value missing for attribute USEEUB< t< t< t uB< t< t< t:uhF:]SR?uEPSE Ph]%s ? Not same device type UWVS}E E1UEPhKj(hAH]A AC< t< t< t;EPS{uXE"9~ RhlpW`v"pURvlt}au h?EUK=l"l"[tXRh_f hyW1e[^_UKC> User Kernel Config Continuing... U?ECfEhEEPj(h&AP ~ރh&AtʃhYUÐUÐUÐUNÐU-ÐU1UVSu] F;HstBu uBPssRQVe[^ÐU0VSUME]E؍E؉XEE]EEU} :ދAqURuQЉ…t9utt t#u1ҋE +]Ѝe[^ÐUVSu] F;HstBu uBPssRQVe[^ÐUlWVS]};}4wrw6 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA=@ xAࣀ@ujjS7ƃƋ=@ס#At`}uEQu1uEEEEEESVuMEE1ҋE9E}'FEE~|} EQB;U|ۋ]UBrURuURЉEt9]tt t#uEE +]+A `A@ xAࣀ@ = ~jW8.AAuAA8z@ӡ#AtEe[^_ÐUVSu] F;HstBu uBPssRQVe[^ÐU$UB,MQhhh@oǃ@ӡ#AtyE`,u#u1URM 1EPtNjU9UtjMQ&e[^_UWVSE@EjjhjH$ǃWQjjhjH#ƃV8UUREPEPÃEf@Ef@ E@L"Ex$EUEPEPURbÃu5Ef@Ef@ E@L"Ep$EUBw<~<13uE0UR V W ؍e[^_pipespace: out of kvmUS]s 5d"=(Cuh貭C 4?]ÐUS]CCC @CC@C<CD @ Aࣀ@PATAC0S4PATAC S$PATAC(S, @ѡ#AtjCPC8]pipelkpiperdU WVSEX$1}CDUzCs )9v֋UB9v%!C@jhhStluyC@uـKA1EPVCCPWǃC@€S@tC@S#pPCC;C rC)3u둉i{@C@t$C@So}E@  C@jhhSkuC@uـKA1;uCCC@€S@tC@SMoC@t$C@S5oK@jh"hSkǃuKExNu: @ Aࣀ@PATAC S$ @ѡ#AtCDPSDuC@ t$#ݐE=Tuhud C@jhhSljuŋC@uـKA1u0CCC@€S@tC@S*nC@t$C@SnS )‰=v7C@@t$C@CPKC@t{8t js8hHe[^_pipewrU WVS1UB$XuK~@|EKt<{@|6S )‰=w&CPQuK@@,~@| t{@}FPQGN@@1e[^ÐU WVS}u j`VfFG F@1҉F0V4N@1ڃSQRP$>F8V/CPPQOKX5@֡#At 1e[^_UVSu] j`SfCF jjSj V@Ѝe[^ÐUS]1S$t RjC$]@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@UVSUu @ tAࣀ@VlFp u FpjPSfq@ӡ#At>1e[^ÐUS]9"u "jSfCxC|Cp1]ÐUWVS]} Gl Pj&F3E t W1ut !AGD AG$@U􋇐E%tJuFUjW;Etjjwx7aUu'htEutTU5tAwVh7E utVh7V1ہu E(tUu t Wfp| E tU+Gp@t 俉GpEUB9uEzt?Et-tWj^Wj WS&Oq@5UB9uYztSEt 4jWWS&G(؃ 9Gt W%}UB9uzuUB 9uJz tD}|jWKWSB&jUB9uExtR6UB 9u=z t7}|jWWS%jjwx5 EtiUB 9uIz tCGpu#GpGmjW"1UB 9uz ␋UB 9u z  u}Et  u U@t EtoUtzGptOGp(t4!t'tY)t'^tK`D|<~4{,}$\uGpEt Cw UB9u2zt,WGP:8P!UB9zEt@W9u2E u+thWGP7P uAWS#EtWj #GtPGP2fLJgqUB9zE%EWS& wV37à t݃ t؃WSV7à i tc t^%d-$@E쐐WSV6à & t t}t%d-$@;EtVS2UB9u!ztEtW!UB9uEzt?Et7}jjwx2UWm$tG(G=~?E t#9GHNWj;jW(wVS1UuW?"WS! t*U9tB9tB9u5Et-t%fLJG(PV5W! %BffufGp t߉GpWj/WS!U9u9:t4Et-)vƅ~WjMNGqtUuUB 8B  gqWe[^_ U WVSu} u3&AGdGHPV00y )t EO@ tAࣀ@GHPVh71E)5&Awd@ӡ#Atf}4 *u uBt>&AGdu GHPj 2/t fLJ ut FwF$H99999999999999999999999999999999'!^()\t Fv9t &AGdGHPj\-uA@t uf&AGduGHPV-tmd-$?wG$::::::::~Jt1 Bfe[^_/dev/consoleU|WVSu ]tw;{t wzt ^t rtgttqwttgett_t,t,rxCzj jjRQ,jh"hh(AEP("ǃ0MA|9B u"C,t;Qxtu u tt,@ot wL^t w t t Zat nt st@Lwf@"t@awt@ht@CbtHwJ~f6wrtl}ftt tt0gtwetvvtt,t,{@ tAࣀ@}?t EHpMap@ҡ#Al{b}W<UJ@ tA@ËMIq}uPEP( U:"t;Et@p((u EE@EE:]EPǃShuiSC0hu lǃSju sut LM ":};=")"EP<Džj,UREP!MAhM}WMA|9B uC,u2PC0}GxtPEi@ tA@ËUbq$MAH}4@E tAࣀ@]wPUR7ǃt"@ӡ#At,ujMQ}GUt5WRЉǃt%M @ѡ#A0&}Gpu(f}Ufz|$߀GpWMA}A$A(y(uG|txtjp(EPt,MQ }%9tjt WVL](SEEP'+Eu}߉}߃UMBt J  }g U% M A jPȃP3}=@ס#AE0URlU;5"r MAh9@ tAࣀ@ӃAh}WQ"ЃURMQ"Љǃ thGà ËA5@֡#AthSjhCPjhC(PjhCHP؍e[^ÐUVSuFPeF(PYFHPM+A `A@ xAࣀ@ = ~j>V-AAuAA0r@ӡ#At e[^UUÐU WVS}u q5 0AApA@PAAAzAmЯAf0 0AIABpA@5PA.AAAаA@ xAࣀ@ujj>VGG@ӡ#At跼Gu RVP蒽}Nȅ}F@=q=6 0AApA@PA=A=A{A=mЯAf=1= 0A=KADpA=@5PA.=A=AA=аA@ xAࣀ@u"jj>ȅ}F@PtGG@ӡ#AtGWw+A `A@ xAࣀ@ = ~j>VT6AAuAA0GGB@ӡ#At觺GEF}F@PRx GG GGGw1e[^_U WVS}_+A `A5@ xAࣀ@ = ~j>SP6AAuAAGGB5@֡#At裹_+A `A5@ xAࣀ@ = ~j>S5AAuAAGGB5@֡#AtGGe[^_ÐU WVS]E=@ tAࣀ@;tTsESt!+KyA)sMFC;CuCC uC C=@ס#At[E[^_ÐUWVSu}E E@E tAࣀ@FF V)9r^)9~SEPR%)])F؉F;FuFF~>>uF FE@ЉE#AEt訷E )EEe[^_ÐUWVS}E@E tAࣀ@7} uGW )‰U{)lj}qGE_)ËU tAN~UUCE uH؅}CG )r'E;_uN~UCE uE;_uE@ЉE#AEt踶E[^_U WVSMu =@ tAࣀ@9uD~;~7A Y)9rQ)9~))A;AuAA~9Ƀ9uA A=@ס#At[^_putc: required clalloc U WVS] =@ tAࣀ@;Ct.uS{uDhgGejhS t =@ס#At莵CC CC UCK )stEEt ȅ}A)Ѻ0ȅ}A)Ѻ 0C PS ;CuCC =@ס#At1e[^_ÐU WVSM ]u$ȅ}A)ҋM ȅ}A)ƍ Ѕ}BE);}u)HЋUM ;‰ʋM ؋UM G9}U@;E|[^_b_to_q: required clalloc UWVS} uEE1 @M tAࣀ@;F~u$hi0cjhV u{FF FeF ^)ËV9v)9~SPEP聙VtSFN )PRV])F ؉F ;FuFF ~F9|E@ЉE#AEte[^_UWVSu] 9^u+A `A@ xAࣀ@ = ~F4"VA-AAuAA0r@ӡ#At蝣e[^_ÐU WVS]U@ xAࣀ@Cf EA@ҡ#AtGCt|{$tSC$Ѓh5@ xAࣀ@$AS )‰ @ Ɉ <uC &AC &A|A5@֡#AtŢ;+A `A5@ xAࣀ@ = ~C4"S-AAuAAZ5@֡#At1e[^_ÐU WVS}5@ xAࣀ@pAu$EPG4"hà ËpA5@֡#At象tYGfC@ xAࣀ@GfEA@ҡ#AtpCCCfCGPEPcÃuW1MGt)GCGCGCG%NOfCC Cg;} _w `+E $CE C ؍e[^_m_copym: off %d < 0m_copym: len %d < 0m_copym: null mbufm_copym: %d not M_COPYALLUWVS} E}Wh(}_K}}EPh<}EKuUBtE )NjM M~ }uhP} KUB 9sҍMME5@ xAࣀ@pAu(EPUB4"h赿à ËpA5@֡#At腟t]MAfC@ xAࣀ@AfEA@ҡ#AtACCCfCUBPMQ0ÃE&}tIUBCRSMACA%NOfCK K}ʚ;u+U SECEUB );EvEC MAtOy{y,u$AQ )‰ @MQA,Ѓ{ u KPsExWY}ʚ;tS )U1M M]}~$}}ʚ;tEPhc}HEu4Au=4A1e[^_m_copym2: len %d < 0m_copym2: off %d < 0m_copym2: null mbufm_copym2: %d != M_COPYALLUWVS}E EE}}EPhC8H}}EPhX!H}uGtE)E?}~u hmGG 9Es܍EEE&5@ xAࣀ@pAu$EPG4"h蜼à ËpA5@֡#AtmtYGfC@ xAࣀ@GfEA@ҡ#At,CCCfCGPEPÃE}}tDGCWSGCG%NOfCC C}ʚ;u +U SECEG +E;EvEC G`5@ xAࣀ@=&AuEPjY&AS t!+$A @ |AC &A5@֡#AtC t#CKC(C$C,C0Ctns sGEEP}ʚ;tC )EE?]}~"}ʚ;tEPhEEu4Au4A1e[^_m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufU WVSuE }}PhD}WhƒD)Ћ6~^uhكDV 9sAuhDV )‰9vӃSURFP)]16e[^_ÐUVS]u ;tT;uJCuC CN ȍ9r3,QC CPvF C Vƃ ue[^ÐUVSuM ˉ|9~#P 9w)@ )ʉP H1Ʌuى@to))XhًP 8t P 8uX 9r)ˉX Ft=)N8)y1҉@t P+P t9P rP @ u[^ÐU WVS}Gu6E G9s&t U 9W rNjF )E } `@ xAࣀ@pAu"jG4"h萷ƃ ƋpA@ӡ#AtatYGfF@ xAࣀ@GfEA@ҡ#At FVVfFGPjƃF Gt)GFGFGFG%NOfFV VgF Fu)EtdA;E sE U9v‹_ 9vӃSF FPw|)] ^ G )؉G )]t_WOǃ} } >V/W\!A1e[^_ÐU WVS}} `wE PWqGt6GM 9s$t9O r GNjC )E } 5@ xAࣀ@pAu#jG4"hià ËpA5@֡#At9tYGfC@ xAࣀ@GfEA@ҡ#AtCSSfCGPjÃ@5@ xAࣀ@=&Aujj&AS t!+$A @ |AC &A5@֡#AtQC t#CKC(C$C,C0CC Gt,GCGCGCG%NO fCgtLw ;u vu VC CPwy)u s G )G twWǃ} } ;SW\!A1e[^_ÐUVS]U u|,K 9v )ʋu u Å}1[^UWVSEU }_})‹?t}G 9wtrG )ЉEuOtiBut BB);E} E}>EB UBU)PJEPEPRWEu1'5@ xAࣀ@pAu UR5"h=à ËpA5@֡#At tQfC@ xA@fAࣀ@Ћ#AtӑCCCfCjURÃu}(EPUS EPU)W }tڃ;t:uE:u؍e[^_ÐUWVS}E E}G 9Ev)EUUaB 9Ew}OMA +EEGM5@ xAࣀ@pAu%URG4"h襰à ËpA5@֡#AtutYGfC@ xAࣀ@GfEA@ҡ#At4CK KfCGPEPÃtbGCWSGC+U SwU WMAS}`v6C`EPURQ}Sw1`}u M5@ xAࣀ@pAu(EPUB4"hEà ËpA5@֡#Att]MAfC@ xAࣀ@AfEA@ҡ#AtюCCCfCUBPMQÃl+E$CE@taK{ u Ex,u$AUJ ) @EP@,ЋUB(MJKEPsEUBP+tMK UEP M؍e[^_ÐUWVSEEUUUUU UtUDEE 5@ xAࣀ@pAuj5"h|à ËpA5@֡#AtMtQfC@ xA@fAࣀ@Ћ#AtCC CfCjjÃu1XuA1FECU SC `&}5@ xAࣀ@pAuj5"hyà ËpA5@֡#AtItQfC@ xA@fAࣀ@Ћ#AtCCCfCjjÃC lM+M;M vM σ`5@ xAࣀ@=&Aujj&AS t!+$A @ |AC &A5@֡#AtLC t#CKC(C$C,C0Ct9vlj{ 0{ )S 9s}u5A>9wsK ׃}tWsUREWsURp}E])} U9UuEE} Ee[^_US]taCt j`C jlCPFCt2{$u,$AS )‰ @<us(s u]m_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufU WVS]E u}Vh4}Ph ~4)Ћ~_uh c4S 9sBuh;C4S )‰9v׃WCPEPU҃u )11e[^_unixU WVSEܞ"U}tURURP8URPǃtu +;Et )5@ xAࣀ@ࡐAujjhgà ËA5@֡#At9hS#EfUBxufCUB@B@{ jEPjjSGЉƃ u E 1KSe[^_ÐUVSU@ @B ju jjR@Љƃ @ӡ#Atce[^ÐU WVSu @ @UB jjjjR@Љǃ t@ӡ#AtIExuH|;5"~5"ࡠ"9}ƋUfr @ӡ#At蹆1e[^_ÐUVSu~F~tjVF%f=t/Ft(F`r"Ph"hF"Pǃt҃~tF jjjjV@Ѓ uFth:/ fFVE@ЉE#AEtze[^_UEP jjjj PBsoaccept: !NOFDREFUVSU@ @1Bu h /fJuB ju jjR@Љƃ @ӡ#Atʃe[^ÐU WVS}Gt -q5@ @Gt$G @ uWÃt 8G ju jjW@ЉÃ 5@֡#At8؍e[^_ÐUVSU@ @B ju jjR@Љƃ @ӡ#At߂e[^ÐUVSU@ @Bu9%t%B jjjjR@Љƃ @ӡ#Atme[^U S0 tUBt MytjjjjR}GЃ UBXt}|Ѓ8Pv MfAXE5@ @u}_LمtN}]G8}W9L};GHrE@9;W<0{&UB }f$t'G$EU fG$ }W t& f{tCtuuMA @ t E9 }u }{ u}}E#d UBXfJXt$fBXЃXPhE8PE5@֡#At2x}KA {}E@ EUt"} tjs jSkM C })G8G@G@Ct+C(G@} tE UBLZL[@ xAࣀ@Cf EA@ҡ#AtgwCt|{$tSC$Ѓh5@ xAࣀ@$AK ) @ Ɉ <uC &AC &A|A5@֡#AtvUBL+ A `A5@ xAࣀ@ = ~C4"S/AAuAAZ5@֡#AtIvMYLEt"}tjs jS}C U)B8B@B@Ct+C(B@}t@MQz tCxuSB ЉE}UBLZLZ@ xAࣀ@Cf EA@ҡ#At{uCt|{$tSC$Ѓh5@ xAࣀ@$AK ) @ Ɉ <uC &AC &A|A5@֡#AttUBL+ A `A5@ xAࣀ@ = ~C4"S/AAuAAZ5@֡#At]tMYL}tE}?}tHf{u }t3EuUSKM܃uMCtMtMEE}gExMA4t +E9vNjC +E9vǃ}ub}u\E𣀳@ЉE#AEtsURWECPEԃ@ @U}t)Mq )EPS +E9CtMMtECEM)Q8A@A@Ct+C(A@}t!E]UZLM\@ xAࣀ@Cf EA@ҡ#AtrCt}{$tSC$Ѓi5@ xAࣀ@$AS )‰ @ MɈ }uC &AC &A|A5@֡#AtrUBL+ A `A5@ xAࣀ@ = ~C4"S.AAuAAZ5@֡#AtuqMYLt@EC8Ut}(}tjWjSM{){ E)x8UB4t%Mu)B4uJ@}9EEwE8P] EtKUBXfJXt$fBXЃXP}=@ס#Atp1EXLtSUE@t0u0Myt#}G @ u}uf$u G VtWExt#}uf{u }u=}2t'UB tMMuNE8PEu5u MUJL}G tExtjURjjPGЃ }؋M;yu`t\EuUUB uLBXfJXt$fBXЃXPo}=@ס#AoGoe}tEԉE}tUM }GX€fWXt$fGXXPM @ѡ#AtnEe[^_ÐU WVSu~ ] Ct /t V*u1jjjjVGЍe[^_ÐUt~ tt tm@t` }|tAt9o`{ C@fG{ C8t f wf!G{ CtL~tVPG8uG\PE7W`9vЉGlW<9vЉGHyt{ wEC `r"@E=dr"E=~ E!]Efȁt t fG~fGZ E*}u&W tztEPVE PWjB1ۃ t S Ee[^_ÐU WVS}U ]t.G xMQSRWj@j j F n+fV@ ;td&t`tBF VG% VGBVG!؉VVG$fG$VG`rVG<fVGlZVGHNuW~WZF ^Й=`r" Fdr"PV*M11e[^_ÐUS]s0s,js(覱PS6`]UUB$ fBUVSu^F% fFt_jVDtMjVSC8PSh tjSЃC"P=GF"P,F8PV tjVЃF\PVe[^ÐUS]C$ 8fCC"PC\PSC8PStjSЋ]US]C$ 0fCC"PkC\PSZC8PSMtjSЋ]ÐU WVS}} EWGG @9 5@ xAࣀ@ࡐAujjhцà ËA5@֡#AtfhSgfG$fCGfCG fCG C G"fC"G(C(wG8PWtjWЃG"PE f C؍e[^_ÐUEM A}u&f@APxt-Pxuf@APxu ÐUVSEu Xt$хtQQ9uuBAfK1$BAfKBBB[^UEHP\RPUS]K C8PStjSЋ]ÐUMQ fQ A"Ph"@tPQPÐUS], fC jh"@tRC PuC ùK 1]ÐUVSu] CPN[C €fS t$fC SFtv0v,jv(ve[^ÐUVS]u s\VbtHuC8PLt){HuCH{luClC`9ClvCl1Vg7e[^ÐUVSuM t" %ܺ 9v1"N9v‰V 9NvN[^ÐUS]SC C]ÐUS]M tFCt4xt@xu@tQS t␐PQS]US]M tgStzt RzuA C耉CAtA(CtJKtAt $fAJQRSh]ÐU WVSuM tw^_DžtPft fu 㐐uA F耉FAtA(FA tQt fQHQPVe[^_sbappendaddrU WVSE }tMAuhʼ ]Su6tV >u}O)G_ )É9~9} ?l=@ xAࣀ@pAuj5"h苀à ËpA=@ס#At]`tQfC@ xA@fAࣀ@Ћ#At#`CCCfCjjÃu1U C PsREtM}}Eޅt&F UB耉BFtF(B6u݋Mqt~t v~u^}_e[^_sbappendcontrolU WVSu}u h0 _ ?t Z :uыU t Z uV)‰UFV )‰;E~E9~1WE t!B F耉FBtB(FuNtyt Iyuy~e[^_semi-panic: sbcompress U WVS}u ]EF EN u1}tu څtFf9BuVƃ뷐t\CuNC Cȍ9s<Ff9Cu2QC CPvCF C F Vøƃ ^t3wF G耉GFtF(Gc3%}tt Ef Ch e[^_sbflushsbflush 2US]C th3S-{u;u{t h]sbdropUWVS} EXEu)NjM)AACt+C(A@ xAࣀ@Cf EA@ҡ#Atg\Ct}{$tSC$Ѓi5@ xAࣀ@$AS )‰ @ MɈ }uC &AC &A|A5@֡#At[E+A `A5@ xAࣀ@ = ~C4"S}-AAuAAZ5@֡#AtM[]u"}uh/]SUӐC 9Y)C {M)9qU)BBCt+C(B@ xAࣀ@Cf EA@ҡ#AtZCt~{$tSC$Ѓj5@ xAࣀ@$AK ) @ Ɉ <uC &AC &A|A5@֡#At)ZU+A `A5@ xAࣀ@ = ~C4"S6|.AAuAAZ5@֡#AtY]tC tMYEC MUJe[^_ÐUWVS}_CGC )GGCt+C(G@ xAࣀ@Cf EA@ҡ#AtXCt{$tSC$Ѓk5@ xAࣀ@$AS )‰ @ MɈ }uC &AC &A|A5@֡#AtdXE+A `A5@ xAࣀ@ = ~C4"Sqz-AAuAAZ5@֡#AtW]e[^_Ðsbcreatecontrol: message too large %d U WVS} $X vE Ph\1 jj褯ƃu1l@ xAࣀ@=&Aujj&AV t!+$A @ |AF &A@ӡ#AtVF t#FNF(F$F,F0FuV胱18^E PC Pu< ~ E ECECe[^_UWVSEu xURURP8ÃucEf@Ef@ E@`"vvEP6ÃtuW,u3:UEB$UE؍e[^_ÐUVSUu EP6reÃu:jvvEPÃuuEp$Ãu許؍e[^ÐUSU] EP3rusEp$]acceptUWVSE xt!jEPM q;ƃEEPM 1Epƃ=@ @EX$Cu =@ס#AtZTCt'f{up=@ס#At*T#ef{uIf{$uI u8jh"hC"Pƃf{uf{$uC tfC$5f{$ts$fC$EPMQEP6ƃUE[jSAuhqEf@ Ef@E@`"EX$jj誫EPS M QtBMA 9EvEuREp9ƃujM qEP{9ƃEPF=@ס#AtRe[^_ÐUWVSU} EP7r|ÃEp$F%f=u %jwwEPÃuVzÃF%f=uu胮$~=@ @Ft%f~$ujh"hF"PڼÃtՅu ^$fF$=@ס#AtQfu u؍e[^_ÐU,WVSu E@EvvEP6fÃZvvEP6HÃ/}WEPEP4ÃEEEf@Ef@ E@`"UEB$WEPEP3ÃEf@Ef@ E@`"UEB$E}GuuaÃu8~uuuDÃujv W6Ãu1Uu4wEP' u4uEP& uSuE؍e[^_ÐU8U BEBEE܉EEEBE܋BEur EP2utÐUlWVSjEEPE p6ǃ8UB=v (!7=ws=w8 w0AApA@PA=wA=A{A=wmЯAf=w1= w0A=wKADpA=@w5PA.=wA=wAA=wаA5@ xAࣀ@ujjEPGnÃË5@֡#At N]EtPSu25ǃu%]uE pEPE 0uǃ E9+ A `A5@ xA@ = ~jSo0AAuAAZ5@֡#At9Me[^_ÐUujEPU 2uà u}jE pUR/ÃE9+ A `A=@ xA@ = ~jVbk.AAuAA0r=@ס#AtH؍e[^_ÐUusEp$f]ÐU WVSU} 1EP7rÃ5v " j jFƃl@ xAࣀ@=&Aujj觚&AV t!+$A @ |AF &A@ӡ#At\EF t#FNF(F$F,F0FuV蓡7Lu7Awvw 3,ÃtVGF VwwEp$Le[^_UWVSUu EEP6rÃ~ t"jEPv+ÃtEEPvvEp$HÃuM~ tFMt?UtHB 9vEuWr*ÃujvEP*ÃEt P؍e[^_UWVS}uVE PW?ÃuGEEFUBjE 0R/*ÃtE0WEpW؍e[^_ÐUWVSU} EP7r4ÃjEEPw[*ÃEX$jj$ƃu7bC jVjjS@ЉÃ u;F 9EvEuwvT)ÃujwEP:)ÃV؍e[^_ÐUWVSUE EEPE0rRÃEx$fGu 9jEEPEp])Ãjj,ƃu7hG jVjjW@ЉÃ uAF 9EvEuEpvY(ÃujEpEP<(ÃV ؍e[^_U WVS}lv\EPj֙Ãu 7>{ Wsu z(ƃt S@E}uC1e[^_UEU ;Ps u fz u E1&uipc 1uipc 2uipc 3uipc 4piusrreqU WVS}E wEܞ" u - t}tUz t E-u$0@Xed`<tph<LWsZV/SMQV5~ESEPW& URWWEF t@t@ MA PqwE@ H"ࡼ"BABAB A xWKV ^ftfuUh$F 5G@V )‰ChG@F G8N)C`G8FC\PSh+}tSEP Eff}t2~ t E8SURWE|~ uE9fF F"tPMQEPR{8Wt?WStjSЃEE E7}VGtE F u h2d}t$URMQC8PtEEPC8PF @ S@)‰)GhV C@B F @K8))G`V C8BC8PStjSЃEh9j5VW`EP@f?uF t S8MQ@E~uh!AFh!AF$V(MA(Q,MA Q$MAQFA1FtI@ UB PrF$F t-@t&@ UB PrF @p"MA h@}tEP}t UREe[^_unp_attachUVS]{`t{<uUftft05Ы"5̫"5ث"5ԫ"Sh~uUjjj,[ƃt9j,V;s]SiEF$S)ЍF(17e[^US]Ct@tsWC{ tSj6sk{u3@s訖 =4At 3jSs\  jS]\]UWVSE PMyupjv HVBPS Dž|EDž\XEEXPV> htI|Pll9u SU PUSU0}AEUB@$ЀfEjB0RlEP|PhPl u:hMCtYjhʚ;jE PUBMQjS/1[^_ÐU\WVSE uPEEDEJMuX 9u|t(EP<Ã}ȃpt &VF0hWkÃ_tt9Uf9t)hMA @ tICtjSwƃu =:C^xtjhʚ;jpCSEP&ÃW 'ASt-C B S CCAC AA@@9Ct'AL'ASt/C B S CCAC ACASE lSt C B C AS CtCBCCACtASP CAAC A1e[^_ÐU WVSu }=ܫ" xr"95A}'jjj@M@Ãj@S0!5A OASt C B C AS CSttPSCstF@ G%CUSB@CGC PC!PwCAC ACAGU3B@#AXAtXSe[^_ÐUAAAhAjj5xr"wXAÐUS]&AP&AЉC@uLAXA 9r$t@@u9sݡ&AP&AЉC@[ÐUVS] AAt9XDtQ}AAQt A B A AQ AQttPQAAQt Aqp AA AA Aхe[^cluster_read: DONE bpU,WVS] EEjjEPURMQ:lj;G0 t`MԋQfB4GGEPPEЃw+A `A@ xAࣀ@ = ~j V 3AAuAA0GGB@ӡ#A[_QGw+A `A@ xAࣀ@ = ~j VY3AAuAA0GGB@ӡ#AtG1%=uURjMq(UB B 7zvY5@ xAࣀ@ЯAujj h<à ËЯA5@֡#At _]؍EؾpEEEEEEEuw EPMqEЃEx+ A `A5@ xA@ = ~j S.AAuAAZ5@֡#AJ @űU)ŰMQE=v E?9RU̍PMqGEĉ+A `A5@ xAࣀ@ = ~j UR=AAu MĉA AMĉGGB5@֡#At_ GUM̋EHpMQG8/RdEP w+A `A@ xAࣀ@ = ~j V6AAuAA0GGB@ӡ#At/UrMqE@EЍe[^_ÐU,WVS]$CECEeEe u MQ$t }t tE%EE@cx@URhW}Sу:/uZB:/t)ȋM)ASptE:u+Exu}t EUzKC CSCBt1:"t+C tЅtPCPh2][$u׸]ÐUM5A5At9Bdu A9Bhu 5Au1ÐUVSuF H"VdNhf=|?u f|?|? ‰U]K=5A5At Ef|?S]uEFde[^ÐUU1ɀ:t1B:uÐUE@@@H@L@<@@@8@4@0@,@(@$@D@ @@@ @f@f@@Xvnodefree vnodefree vnode isn'tU WVS}5ܞ"5? xr"@9~ ?9|%(@=(@uG A= At =?t0jjhÃhS@ uh4Yf{4tSh4 h4JSLt CPBPCPASPCLc1Cx{pt VS/ C0C<ǃǃC|ǃǃǃCtCpSEECHu S#fC4ǃ1e[^_ÐUSM] yDtQTt AXBXQXATYDtCATt CQTPXKYX[Uju uUju uU WVS}u uQEP5|&Ajjt 1]ECpjWS#Et St]1e[^_ÐU WVS}5ܞ"Gpv1cVSjE E ?p+AEEtSStM ;J u)Cp9Gpu!f{4tVhSu ZuŅtu {p5@ xAࣀ@0AujjjGt Gt0A5@֡#At|GtU P GtMWtBGt@Gt@9O1K1S$VjSxVjShGHCHGpuS؍e[^_vgetUVS]M C0t"C0jh9jSO tCf{4u<{8~SLuCP$ASLt CPBPCP,@SPCLc1fC4t;uQStnƃtC4JfS4fu S1e[^ÐUVSUܞ"B4IfJ4fHf~SjRweJ1 (@z8~ Azpu&BLt rLpP BLAJPBLABPArLqSRfve[^ÐUVS]5ܞ"C4JfS4fHfuK1 (@{8~ A{pu#CLt KLHPCLBSPCLBCPBKLJVhSmu VSue[^ÐUWVS}5ܞ"EEXE9CDuCTE;] tttC0uft f{6tW{puQf{4tt?CpvVSr(VjS|&ACHjS E]n}u1e[^_vclean: deadlockvclean: cannot reclaimvclean: not cleanvclean: lock not drainedU WVS]{4tfC4C0th<背C0SEPhStu  tjjURjjSU t&tMQjjS\mEPSsURjStMQStt h<ttC4JfS4fuc{8~ h)<踋K1 (@{pu)(@CLt (@KLHPCLBSPCLBCPBKLJSGfx|Sh;<i+A `A5@ xAࣀ@ = ~jWG;AAuAA8B5@֡#Atǃ#ACHǃC0€S0tC0SbNe[^_ÐUEfx4t1uPTÐU5ܞ"u5vgonemissing bdevmissing aliasvgonel: not cleanU WVS]C0tC0jh>jSIu jS{DtjSCpPstE9u F2AtHtQt9ZuFBuh>3C1tb1stt8QtF 9B u Cp9ApuϋAtHtQtF 9B uCp9Aput݅u h?Ԉug1c1{t+A `A5@ xAࣀ@ = ~jW6AAuAA8CtCtB5@֡#At/CtCpC1 ttf{4um{8~h?9(@tQSLt CPBP CP,@CPSL(@CLt(@SLPP CL,@(@CP(@e[^_ÐUWVSMu }1ۉȃ?p+ABtPtBt;H u;rpu[^_ÐU WVSu}] 94EPWE PtjukC9~΍e[^_ÐU WVS]C1uC4SQ搐1{tt4QtBEG 9B uCp9Apufy4u9uA4ƋMuωe[^_VBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %d, writecount %d, holdcount %ld,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBWAIT|VALIASED flags (%s) UTSE] tPhB9s8C6PC4PCpl"hBE C0thBEP # C0thBEP" C0thBEP" C1thBEP" C1thCEP" C1thCEP" C1thCEPn" }tEPh!C<uh-C#h/CSm]ÐU WVS]E }uvo t@"R$9Juu uVWMQHPCPB,oSttY5"VWEP9Jw="t.C9BtR$t9Butj(RVWUR;-e[^_kinfo: vp changed UWVSuu0@ E +uU 2 EEU U5A5AEPhAjSWt;uCEt}E9XDt ="th]Enu͐@TE;}_jVEPHuQhFPu-u6UUu;EPS+5A6+uU 21e[^_UWVSu1^t{t7F1t.BtPtJtC 9A uFp9Bpuytݿ[^_ÐUWVSEEP\uFUB=t ] MC0{4΃fC4EH=1^MAd4jj1VÃVSmEp\WpX葽ƃU;B\~ B\MAdt<}Q\UPMQEp`FƃUM;Ad~AdwE EuGXARt#92uz tr$E QB ЃUu7ESPMQW@ Ѓt9t &UC0{4փfC41j1Se[^_ÐUS]E Pss @Ѓj1Si1]ÐU WVS1EEt'ShHSC(ЃjS#E G~e[^_U WVSu} ]CtWf=CtSWVwuN=1e[^_ÐU WVS}u E1G=tvinvalbuf: dirty bufsvinvalbufvinvalbuf: flush failedUWVS}E Ee@ lAࣀ@ރdtO1jGdP2<du`t_@ӡ#AtuujuW]Ã@ lAࣀ@փd`t hN0y5@֡#At5@ lAࣀ@O\ȅtE tyP}@t xP|u0W`ЅtE tzP}@xP|ÅtCEE t {PC0tKC0 C0EPhNE PSg8ÃV5@֡#At@C0 C0C0}.}t(5@֡#At SdC0 C0S股]8E uut hOw5@֡#At1e[^_vflushbuf: not dirtyvflushbufvflushbuf: dirtyU WVS}5@ lAࣀ@_`txSC0ufC0|hlQ"wC0 C05@֡#At9{\t} uS느S;wӅu} u15@֡#At[TO1jhQjGdP6du5@֡#Ats`tWhQe[^_bgetvp: not freeUSM] {\t hRvA1 tNy8uHfy4uAQLt APBP AP,@QPALAL$AAP$AAL$AA8K\Apw At@ CDCDA\Ct A\SP Y\\K ]brelvp: NULLUS]K\uhSVuS!Cett C B S CC!Cefy0}"y`ua1Qht AlBlQlAhC\A8PQ8A1 tNuIfy4uBQLt APBP AP$AQPALAL,@AP,@L ,@]reassignbuf: NULLU WVS]M uhiTxS!Cett C B S CC!CeC0|6q\fy0y`a1QhtAlBlQlAhfq`fy0|ZApt t;""+Atxt="VUUU) "RQCt SP s e[^_ÐUVSu""t,FPCPp u 8S$[$u֋F;"~"F$2x(t V@(1e[^ÐU WVS}"" s$[$tGPCP u ={t /C$1ҋ"tC9~‹[$u"1e[^_USUJ1 (@z8~ Azpu#BLt ZLXPBLAJPBLABPALQ[U?"jjh?1ɋ?9}A9|ÐUVS]M 5@ lAࣀ@f{0}Sht ClBlSlCh"9~ "ș=? ?Cht KhHl?ClK15@֡#At([^sched_sync: fsync failedsyncerU WVS}ܞ"5APAE @ lAࣀ@ࡤ"?4@";?| " @ѡ#AthaWhSOWjG0STWjSY9u.{`u{pthWKp5"SquAt jЃ"~ H"PA;E jhWj(h(A/US@ Aࣀ@5Atxl(Au P7@ӡ#At"""9|1B""]ÐUS]EP5"ASjt CEf@6E@p ??ࣔ?t;"~M????u"??ࡌ?ࣔ?5?uEC1]ÐU WVS}GpD u[5"PwhAjV u5F<Ã@$FtyWC<t$C t SJ)c>߉5A,5Au C5ACBS5AtϋCt@tPxC H{t hbdWhAhURC> t S(jS1e[^_ÐU WVS}55A5AtnWhAjVt^HF<u/Ã@$Fpt URB0j@W'AW}umwtt;EPjjVuFURV@ ЉÃURV tu'EPjWGUrEx1 W؍e[^_ÐUTSUE ZEEDEEUREPusHEȉC1]ÐU\WVS]} s2PC0uaEEDEE]SEPAu0F t!PvEf@4EȉFEȉF 1e[^_ÐU WVSu} VԷÃuEv~pt WG0j@VV?Ãt VWjVXF؍e[^_ÐUWVSu E@4Dž(SEPjXP`]?Ã0tHURXqAP`/XPh\R3MQh`a4XH @URj`=hE1=XQmh\P `t P؍8[^_ÐUWVS}E |2PG0ÃjuV|0蝐ÃuzV蛾u FaQEPEPQB ЉÃuAWuVu0Ãu uj`|pV胏؍h[^_ÐUWVSu} 2PF0jÃhPt /UL׾A󥋅TPMA@$!fUTBE1B%=`t0 = t9=t)=u*E&EEjMA0Ql4tFj|Vl=ÃtVl8l&LP|PhPl1\|Pl8l;PuPRg PPtPQ@؍8[^_ÐUWVS]E TDž|EDž\X]XP/htS|Pl7l;hu P Phe}AETPC@$!fUjC0Sl2EP|PhPl-08[^_ÐU\WVS}E EEE@EE}uVÃUȉUzpuEEEUBE}VԨÃ}tAEPu6Ẽ;Eu PR P觿u<7jG0Wu1jG0WEP1EPURu3ÃEP؍e[^_ÐUWVSu =@ xAࣀ@ЯAujj h à ËЯA=@ס#AtjhS6BǃDž|EDž\FXEEXPxǃhtV|Pl5l;hu P P;h;_}AUB@$ЀfEjB0Rl/SEP|PhPl3ǃ0+ A `A5@ xA@ = ~j S/AAuAAZ5@֡#AtI8[^_UPVSuE EEEEuEPÃ}uEuLEPu3Ẽ;EuPY P諼Eȅt P8GjF0Vu.juVu7à tVu3uL؍e[^ÐUPVSuE EE EEuEP]C0tAEPu2Ẽ9u Ss PǻS辻?S3mjF0Vu- jF0VS-EPuu/e[^ÐUlWVSM} AEA;Ps u f{ u C$@pu Gt te{t#quCS GW x^GCG C XQUREPs$+uSuEUGW x)GW EUu |GW CS CS MQ1e[^_U\WVS] UB8Ct WUWU@GUB@ GEEDEEUEPƃu_EȉECtFtˀt@}UR"ƃuEPWSUR>*ƃEP蕹UWEGe[^_ÐUWVSuE TDž|EDDž\XuXPÃufV}Wh$Ãh t82PF0PtEj`TrWfÍ8[^_ÐUWVSuE TDž|EDž\XuXPSÃufV}Wh$Ãh; t82PF0tEj`TrW螂Í8[^_ÐUPVSEu EEDEUEEP衠Ãuuvu'0Ãu获؍e[^ÐU|WVS}EEEU E}ăEP8Ãu~pt XM AEQEPEEEEEE}UG0EPVP-ÃVζUEu N)щ؍x[^_ÐUWVSE TDž|E@Dž\XUUXPOÃhPjUB0RQM(MQhPPa$PBD @<t TytME2PUB0Kt4MQA0EPPP&ÃuLEw:}A󥋕TBEMQA0EPPP&ÃPR[؍8[^_ÐU|WVSE EEPU2Mq.ÃE@$EjUB0RMQ'EPhUR'#MAD @<t ExtJE2PUB0t3MQA0EPEPq%ÃuHEw 6}AUBEMQA0EPEPq%ÃURjMQ+؍x[^_ÐUWVSE T@t Dž|E@Dž\TXMMXP袜ÃhPjUB0RPQ%EPhPR!PAD @<t@}A󥋅TPfUMQA0EPPPJ$ÃPR؍8[^_ÐU|WVSE E@t EPU2MqÃE@$EjUB0RMQ$EPhUR MAD @<t9}AEPfUMQA0EPEPd#ÃURjMQ)؍x[^_UWVSE TDž|E@Dž\XUUXP诚ÃhPjUB0RQ#MQhPPPBD @<t TyuytXE2PUB0u =h"t/MQA0EPPP!ÃuVE€f9u}A󥋍TAEAEfUEP@0EPPR!ÃPQ袰؍8[^_ÐUWVSE TDž|EDž\XUUXP3ÃhPjUB0RQ1"MQhPPEPBD @<t TyuytXE2PUB0)u =h"t/MQA0EPPPx ÃuVE€f9u}A󥋍TAEAEfUEP@0EPPRj ÃPQ&؍8[^_ÐU|WVSE EEPU2MqÃE@$EjUB0RMQ EPhURMAD @<t ExuxtUE2PUB0u =h"t,MQA0EPEP.ÃuPE€f9u}AMAEAEfUEP@0EPUR&ÃMQjEP%؍x[^_ÐUWVSE DU@׾APu$EPhEUEUM9jEPRxÃ}uE}uEDžlDžp@DžLDHMtHPÃXjUB0RVMQhVFD @<tNEEU)ЍEEEU)ЍEEP@0@RVÃV^؍([^_ÐUWVSE EUU׾APu"EPEUEUM7jEPR5wÃ}uE}uEEPE0Ur ÃEp$jMA0QVEPhVFD @<t LEEU)ЍEEEU)ЍEURB0MQVSÃEPjV"؍h[^_ÐUWVSE TDž|E@Dž\XUUXP蟓ÃhPjUB0RQMQhPP Pzpu ~PQÃucEP@0hPRÃu@}A󥋍TAQ EUEP@0EPPRÃPQΩ؍8[^_ÐU|WVSE EEPU2Mq ÃE@u @$EjUB0RMQrEPhUR Mypu REPÃu;}AMAQ EUEPEpEPURÃMQjEP ؍x[^_ÐU WVS}U EP2wÃuOEp$WhVWjEpVà uAt VЉÃWjV ؍e[^_UWVS] EEEEEEEPǃUȉl,zpu,EEDžtCpMMpP蝐ǃt4EPuUu.lPu]t.lzpu{pt{pu 9lu9luuvjMA0QV!Ũ9tjMA0QRtSjXjUB0RS EPuuEPuu~ǃ oEPuU9uS) V{t SkEPuulQߦxΦu+A `A@ xAࣀ@ = ~j VS5AAuAA0EEB@ӡ#At觉Et P'u+A `A@ xAࣀ@ = ~j V謫6AAuAA0EEB@ӡ#Att1X[^_ÐUWVSE TDž|EDž\XUUXPsÃhtL|Pll9uS P7SΤ}AETPMA@$!fUjA0QlEP|PhPlà uh解؍8[^_ÐU\WVS}E EE EE}EPLÃuȃ~pt WU9u FF0tu5jG0WR'jG0WVEPuug9EPuẼ9u Vj P迢V趢؍e[^_ULWVS] EP3EpẼE@u x@$EȋEȃxpt \CEԋSEԉPEEEEMMUQhuKM܋AQ EUEăjjEPquVuE̋M܋EUAQ ,EPjuxE̅E9Cu7="t.EPu܍EPEP"Ѓ0 E̅uuE9CuHMA0t?AD@< t6@Ef@4U܋EȉB$E@@ Qjs EPkM̋UE[)Ӊȍe[^_ÐUSE] MPB$fZ$1[ÐUWVS}E Dž|E@Dž\X}XPeÃulhWG0EPV>ÃuBOE9Bt2P1蟸Ãuf~4F1tjV"V覠؍8[^_ÐUEU ;Ps u fz u E1ÐUVSUE u]f@A$fy u.xpt(FVEUuEPvvQSWTfe[^_ÐUWVS}u G;Xs tAu >A$fy u.xpt(FVEUuEPvvQSWfe[^_ÐUWVS}u G;Xs tAu >A$fy u.xpt(FVEUuEPvvQSWTie[^_ÐUWVS}u G;Xs tAu >A$fy u.xpt(FVEUuEPvvQSWie[^_U|WVSE@,E@EU tE %=u M uF$F( uF(LEPςÃUzum}AEEfEjuVEPr EPE$PEPUrà 5e MIME$PuvF;Fu Pי P+E@PUM t e JuF$E u F(D UB(MQ趁ÃuvuUBpu -Su AM t#uVEPhURà M tPu~pu EPÃURMQhuVÃE txURjMQjuVEPUR MQhuV}AEEEPUREPMQà u4uVEPU RMQkÃuu tEf@61UR@؍x[^_ÐUUBD@<t>Bpw6$B0tRYHu 1UVSuE tfN6uuPVÃV2؍e[^ÐUt -EP5&AWj s@ xAࣀ@Aujj@j|ƃ ƋA@ӡ#At\E@pEH0EO=WrEPjYPu DUZ)PRL]jZS;]jSh[Bn1e[^_U1ÐUVSuEf{4~ CPSVyu.SaxS|j@~dž1e[^ÐUVSEu ܞ"fC4RhS1e[^ÐUVSu] "AC"AC@+8"ASC Cxr"C+@CFD9tBjC PFdP(AjZCTPPAjZPP@jF PCDP 1e[^versionusermemtimerrootdevrootdevposixphysmempagesizeosrevosreleaseostypencpumsgbufmodelmachineloadavghzdomainnamehostnamecopyrightbyteorderboottime...%ld %ld %d %d %d %d %ld %u UWVSUuMB /tf tCtgYtg5 [C_y]S,suh0B0hBAt;a0t "C 9C}C9E  U )'9E U S9|)‰)+E 9vȉD AA9}S6h@%AA9| S6h'A> DT!Ah5!A5 A5 Ah 6d!8"A@)‰Ph6AװI;M ~U +M 1e[^_ÐUSEU ]@ /t/_uR| uKSh'AR=ƃ'AA1/| uKSh@R=ƃ@ A1]ÐUWVSEp PUXNMFEw ~u*U:.u"MfC4EPhS7Eh"1;="}8UBV9uRMQEp/ t8EG;="|˃URhS>D:My GuWY;tEPUB P3yu EMEPju[quEP5&AsDj lƃtURhS-@ xAࣀ@Aujjju‹EEEA@ӡ#AtUEMUA BpEPhuEU1e[^_ÐU1ÐUUB@0uHmr BPjjPÐUWVSExpj`VUVjFF GD@dFFFF SdF$S)ЍF(F$V(F,V0F<F@FDFHFLG0t,fFmfFFFFdC CfFfF-h"F1ǍhPWSu؉~~1[^_ÐUE@x@u1-ÐUSEPXzpu-GShPRQftSP蛩u1ÐU WVSEPxzpu -{G G t \G9vƃWVS)u3u(߰эAPSP[^_UWVSEx@xpt v } Džwj P SfDž h"{ Gu%S:tmPC P28utPFC@PPs7Wj P uFv ;5"oww [^_ÐUSEXpjSCp1]ÐU WVSEx+A `A5@ xAࣀ@ = ~js9AAuAAB5@֡#AtiPLJ1e[^_ÐUEPJwm$(((@ 18@ 1(@ 1@ 1tag VT_KERNFS, kernfs vnode Uh/-1ÐU1ÐUS]s s(sak]ÐUS]s ss1k]kernfs: bad opUhU|WVS] Sul}UB8U)ƋUB9vƋPuC,u SYe} MWSru9EPVURu!Uzu{1t WSUBB x[^_UE@, 4U WVSu }u1~VuÃuiV, u F NHuu V[dF Wv gv ,؍e[^_ÐUEÐUVSu] SNA9BuC-t2P1葁u{4u=A| 1e[^ULWVS] Su@}UB8U)ƋUB9vƋPuC,u SQc} MWSu9EPVURޢu!Uzu{1t WSfUBB e[^_ÐUE@, 4UE@ÐUWVS}GEWUBtP Up UBDt @<CUBp$Txx;5P" GA~<$"~cEPL.ƒt6EPjRnt Efx4~PsÃUR-$"uEH0URjEPiwh wUR"ЉÃEPhUR};5"rk=A~' t!Gt)<"u =EPrÃu%)wh`wUR"1e[^_spec_read typeUU҉)Ћ"`hKkvRvURЍe[^_tag VT_NON, dev %d, %d UEPBt@ PBt@ Ph1ÐUEPJwm$8hhxxHXxh@ 18@ 1(@ 1@ 1ÐUEPppp pjjBtP7ÐU spec_badop calledUh%UWVSlr"+lr"U2)ƃ95|A5|A=))Ӊ))ى%v) f &A;AAྲ)Fntm9s"t"19rK)A wK9sA@f,AvD f,A}t &AUf}t7Eȍ4UZk_k)ىȋU ,AE f[^_Ðdos2unixtime(): month value out of range (%ld) UWVSu] uE@Pكځ) Hځ )QE< TA9f5TA1ۉ% 19st m nB9rE"tE"%ujh1ҍH9sEPB9r\)|A=|Alr"+lr"UQEM))ʉ)ЍUBe[^_UWVSUM :u  " $"A}t $"B: t*$"BA}t $"GC: uփ)ڀ: t6.AG1ۀ: t*$"BA}t $"GC: u[^_UWVS}E E HKyE @ <.u8}u U ..u"}uM .A.}]K AK< t<.tw11O]x&A t.u u t1Ky݅tqt) )U)‰U1ۺ;]}J3$"M  83t }tEE <u E JCB;]} ~ENqAN< t<.tF19sI$"M  8t }tEE <u E JBG9s ~EuU _M 9u}t}wIEuM9v/}t6IE)EE0U9vu݃}t1VU z u KE < tA)ƍV)9~)U ~ U AC9r[^_UWVSuM }T1IJ< t<.tEH@)щBKyEG G EG fGWIxIFBBKyWIx1FBBKyWIxFBBKyu@ B@1[^_ÐUWVS}u E@t H MMA 9EtE}Ѓ?H@)ޅ ߋMANyAu݀9Ґ$"GA8$"uAuKyȋMNyAu9ty뒐$"GA8$"uAjKyċMNyAM9t-C$"GA8$")AKyE[^_U WVS}uE Eʀ?B<@tw @E PG 9t$?H@TM эWBAuU B(؈B/tkBuhKyэWBAuU B(؈BT/t7;Mw2Bu/KyЍWBAt /tCU (BA BuKyʉ[^_ÐUU BIyÐUE UH~ J t.t=H ON)‰1UhAjj;xr"xr"Pߍ@1ÐU WVS} 5ܞ"EU#A@t:;{uE;CuE;Cu{(t߃VhsPu1e[^_ÐUWVSMAEy}q#A@Ѕt2};xu;pu};xux(t uօtJY 1[^_ÐUEHttJ@denodedeget(): pcbmap returned %d UWVS} ܞ"EUztuuzuxREPURV;wtVtVEEG EGEfGE t t tu qEPUR ÃtEPhURE ڃtڃuk|VjYEPu |Z)PER3 VjYEPu|)SUPj|ELPEP1X[^_RRaArrAaUUFH EPU@(E=v t hEEPjhjURà UB0 B0EXHs jj;h8ǃhWE VUfS fFf_fVfF fWFGfVfF fW fVfF  fW"V F  ‰W4fV fF fO(fVfFfW*F G$ E@xu(fZ}PfEf?;f"uFVFFF‰W,VFFF‰W0FV ЉG,G"G0GfȺ1A9G0f urf"4u~VF uoGtLJLJVFFF‰W4~}F UBxtu }]CW;UBG0E؅Й}U؋E;EfGW0G,G,GfGG"fG"G4G4و]__8tuDV!F"F#F$‰W<GG4É_DV%F& ‰Wx/OO4ىO<W _T1É_@ىODGDO0)]1ƉwHNOLGG4GpE@xt#wG} t#}u;G*fHfv-tuAwGtLJLJGtLJLJtu G@GhGhOWh1OlGuW\WӉW`BGXuOT9t OuExURjhwxEPà VEXHjhSC jh!PB uljh&PB uOjh&PB u2‰W| GxuEjj4AAuAA0GGB@ӡ#Atlpr hH[^_ÐU WVS]Ctu!SSC Ex+A `A5@ xAࣀ@ = ~j EpA9AAuAA8C @C @B5@֡#Atsv e[^_ÐU1ÐUVSE@fx4P {PAPAEuR)ЍFCt_ CtjChPCjPVK` C,u/CtjjCfPV軯CtCaPCbPCdPV蠯c1e[^ÐUSUBH,m@`uÒf#Yr BPq qPc]ÐU,WVSEE@{,UrGfEPAPAEMMR)ЍACth CtjChPCjPQϮK` C,u8CtjjCfPEP襮CtCaPCbPCdPUR臮cCFC`t8KlMG\WT)‰ЉeD}EEE{lu?E6SG\OT)GDUU{u UWF,@U9BtG2PRuf{} f`N`N {@t>F,@U9BtG2PRu"CBt f`N` N jV!e[^_ÐU迆Ep:}tURjMQ;o]S1 UЋN M]9tb}th>OEpURjun }tMQj]SnE~PEj EEP]ăTSj SUREMA EA$URjQMQaǃ tZMQ\IT)]CDURjs`Ps٩ǃ t$u豭EPjul OE܋PH MAlBAlBu:ǃt ]SEPju_l}tuURMĀa]S ue[^_ÐUWVSEhP d@`p,xlu@p`9A r jxPjjjV ǃ h|\PuEPAPAppR)ЍCEtb EtjEPEPSgM Eu2EtjjEPS@EtEPEPEPS%e㋕xF\NT)VDjjv`Rv襭Ãv`sHj@sHhX"SHxBxBEBfEBEވBfE߈BE݈B EBfEBEBfEBEBfEB`Al ~tu;F%b t*!G9vЉǃPPPSQˣ Pjs輞 /B@)Ɖ9vZH9FPPˬFP^SEC EfCE+ECP]Su ]ӋE 8N F$tqF ;AsfV t_F$FFNVFF V#~8tFA  CA A  ‰ 1[^_ÐUVSU] u)Ët8B 9}J)؃~ffQ &u 1@ ‰[^ÐU\WVS]11u =$mrrrrsrTp(t8t8t8t8tts8t8t8t8t8t8t8tss\p8t8t8t8t8t|sPs8t8tdp8t8t8tsr8t8tp8t8t8ts@s8t8tp8t8t8tss8t8t8t8t8t8tsHs8t8t 5"""M MϰэQUMMA9}ǃwG x}(jj S~ƃSVb^(F(CURF0PMQrECUB0fCB8C""4MN F@|A Ft VP FMAUr V^M }tMEDue[^_ÐUU="upAtApAB B BpABtpAJH BtApABpARnUU="upAtApAB B BBtABtABtARÐUUB@;E ujjrr0r j0=1U WVSu=@ xAࣀ@~(t VJ@AtVh xP@(ЃC~݃V mVt FB FtAVFXQt ABAFAQxu"QE@u>@ xAࣀ@V@ӡ#AtUBt;F4u5@ xAࣀ@V@ӡ#At۝V4RMA%q fV4QE PV2PC0DžUBF@2PC0ǃt\MQE PVg2PC0xǃuNt URM QV+UB u -VMQU Rj MQ@Љlje[^_ÐUC<̀fC4ǃC| C8C:C9S jj SEPEXXXse[^_looutput: no header mbuflooutput: mbuf allocation failed %s: can't handle af%d UWVS} ]Guh8PATAMAtQxQ(tAA4t;MAff|}E|EEPRUWt:C4t1WS4u3A1 ?5@ xAࣀ@pAuj5"hà ËpA5@֡#AttQfC@ xA@fAࣀ@Ћ#At臌CK KfCjjlÃ5@ xAࣀ@=&Aujj/&AS t!+$A @ |AC &A5@֡#AtC t#CKC(C$C,C0CuS1ۃu"hЏ!;W7bGCGCswjWmGC W+shjWLhW^C ;g ߋE@PGUB`MAt)PЃPhy:WT/ @@ xAࣀ@B 9B|0BW@ӡ#A菊GBu = @xzB Ajj #A@E@HGUB\@ӡ#At"1h[^_ÐUE t@T̀ÐUS]U M1 i uK4t:A1 i r$2i w1i rtyt/[USEU M]@ @@HX[Ðifmedia_add: can't malloc entryUS]jj j4ƒuh4E BEB EBC tPS Z]ÐU WVS} E~#1Ðt7t7 t7EPsKue[^_Ðifmedia_set: no match for 0x%x/0x%x ifmedia_setUVS]u 3VSu#PVh\7h33Ce[^ÐUWVSu ]E1}z=5i t=6i(cv3VSeu Jt;su;Cu 11SUKMCsEPCЉDžUSMKEStBFFFFVEPCE[ F tLjjPEt6;~ }CUMBUt;V |tEutuF tPv$EP6mǃu߃~ tjURߨMN e[^_ÐUWVSE} 1]ӋH t#Q!9u΋ u[^_UVSEu H t:t A9u tACQjQBمuɍe[^USMU fz|B Z "؄tR吐Rݐ[ÐUWVS}uU fz|"Z J "3t " ;tR␐Rڐ[^_ÐUWVS]M 4 )‰UCAE~!)Ѕu CA8tE9r9s At1+}t}}+u9sCtuE[^_UVSU u1ۅtp jRu1)X Vutt9Xt @t9Xue[^ÐUWVSE uX HE9vЉ…u ?149vЉ‹}U9s2"uBCA9r[^_ÐUWVSE ]S E8f{|C K u" 0Ȅt[[ݐCEt8u֋K }9s8u FA9rC tOCtHD0J+uu҉Uރ}u61C tC9E!URSMQuߋ[uɉ󐐐[;t~Gt9EfGsC uu9vEwSEP0ƃt7G9Ftvt%9FutURVMQ+u;]p1e[^_ÐUWVS}u UZfsC Ss fBz ZC B [^_ÐU WVSE EX E0URP)}Y u9sGC8u9ruEG2C+Ut Ju]ދC M"C t[[C9w݃uR}WQF 8"F uNNKqA u0"A uYQYЍe[^_Ðrn_addmask: mask impossibly already in treeUWVSEEE84A9~ǃ}uE;}~t}~EHP?@P?@Pf+EPE?PEEPf?K9v{t);};5("|=("5A,m("9})RP?=("5A05?ƃtWv 5?: t1} jj4A0P讟Ɖuu 14A0PVv^0]WS5?e VEP55AS0ƃ}t!hj*jEP舡d ]C9s;t9t-€t EuU"8uA9t1+]Ef^tN e[^_UVSM] 8v "8u49sCA8w9r1[^Mask for route not entered UVSuDAt ËCDAjjj:Ãuhj)16jSFfF CF tsFCE C؍e[^ÐNon-unique normal route, mask not enteredU,WVSu]E E1UfEfEt6r jPǃu 1{OfMfMfUG ESEPVURƉu}utQF;Et}tAt3Mf;N|4PEPu vUR"u uvu;uu,ދMNA F y~9Ouww]ދUBFrMK fCC }tEFGfFG $F URU}JfMz;}uzf}GEEttt-Uf9W|$?ujWËMt]u7t1}ËEf9}SU[tMf9 |EU}EMf;A~C VfU}OMEf;A;}u}^CtCxF th,j&\{;}tWURu,WMQ[uCE[t f;E|~U2VMe[^_Ðrn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us rn_delete: Orphaned Mask%s %p at %p UWVSuEEPV6EEX UUMM9t)P؉G P3P0 uy} t9SjE PEtZUB M9Atuvut?9Fu}GօG t"9zuz ~Fh,j$19Bth,j$B HJ ȅ}WҋEXC9r][C9M9Mu}t29u BJRt9uBDABDAuhlj$E@ @UB 3MYuF9uEX9Ku}{GEC?UUt&;EtRtM9Jut uFBhj#]C <EEމS9Zu EBMJuFpFp{}E9uSUS9Zu MJur}Wf|Mt JRugƒ}t@E;u(JB pr }DABDAʋ}}t!utEPRhhˣjo"UU9t-؉։CXCXRE9BuZZUb b#Ee[^_ÐU WVSE}fx| @fx}ЋP9Bu@ t@@fx| @fx}[@ uWPU ҃u؅u@ t1e[^_ÐU WVSu} >t jjjtÃjtSvC,PW5?QC\EBRrB F f~}?MA C XCأCC 4C(X1e[^_Ðrn_init: radix functions require max_keylen be set rn_initrn_init 2UXAt4AH(9~ʋ@u4A4Auhj: jj@P踔‰?u h4A@PRzu4A??У?9s B9rjh5A-uh9UVSu^u 7V50"5,"Vcu:sF @fCE fCAt AXACA1e[^ÐUS]C@PtCBSjS֕]ÐUUB@t RUAÐUWVSEEU UEEUUE5AUf9FFft f;BFtPEPv3 F tPURv  }ttjhʚ;jEPÃtYjSUR}8WCu S1WEPOUtjRЃFE6 }t_jUREP]8SuURV@SEP Ut$jREPe[^_U1raw_usrreqU WVS]E }UsE u -tz tE-[$ج Lಬಬಬಬh࠭hಬ<ಬ{|E FWSE/V~ VS S t~ tE8GF ~ t}C SUR@ЉEEF VSJSe`1qFu ELSwvF u E9,Swv U_ hk}t EPEe[^_UVSuXAt&{ ts$PC Ѓ[uݍe[^ÐU h@AÐUS]t x@t@4uu jCP+]UE tuEu1UthA} t*t$j$]Szm}EPjSEP? 5@֡#AtVlE؍e[^_rtfreertfree 2rtfree: %p not freed (neg refs) US]uhC8JfS8fHf~C4uxC th 'Af}!Shر/IPO"S CDt P tJP js 迍jS贍]ifafreeUUuh2B u j RvHB ÐU} }u>~t8jj耻Eu 7EXvSW߃jWÃtHfK89sDt?}t EPŽ3}3A)POEPF EEPv6WE Pǃ }tEP`} u3u/]t(SjVjC8f@fC8S} ]fK8CD9tiPVhxmCDxtjSj@ЃCDP JP sDF C@F @EtUPDǃtCW U̅t9Eu}t,MQuEP(ǃOPvEtPǃuEtPv v4ǃtHG E̅t>FD9t7txtuVj@ЃFDP tJP ~DG ỦV@FPPC$Ps %FDtxtuVj@ЃEtFHC #FPFPS #S$ ЉFP E-t}t MЉKK@}tEP1UB@u2=@A#tjSwMQiEȋptSPjURjSw tfFEt f@fZ"h8"hH"hX"MQtfFEЍe[^_ÐUSUM ]tACtAC tAC@tAC}A C tACtACtA C [ÐU WVS]}j wVU1;] s*t;t H \A;] r֍e[^_ÐU WVS}uE^ 9] ~x)] ]>u/FPj&M 9lvlP 6^ 9] 0>u'FPj4tTlvlP 6~=F +E 9v‰ӃSE FPEP9])] E ]uUBt M9J}Je[^_rt_msg1UWVS} |)} ~ }tEET EL}~hjj(ÃH}`5@ xAࣀ@=&Aujj詧&AS t!+$A @ |AC &A5@֡#At^RC t#CKC(C$C,C0CuS11ۃEC CC{PWREE Mt3M :t H pRVEPSguE}~M9KufGEGS1e[^_ÐUWVSuEE } |} ~}t TLutEE Mt7M :t H XtSVR7ރE}~u~}tt}unUB B _ztY9z}2BtjPrjjWpMAtyUBtEMAtE@UPf8e[^_UVS] s=@At[SutFAU@PUPP t fFfZ" fZ"h8"hH"hX"Qze[^ÐU,WVSu=@Atgj$]SPSj>à tECV0fP V4Px8@fZ"h8"hH"hX"Se[^_U EEjEPUREP@|Ѝe[^_revarpUVSu="t 5""r3V`r"`r"Ph jh?茤 #t"="t)ju h?juh?q13e[^UuEPu 4U#A?ÐUS]?tC9uS zu<:R ujj8jX‹CB?B ?S ]ÐUS]?t 9t.R ujj8joX‰B?B ?Ћ]ÐUE??J R t9uB j8RjZUWVSE@EUB} A@EAGMAu9A s#PEP袟Eu A}URUEMA)y URQ{-t AMEP)UPx M$ t#AE@4UzPk@@MytAEP@A11t؋xtXVt3؋M9K u9SHt@ CDPEPCDP) E@4tCTPEPCTP CdPEPCdP EPWhi EP-h[^_US] Ct)E@4tjjS jjSc]ÐU,WVS] UBE5@ xAࣀ@ECDECHECLECPECDBCHBCLB CPUtMSh i RЉǃt8ECDECHECLECP5@֡#A.#$5@֡#At#}tESURCDU€u C, E%=u C,C,C4uC,C4Ch!C,E#C,C(U#S4S0CdPCUB@C$B4tC4 C0CXC, C(C8 ut{Ut 1GCMEPjSLǃuKUfz4}EREPe[^_ÐUWVS]u t}t F4upA1~9toQ t`u(xuLz4tA4t;ZXt1;Z0t,;Z8t' xu$A4t;ZXt;Z8t ;Z0t;Z(u RuI9u1[^_ÐU,WVS} 5@ @ࡐA@à ËA=@ס#Atu 7DhSsEC8"""=@ pAࣀ@Cs 9vu^X S ffC4fC6f #F Vt#N FXS ffC4fC6f#V FS ffC4fC6f#V VS=@ס#AtEXǃ1e[^_ÐU,WVSU E@8EMIMM5ܞ"fEEHρ=A]f{6u7{0u1u]C @ tuE)Zz t NCfES%=t+t1fCjsl u1 tf}Ef=2PF0PUt9jEPCPjh@MQ| t@8U9u2MQEPCPjh@EPA t@8@u 0BCUB0f}fEEMA`t"= "g tT2PF0Ot X.}E!]E"="f9}uf]o)1))ƋUfN }tAMf f9wf9sEfUffUMA @PUPuMQEPE0Pjh@EP v}uf]n)1)ƋUfN}}MBff@f9rf9vMfEffEUB @PMP6uEPEPE0Pjh@UR m]MfY6Q1e[^_ÐU WVSuE 1Xx t {t /f{At#CuBHuB @4tBXC~0u:EPF8@PF@PSǃ u}uE1E{F6PF0uGPCPsv  t 0J~0u(f~6ujV1u1 GF0CF CfF4V1e[^_ÐUS]C fC4SlC8@t S]ÐUVS]C8@P>t PDtC@t P轫`E @ pAࣀ@tCBSS;Su C BC B S ;Su C CB @ѡ#At@+A `A5@ xAࣀ@ = ~jS[9/AAuAAZ5@֡#Ate[^ÐUVSuE @ XjSCF6fCF0Ce[^ÐUVSuE @ XjSACF4fCF Ce[^ÐU WVS}E UfUUfUxu]ptV9tP9s u#{8tEf9C4uUf9S6u E9C0t [ϐ؋[} tURPE Ѓ믐e[^_U WVSuE xuCxt<9t69{ u {8u [鐐؋[}tۃURPEЃɐe[^_U,WVS}w@tbG@j$]SD}F0EFEjv4Sj F4tjv4vv0v j@ V˨e[^_ÐUS]C@tP覨C@]ÐUWVSE UEMfMMfM0U9tlMf9H6uY1ҋH tt9uHMf9H4u> tH0t t 9u"tBtMt 9} Eׅt@;EuE[^_ÐU WVS}u 1ۋt+G9FuEt$B8fHfB8Uu4tx@u(FFGFVjF Pm t B@@4uZDuPwfGWoÃu Wkofwu!AuMR[G%=u9}t3Ut*A[6 . #vS9|w 4AS%=tGC ffC "CA@8"CPh"Qt(Ak="uFu="uFt PBHPGR+]؃j EPWd}}EU9v&MˆMjuVED8PE$twtWkEU9VMĉ "Eph"LƒtyjVBHPE;EU9jh"Vah"lJ t*EE܃jED8PEP*EU)U׃}~ }t=l"tjMQ]1EgE؃)YEKEp>P]S<6 SUr "PhT+jƙEM؊$ff)AAffAjjSEPUR0Ae[^_ÐUVSulAhAt!;st3P8f~8JfP8hACshhAhAt@DP菁1e[^ÐUSEX+w"Sh9?PC"E 4?]ÐUWVSEEEEfEjEPÃuSC8f~HfC8C4%=ulC0xt aZ=pAtMw t=S0R8Pu(jS0BDPBDP5 tvuċu1e[^_ÐUVS="tj jDƃu1q"BF N8?4?8?;?jFPh8?V[]%=&]SuDEMUEBBQ]gEUp@PhA@@@@t}t%hEtP }t} u j(E PEUfBpe[^_UWVSUB @8E} @ xAࣀ@AujjEjǃ NjA@ӡ#Atyu AMQ%1EE0t!FM Q u6t F@)Ѕ~}UBXXM +YE;,A0A4AURJ%+ A `A@ xA@ = ~jEW.AAuAA8z@ӡ#AISMQg/E)U ZDAMHALAEv l$tFBV+A `A@ xAࣀ@ = ~jEV0AAuAA0r@ӡ#AtYut;NEE PY)څ~$A9#ӉYf)QRv J.UW MU fBW}uMtxE8GUtxM9OEfxSU2FVMAD9B4F@UBDF@ $MtFAVE@ tv "v E8Pc+A `A@ xAࣀ@ = ~jEVR.AAuAA0r@ӡ#AtutVMAD9BE8PEPaU􃺄tjRЉe[^_U WVS} @ pAࣀ@4Aƅt4=4At-'PfG tN EHEUBDMA $E AEAA]SuV4V]ԃ8SPMS}WKt^jWEEPUREPMQ]SuVE؀N }W eEبUBff MQJ]KCDuFft) ft`f t"f tHO}fGBEf@6UfB R&MfA x]SQG ufF x}Gt ujhAEPEPj }u UBMQ? ]uV }OWEبu}UButMA%=tb]tjuvjRQ}W(EبtEjjEUBPMQ]SuV }tb}W[)T}t,UB @8@tujhAREPj MQ }t ]S)e[^_ÐU WVS}] fEtW ttwE@ jEPCP0EffEUB O@S9vЈG uzEjURCPȒUffjE PCP衒U ffE@ tOUA)u}~!tsE@ tEPWNe[^_tcp_pulloutofbandUVS]EE p|C 9w)Ƌuh rVKE@@<PyHxC )HPQAQ译K e[^ÐUVS]u ANSlftEf)fClffClf}Snf)fSnffCnfClfCnfCffCSpƃN9~KpClfSnfCf9}fK f=~fCfCz[^ÐUWVSu~ W@G8EG@EuB tBBG BR<W@Uu<"fFF`<"E@@Ef~lUJlBP@t4C)fVpfw fFp f=vfFpC)fVlUJpt VlfVnFlfVn fNFp9} FpfF f~fFU}tEX<1ۃuw yu <"9v؉Ã} t E 9v؉ø@9s؉É^`F%f=u~UBduUB`9s+D1Ë"9vЃPE\PEf^UB`uUB<9v'D1Ë"9vЃPE8PWE^XEPht 9s‰V\؍e[^_tcp_outputU|WVS}G @8EЋG$9GTEtGf9Gd|GGXG$W()‰UċWdÃt5E죀@ЉE#AE}~ u 9tGu,tG)wG)v GG jjWǃu 7GtGEE=v (_j S}C UffS F0C F CF6fCF4fCfSfC="tEPWrfCfufCEfCFlCFeC@jVF8@0PF@PW萖à }tEVcEF`EF0E죀@ЉE#AEt|Wg}t EPR؍e[^_udp_usrrequdp control data unexpectedly retained U WVSE MUr1 uEPQUREP^Muul$ଣ00lȤ8ܤ@,80 00000t *@@Ãh0AUR[ǃ@ӡ#Atz5"5"EPǃEPx"BlV@@ÃQV\ǃ@ӡ#AWzM~ t 8<@@ÃQVY`ǃ@ӡ#AtyUR~ u 9@@ÃV"aF0@ӡ#AtFyE`URTwEPQVUREP|V FQV>b5QVnb%1V--Gh(#}thL)(UR }t EPe[^_ÐUS@ @uD`@ӡ#At3x]ÐUVSu]MU} t lEt"tQt+t2Dh".j@h,ARQSVY(h" h"RQSV*e[^UE="u@ u@Pu PÐUWVS]E@uVjjSEE<{ w*jSÃuȴ@jj{E<uGEE PSVjjS E<&{ w"jSÃuȴ@XE<u{GPEPjSCt@4u;5pAt1V t t yu G 9ARuvuҋC+E д@Դ@C tCtE @5@ xAࣀ@UB 9B|-BSA̴@5@֡#At|uuCUBu@SLXEX@ Ajj #A@5@֡#At;ue[^_ÐU WVSuEPjjV&mE Wut u$@VEU|Fu,tF)wF)v FF jjVcƃuȴ@E7FtF~EFffGx"GfG U G GnffG}tVpE/]SjjVG GPjjVfg ESEPjpPEG VU@7CĴ@E0U u)B f8u FBHRLFش@ܴ@1e[^_ÐU} t*E8t*h"uuuuSfile system full %s: write failed, file system is full U WVS}EUZ M;K0u Ext9K`⋋ʉUs(s<Q))U}~b;{$|1uUB1 hMQWPEP| ~} MUJU1-hMqS+Ph$e[^_Ðdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevbad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimUWVS}E w Uzt=N`ЉE^(^<Q))U}U Eu+Pjv0whdhEPjEPU Rw{@à tuSDoEEUREPUREPW à tAUNd9ZTthk]+] OEPRE;F$|EtgUUF<^(Q)9PhĬjEdžzV0U^<^(Q)9|MPhjdž(PwhDheMhUREPURW à ENdPTw;EPURW E9E}U)PNTPW]+] OEPueFMA0A0SE@HEURnEU 1>u BhEpVZ'Ph$&e[^_ÐUWVSEDžt="P|MQ U$j@px HLpPT7lMIdT@TPEHPHPLTRTTЙH9PEP]SV|RrEPMXQlP|RsrEuMxhS@\EPjEp03|R< tu^@:E@Hx[hxQhPVUR;ƃEt@X\SB9|`?G)Љ`EPjUr03|Q; }E@HthWVMPEP}d @Ëhx19};`utFUZ89|E9xt&="t u>SuE9xt u>([^_Ðmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free UWVSEEPUxf}@s XE%f=@uVxKF,9r1ɉȉ1EhHEEPQURSǃ UBD@UrWUrD@ЉÃtEPWUR4UBf{xt'PsCxPh*hĴt PWPhǃǃtxu û@w ǃ13hUB pV!Ph$e[^_UWVSUZ,EEuE19]}NUJpUUJl!UUU9U}U9T| }EEG9|u[^_ÐUWVS] Ep N\Et}UDFt 9}MA1+}t}UDuEx1ljؙ @~,UEEE9}4Fp]Vl#UM9LE9}|E}9}4Fp]Vl#U}9|}]EE9E~1^8<FX9E)EN`UM9t=r}v8}UEv8E;N@t0NDV|)Ѝȉ֙D lj[^_ÐU WVS] ]Ex URuSPU҃ur$9|)ËEPjSURU҃uIG,9|؋Mș,Ӿ;w,}&EPjSURU҃uCG,9u1F9|1e[^_U@XxEfE~U   {8}]E!EE}~U t @`E}$M))!jN4MQRS;%KTEE19UyJFE=U t  @`E܉х}JM؉)Es'PRUrhhN}U tM؍M @`E؉Eԉх}J)ʸUG;};~$KpUMЋCl#E| E}~U t  @`E}$M)+K8!jEPRS#K`}W~U t@`PSh$ C8)F$S8)CpUCl#EMЋK8)L jWVS&FKpUCl!EMЋeUDMK|MșljЙșыPEȉșɃ~U t@XU׍Pf~U tDTvTƃu e[^_ÐUuÐifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodeUWVSEx@Ep F,9rPWUrh>1EEPjUF#EFF NdPEp à tuz QEXH{U tU tPL #PAC1U{U t  @\}r7PMQEphDuhc7U{U t @\¸ E;C0sC0C NpUFl#EDUB %=@u&KNpUFl!EeM Ɔu1e[^_Ðstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapUWVSEtM}U B,}MB}B)E@8E…}E)ЋMTPP"E4U zU t 2 E @`PSe ^1MI8Mʅ}E)ЋUDEMPE4U zU t E @`PS u$EPSjhbh)M Y,CE9؅}CM yU t  E @`څ}S)щE@8E)!E""1 !9tDGE+E9~UZ8;]fEPShhe[^_ÐUWVSE$U ыYlىMЋPhЉE}~*E}M)M (E}M)] uFE$E<0U Bp9|lj}E] MC)ȃtECA9}Uu)MuN+}y}E]UK)tEKI9~Uuމ)ȋUL;M~MU]~)}~ EM])U$MI~ ~] S ]T [^_uid %d on %s: %s UuEPu hjPffs_balloc; blk too bigCould not unwind indirect block, error %dUWVSEEDžlPUMY ]px CP tu]C]#8URЉE;C0~h(MA} ][]uvuMu^P t1҉ƃ  ;u F]9wu;w EH0UU#8@#JL];K0EPEPs0Q}ǠWVVURPVMQà F]KPMRP]SEUJd@TMI]tu u} }]à4 E@UJPMT9wRu M;wEEPj]s0uVEPà tu MQEuu#8@ FL!u!9)EPjQEPURvà 뇐EPEPVQSURRMQDP]SuVÅeE@UJPu9w u;vuE@#pL Ur0EPMQVS]SSEPPSUR]à jjVMQ]SEuNdUPT MtEpE@@dU4Mtuu]SoREt-EPjUr0MQ]Sà t0uBjjEp0URMQE]KdpTuVE1u1u;ps)Ep06URMy0;pr؃tttl|vEPjEp0l4Rt.ċMQ' tPhHfE@HED.ȋuEtu ut U)J؍8[^_ffs_update: bad link cntUWVSEE@@D@<t ffx<} Fu$FFu UzttMAA@Ft"UB B @F,V0Ft$PATA)Ѝf~ ,fF|fF~EPjw0F1EӉG!EEGWщM1wxËO`E؋OdPv T à tu,iFz9FthzM^1wxyHx Ext@@D@<@uu u 1e[^_itrunc: newspaceU WVSE\PXpx Dž8}  XP9u9u 1 PAPAhh R)ЍCXxp@D@@P9w(u;wuePuVPP9PǃǃKj PPXRWVXQXC|ǃǃǃP@ HP$(9;(9H49w u;0v Dž0\@t Dž0dP0R\qjWVXSr PWVXR|XQ 0td d^ PHj RRXQ+WVXSH8!DuPvHKP tDž0\@t Dž0dP0R\qjWVXP$ <P )CHKPP9wu;w HX0#PH#8@#ZLXQXXxpt*+DPd@HDDR6SdP0tdd~ HC0KP tHTE+CtESt)ЉEC0 tUREp0URÃ}E@?UBxt?RhW/EP@0hWsÃURjW膳8uAE@>u!Ph5Ph`t UB0VEPW]ÃEUB<t$B<}u)EPE@PEPzJà UB$B(@BEEB,R#ÃDUzpt %Gt@ ;"|  UBxtUE@<uÀURhW褨EP@0PWÃURjWE@>txEP9tGtRtR 9P t zW:dEPjYEPuMUZ)PER uVjYEPU R UZ)PER VjYEPuE)SUPTEPURWÃjlELPEPOEPEPEDPEPBЃ UB<t$B<} tJE@>tAUr 9Et/E}t jUR1 W'9؍h[^_ffs_reload: dirty1ffs_reload: dirty2UKdPMQjǃ Ep1sx}xMqH UBzBuMQV4 EE1e[^_ÐULWVSUBt@ E}t MAEEEP@ÃUR;~M; 4At EPhURjjMQEPjURHÃ,MQjEP=AU J<M؋EPjtPURLà MQEPjEPhhdUR耥 t Ep(EEMMQEPh RPjh D[ PURà ExH\TuG0==cw OƇ$uR }u M A>tPh`"PhtLu}u \jjhL 6EhLPjjwh5UB whr EpH h UB0 B0uBEMy E؈}uƇƇO4T1ЙEЃ$~G,ƃjjVN5EEEw0EG8;E~ u+uw4MQEPVEOdPURà VMQEpHO`EM MuLE G8E܋U9Ud$~1UTEM;O,}$E܋E;G,|MU EBdt u U B @Bh(M A@I=EUPMHGtUB GdB$G8B(EEMAM܃~UBtM HWEPhPE PxU)PR}04M쉁DHG0ÉEĉ‰UȋEċUȃ49w u90v 04}uDt&URWM QEPÃt jUR%ƇjMQ 1jEP5UBt@Et P:MQEP}tPUR赞}t+jMq 4jEP4U ǂ؍e[^_ÐUWVS}9sЉ9sЉLu LJP,G0EU@04EGtÉEEE‰UEEEUEU04MyGHЉ8<GLЉ@D1[^_ÐU WVSEUB?tURPEPURPEPÃUw u14$jWÃt ƆG@t@jjEPjjwA URjtPw藜Ãw,j2jV2jW2Eǀ`=؍e[^_ÐU WVSE}u jP-Ãu1WhvWjG0vGÃWjv[؍e[^_ffs_statfsU WVS}u X \Tth[kC4FC0FC(F K8NC(CEM9}4#FUH U;r s;E}MċQHMA(D9tуE E̍PŨt%MuSEP1t9}t URpEH$U:u1e[^_ÐUEP}t;utf}}URjV*EURhV|ÃEEEE}t}uf}}EEP U܋GD@LHEȃ}u^`tؙ9w u ;vEFdEr^dEȉE!]tVEPjFdRPW豆à t8EVdU[]^lEԉE̋UB HME$'AFdEЋ EEEu}u"EFdu FX"U+UЉVXEFdUVX9E}E̋EyE%F\NEH}uURjW蜁xE@@Z}PPU2WB<}u 'AGDx@CC$UD1ҋ9w uR;vJhr)vdV9GDx@ CC$UDdžNE%ft}u VdV`}fEpURhWmyÃjFdu FX+EЉFXFh9FufG4E88GDPEPvhwDBЉÃFyt9EPt/;t'M9tQAEU}EPjW}}f}UrEPhWpxÃmFh9Fu [GDPEPvhwDBЉÃ5EUEH}URjW'E URjWGDPEPvhwDBЉÃ tEPhWVu}f}}{URjW,uÃtcuFh9Fu fG4E8IGDPEPvhwDBЉÃuA}tf}|URjW?~EUE@@tPU2W1x[^_Ð%s: bad dir ino %d at offset %d: %s bad dirUSUBXDuu rPh3苙 CDuh3]First bad Second bad U WVSE] UxD@~ ssCu:K)9%@CC$9r~h42;t19} |t@9||u1h(4诘e[^_ÐUVSuU ]FBCB@PCPr F@Dx@~ Fxf CCCe[^ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2U,WVSEP U@EMM]CDx@ uF UB$EMAXAdthE5 EPj]ShuFdRPEP}à UBdMIRP]S蚵ufFCD@LHU#BdMQUBHPVu=ÃPAPAEMR)ЍAjQQuV8~UBd]9w u;vuEPEPUBdRPMQ{à u]CDx@FF$XF)߉E܋U;BX}[MM>t f^ߋ]CDx@AA$XQ)U܃SVQtU܋E;PX|t&uCMAPȃPFP}/ u";;EshZ5ߋEfx";}}hq5Ufzf^ރMQV]Su}ÃuNuvF\to9w ub9vZ} tEPjU RyMQ]SjuF\RPEP{à } tURhM Q]o؍e[^_ÐUVSMu Et2EPEPCdRPQ z uuEE@EEPEPCXSd)‰ЙRPQy u<{Xu E UClfBt NNfNzuK|Ke[^UWVS}] wEPEPGdRPV_y u4EUFDx@~ UEBKKfKzu{Oe[^_U,WVS]EEEjEPURjjE܋URPj SUrji0uU}uOf{tHvHMA@Dx@~ CC {.uuE;Pt{ .uU 9t1'CE܃U;}`u ;uUe[^_Ðcheckpath: .. not a directory U,WVSuU }BEB;Fu$E1ۃmUBDx@~EEuf}..trE;FtteR6UBDHEPurDAЉÃ zUzpujjWjjjjjEPRj_gÃ0buh;dEt P؍e[^_U1ÐUUJEPjRAЅu UE 1ÐU-ÐUUu @PR tA0UE41 ÐU=d?ud?>1ÐUVSMu ]QEPvQBЃt 9Ufyxt F9tRF1e[^UEp pp@@ <"P6*UVSEpXp SpF <"P*u?HVDt3@p31e[^ÐUUBtB u B tI1ÐUE@fx4BuNB Bt PABtPAB,R0BtUPAHBtB Bt PABtPAB,R0Bt PAb1ÐUVS]Cs UtbPpw>$D?x?h?h?x?x?h?x?x?x?@D@<t<}tt #s PAxPL e[^ÐUVSEpXAuLA At PAAtPAA,Q0AtSPAFAtB At PAAtPAA,Q0At PAaACACAxfCAfCCC CDCSC$C(C,C0C4C8C@Cdu t PjRdGx%f=@qq hR\Ãu*tss hP\Ãt'Pjc MzuB8.t#9tA uC uGt%Pj&c GvDžRDžt GfGzOPAPAR)ЍCjSSeÃt PjYbirr h[ÃQjbF 9tts VW0Ã@uhJxRPQÃDžt G9Ft hJpxt[tRFzf=v  F@fFzNjPPR&dÃtNfNzNSQWjPSjR^Ã0tEwNfNzNjPPQcNPiB;Fu;Gt hJTwG9AuhJ9wFyt2C @t";t9t Ax%f=@uWys vQu Bu iP聬t AttPGxf PwRVà tauNNIIufNzfKzpp jjjaà R A$ AuhdJuPPRkt0thJ2us1\9tthJtt:t1("GdjjPVWWR蠪jqSPsËbtQatGptrvtgQjSuOfOzOJ؍[^_ÐU\WVSEP@I fzzv @؀@Pq SP]ǃzB @IfYx@pAfAzAt BfBzJPAPAR)ЍCjSSQh^ǃsBD<"x@~$"󥋕BAPjp hjj\ǃ ǂǂJjh藔jpHQ豬 jSS{]ǃt4^_^ǃu]SPRQSPǃ0uQ:HfHzHBfBzJq+A `A@ xAࣀ@ = ~j p9AAuAA0AAB@ӡ#AtP[^_ÐUWVSEPUPU@ EE9uUR;xtt"EPURzCt {uEp vSXu Bu tjjUrSEPǃuNURNNKKfNzfKzEpp jjjURtZǃ$EP誤UREPe[^_ÐU WVS]{s WsC@̠P3 ƃ?}SװэyMAD;x@}2WPROK*jjC p jjjjWRMQjRHƃ0EPe[^_ufs_readdir: lost in spaceU\WVSEEԋPUЋBR EUċMЋYډA%)u )ډUȋ}Љ_XEԋPBDx@~Mq jWROẼN}}u}؉}EE]܁wtw8 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA5@ xAࣀ@ujjS ǃNj5@֡#At}؋Ep jURp5NẼuK+]4;9s(QAAQfyt AEMQSWẼ+ A `A@ xA@ = ~jW/AAuAA8z@ӡ#At}}ԃEЃxuxth1[jMЋY+E)‰UEUĉEUM1AEUGAUЋB ;Eu ;]vfyuՋMЋA+EEȋEUĉAQ wtw8 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@ujjRDƃƋ@ӡ#AtUԋB8B0EUEUċMAEUEAUЋB ;Eu}9zwҋUȋEPMԋY1A}ЋG 9wu G9w3E̍e[^_ÐUVSUZCD@@9| u urVP1r jrSJe[^ÐUUJr Pr8PÐUUJr PB P8PÐUE@8Pufs_strategy: specU WVS}_K\EApwh\aagCP9CTuVjCTPjsPQ0Pƃ ts4C0C0SU{Tusj Mq8E PFfFzN[^_file system full %s: write failed, file system is full U WVSu}E^ C tzt;CtoU;SrE}uFH1s(E+C1s$hoURPVHƒ ~ NE1-h\jwS Ph|j{`e[^_Ðmode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free UWVSEEPUx@s ~/%f=@uVQEKI1v(EEF(@hDq}WPEPSà UBD@UrSUrD@ЉǃtEPSURGUBf{xt;ft1PsPCxPh|kq`hk[hCxP迱TAPTAЋPA9s PATATA10hkUB pV PhkI^e[^_UWVSUB1EE19}61ۋE,D;E|t D ;E~ T U F9|̉[^_ÐUWVS]u{ KttCp@9E uA'tM| uIyCH1w(G G@[^_U WVS] ]Ex URuSPU҃$9|)ËEPjSURU҃uX9|ՋMșӾ;},EPjSURU҃uC9u1F9|1e[^_ÐUWVSUuz ,M Me]f| t>EPj,]Pr ? tu1E@HEGE+E_$1;E t1t>+E1օ}VU )sit+E11ɍC)ȉ9}]<t7B9|19}E<t#B9|VURWƃ} E}F)M O ,]fL Ƈu܀E G$e[^_cg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in mapUWVSU]Kz ,M Meuf|0u 1EPj,uD0Pr } tu1sE@HEt,1w(Ӊ؅}Cu 0)؅}CEG()؍pEEPVh ƒuKuFEEPVh ƒu%PSU RhppVE)ЋMt,C=~PhpZhq=V؅}C)u2O,UfLƇe}@u ,fDu>~M O(D e[^_bad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockUWVSu EX +K1s$;sr/EpVh=sYhSsUBzPS%EPj,MUPEp kz tuE~E@HE+s1s$օ}VE)r&PVUrh|sXhsMTU C ,UfD ƃu|e[^_Ðifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodeUWVSEEP@Ep ;s wPRUrhtJSZ1v(EEPj,UDPUr x tu|ExH1v(:ڃr4PSMqht8EPj] SEPuà xEUEPMQW] SSEPPSURà {] MYpEAtjjESURV{E]UPT MtEpMI]EPEĉEPU RMQ蔪ÃMEȃ }Ǡ<jj] SEPƒEPMQRS]SÃ0yuEptjjUuЋMQXzE]UPTEpEM9}4#FUH U;r s;E}MċQHMA(D9tуE E̍PŨt%MuSEPst9}t URrEH$U:u1e[^_UuÐext2fs_inactive: pushing activeUWVS}wE=d"tf~4tVh؀f{xfu`FD@<uWjjjjjV53EPAPAER)ЍEEKCxPsV2Ct0PAPAEMR)ЍAjQQV3wjV/twjV蛼Ee[^_UWVSEEPBD@<CtB Ct PACtPAC,S0Ct PAcC$Cs EPjCH1v(1$,L ȋPs kǃ tuoRh}SJ1$WHRCxPUzuu(n1 ume[^_ÐUWVSE\PXËK[ HLDž<} XPPAPAhh0R)ЍAX{pucCDPQ|@@9r uLuCRPPҚPC|Kj0PPXR0PK|1ۉ(,H9u/L9u%PIj0SSXPe0PR D,9L 9LI(9H7HOD#HLHL tHLDž8\At Dž88PdP\rGPSPQ HPC|HLQRXQAfXSe 8tdjd&lPJj0QQXS.KHD#uHPJ|DHL tDž8\@t Dž88RdP\qWSPS HPP|DHLRPXReXQud)PdxHWޗSdo 8tdidjDHLD tHTƒU)‰U)‰U @jt#UREp0URVÃE@?UBxt[EpRhV(URB0hVlà tEPjVxURjVaƇf:ufG:fG:Ƈ}uEPE@PEPƗJUB$B(@BEEB,RqÃUr~ptV讈Ft@ ;"|V茈UBxtdE@<uÀURhVEP@0PV1à tV臇URjV-E@>uURPVE;ptVׇtVLJfUUz uVhEPu fSU)PRk Lt-Vj?SEPS@+EPSk jZEPURPVjY]SuRUZ)PERckt:Ƈf:u PAG0ShjUR]1h[^_ext2fs_reload: dirty1ext2fs_reload: dirty2U,WVSE@<u ^U@Ejj}WE PjURÚ th}WjjEPhhdEP tE@(UURjhRPjh蚭 P}W9ƃ u"ExHUB<PWƃt"u=WۄrUX hSWNSSK ʉ1ljKQEeE HЉ UUmE܍L81u܉ U$C(1(19EPjGGPUR8ƃ $,PEpHMuG< G; {ExU9WDuGTEURhAWuʃEPhWsujjURE PjWQ th%UEPjBH1s(1$,L ȋPEP7ƃ uEPJ1$VHhExPRLu';Wr}1e[^_ÐU,WVSUBt@ E}t MAEEEPَƃ UR~M; 4At jjEPURjMQƃ E P<UMQjtPEPƃURMQjEPhhdEP EEUURMQhjEP5ƃ EURpH ƃsjjhLEljSjjh0NjEx hEp EpHJuQ9EUZ M舋 }uf{:u fC: fC:ƃSSK ʉ1ƉKQ牻 GЉ }mU܍L21u܉Ɖ $C(1(jj Pу,1; EPjGGPUR)4ƃ $,PEpHnIu7E G; tEM UQdA @AhA@<I=EPUPH UB$B(MAtU P1j,Et P57MQhEPURMQ}tPEPURjMQ}t+jEp 萄jUR肄M ǁe[^_ÐU WVSEURPEPƃU{ u,jSuG:ufG:jSoCxpt @t@EPhsURjtPsƃs2}j,莃jW胃jSxEǀ`=e[^_ÐU WVSE}u jP ~Ãu1WhvWjG0v;ÃWjvO؍e[^_ext2fs_statfsUWVSUP fz8Sthgb (MZzLtvBdtp1ɉME9}jvSE9M~ 9~98;Mt/9t+9t'E@E4)9M~9~9~EA;M|MM @EËM AAB)؉A B A+BAABAED9t8jZȃTPEPEjZE PEPjE jUB PE DPT 1e[^_fs = %s update: rofs modUWVS} EEV Ut%PhLh EXtzU9SDuCTE{ptW@u{`tKtFURhSytt&EPWURStES&z]utP@?tEPhv6URWEPv} tEURjvEt#ƀPAUB0WVtEEe[^_inodeU,WVSEEPUE PUReUNEEP5&AURj%tÃtE@ xAࣀ@ࡐAujjHh}ǃ NjA@ӡ#At\hW]jjhcjG8PtEEGUr w EGU WGpGt$WqeÃt uxEEPjE HE1v(1$,L ȋPEp,à tuwu0lhGxP]E1$SHRAGuA0 UR5@5`!AEPAÃtuewU_UBG f@4u?TAPTAЋPA9s PATATAE@D@<uOEU1e[^_ÐU WVS]} u@ O wucP(9sSCURQS@Ѓt@Mfzxtu G9tQkvF1e[^_UEU f ABB1ÐU-ÐU WVSEX 1jjhjp0ǃhwHS@} u WD, W-e[^_ÐUWVSEX EE PEPvEE; jj EE@PEp/ƃvHE$,PL?} uVv+E V-EE; ju }t}e[^_ÐExt2 fs: unsupported inode size Ext2 fs: unsupported optionnal feature UEfx8SuPLwxv XtPxT ufxXt hH@`th} u@dt 1UEp pp@@ <"PUVSEpXp SpF <"Pu?HVDt3C uhe#xtKCtEjC @p0z-C <thSCSC4CS Ee[^amap_unadd: nothing thereUVS]U ;Sr hGC <uhGjC sF9tSDCC Ke[^ÐU WVSu} ^0CtK{$u,uF V)‰ ;Ct S{$t7{$t1tjC PjS~jFV )‰Pv,Sfe[^_ÐU WVSu} ^0CuS}PSu Ct$C{$u(uF V)‰ ;Ct S{$t5{$t/tjC PjSjFV )‰Pv,Se[^_amapplUjbhhjhjjjj(h(#AU WVSu] E ؉EPh(#A? ǃu 1JGGG$EG _GUwsw7 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@uVjbR=UGG@ӡ#At5nUwsw7 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@uVjbRTGG@ӡ#At32Uwsw7 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@uVjbRRG G @ӡ#At2 t N_.+A `A5@ xAࣀ@ = ~jbwT4AAuAAGGB5@֡#At1_+A `A5@ xAࣀ@ = ~jbwS3AAuAAGGB5@֡#AtO1Wh(#A1ۃteEPs 2؍e[^_ÐU WVS}w+A `A@ xAࣀ@ = ~jbV$S6AAuAA0GGB@ӡ#Atw0w+A `A@ xAࣀ@ = ~jbVR5AAuAA0GGB@ӡ#At/w +A `A@ xAࣀ@ = ~jbVQ5AAuAA0G G B@ӡ#AtO/_$+A `A5@ xAࣀ@ = ~jbSVQ4AAuAAG$G$B5@֡#At.Wh(#A=e[^_ÐU,WVSUM r0BZ ) R,Ӊ]؉EV9|&F$  jQSVp E9F |XF$tDt?9U}jF+E PURVNE)ȋV$u  DMN EF$Uwsw7 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@ujjbRLEE@ӡ#At,}~$+A `A@ xAࣀ@ = ~jbv$N5AAuAA8F$F$B@ӡ#At+F$Uwrw6 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@ujjbRJEE@ӡ#At*Uwqw5 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@ujjbRIEE@ӡ#At)Uwqw5 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@ujjbRHǃNj@ӡ#AtT(]]F)EVUFPMQRV]^F EFPWUR6]SFP(~ ~FPMQWSFEP(EFV$U}tyFPMQR SFEP(]^$ E;F}jF+E PURV*F}uM]UTMNN U+A `A@ xAࣀ@ = ~jbEPII7AAu M艈A AMEB@ӡ#At&+A `A@ xAࣀ@ = ~jbWH.AAuAA8z@ӡ#At&U+A `A@ xAࣀ@ = ~jbUR(H:AAu M䉈A AMEB@ӡ#Atw%}}U+A `A@ xAࣀ@ = ~jbURzG8AAu M􉈐A AMEB@ӡ#At$e[^_ÐU WVS}w0GW )‰ O,UV9}<;]}zF t!xtE PF @p0eC;]|F19}?F;W,|,;U}'F xtE PF @p0@eC;^|Íe[^_amap_wipeout: corrupt amapUVS]1;s}=CC tuhJu PF;s|CCSre[^ÐU WVS}u]U B0}tSRM A ) =v>9vVQWX9rE ;X sSPWYU B,MQjBJ )P0U B0QbHxuM a5U BJ ) M}Ph(#AMǃGGG$EG GGUwsw7 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@uMQjbRNAG G@ӡ#At!vUwsw7 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@uEPjbR@G G@ӡ#At6Uwsw7 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@uMQjbR>G  G @ӡ#At t N_.+A `A5@ xAࣀ@ = ~jbw@4AAuAAGGB5@֡#At_+A `A5@ xAࣀ@ = ~jbw@3AAuAAGGB5@֡#AtWWh(#A1ۃE x0u`KS1;u}Rh fh Ѽz@~vPVRu1aQ<t uDA ?tI y u0t ABQQh`A B <؍e[^_ÐU WVSUB@ J(AM19}ZUB$4tD1ېFtjP+ `"AC~܋Vh`AlޅuG;}|Mq$+A `A@ xAࣀ@ = ~jcV27AAuAA0MA$A$B@ӡ#A 19},UB tjP8 `"ACM;Y|֋Ep +A `A@ xAࣀ@ = ~jcV18AAuAA0MA A B@ӡ#AtLEPh(Ae[^_Ðuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots failedU WVSu E t@="thl?wGG"VU t(l?="th "%jh(AaljwGG} t E U Ume@~?G(PEPjcW9vP:eG$gh`/wsw7 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA@ xAࣀ@uEPjcR",G  G @ӡ#At  u hVw } tgFG"GWW G?G,t ?W,P0=?G0?e[^_uaoeltplaobjplU=?ui???jcjjjhjjjjPh`Am(jchhjhjjjj4h(AEÐUMQBvBQÐU WVSuVBBFuV,tF0B0V0F,1^tKC$tfC$+js0KC PVS讆[utN Ve[^_ÐUuao_getpageuao_getUWVSE UUU$@EE1E;}E<UREPnÃu~u UBu4Ex@~jVPzt UB u7jjjjEPURǀà t%fc$K* S7pt C$t;}tE$tE fC$EEGE;}EU}1E;}}U<];}tFE$N:C$t! fC$jhjjS  fC$EU<EPURlÃujjjjEPURà uhЏ말K* E<u UBu1Ex@~jVPtUB uSn9jPSPƃt#C$ t Svc$σSЃ1fc$jjs0LEGE;}1e[^_ÐU WVSu} ^jv01HF PSA tVMCt{uS1e[^_ÐUju ut jPԹU??udv_attachU WVSE}uU@ "'E PWURӃu֐?tbE;Ct[ tQU;SutECt CjhjjS% CCt Stc{@ xAࣀ@PAujjj(j%ƃ ƋPA@ӡ#At9?E;Ct[ U;Su+ A `A@ xA@ = ~jV '0AAuAA0r@ӡ#Aux1[F"FFF FFFUV?F t ?V P$5?F$?e[^_ÐUE@udv_detachUVS]C~ HCCt! CjhjjS$ ǐS t C$B$S$C Ct Sr+A `A5@ xAࣀ@ = ~jS%-AAuAAZ5@֡#Ate[^ÐUudv_fault: !PGO_LOCKED faultUWVSM EPB]$@uh螭Bt&5ܞ"jjUB PiX]@ "E+ZZE1+ U RjRPVU0A? G;}}4E$u;}uE"AH`8Kj@Ur4EBtE$PDP`PdS@+BBP8RADž\ `@1H9L00tutp;Du \`P\"AjTQEX@t XR0p0WE0r30 `$00F;Hd Dž\LYD4SU9UtCE$7C$t! fC$jh9jjSo fC$>u`WEP:GÃujjjjWUR@Zà uh9nj뵐>uSIfc$EE9E/1e[^_Ðuvm_km_init: could not reserve space for kernelUVS]u ELA@jhxAu js00nVBp0Rdt-u1Uujh2Gjh(APA192^{,ujs0NC,S;e[^_fltagain2UWVSu]VB0EzOyt0EEj@jjjEPEP+BPWAЃ k5ܞ"jjF PlEWjjjjEPEPF+XSWBЃ t#jhGjh(A3@1 "A5ܞ"jjF PV 9Ft5ܞ"jjBP1ۃ "AE@%u+tJ}t@FPN)щR,PDtt5ܞ"jjF Pw1ۅuNE@$ t PtCUB%tGjR@010R:E`$1Eu=Ex,ujp07E@,u8E EU E@ tM u-:蓿Åu=E@$ t PBE`$ϐ5ܞ"jjF PvdECEX Ex,ujp0~E@,u9U E@$ t P/BE`$ϸe[^_loanzero1loanzero2U WVS}Ey5ܞ"jjG PhJZ"A5ܞ"jjG PW 9Gt5ܞ"jjBPn1"At]jjjjjjIà `SK9fc$U S 7C,15ܞ"jjG PtσVhJY "A5ܞ"jjG PW 9Gt5ܞ"jjBPz1"Ae<ƅ^jjjVjjHà >SE8fc$S7U 0e[^_ÐUVSu] u PKe[^Ðuvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!U WVS}u pC,uSh(M>{HC,S5{,u;{u5{ u/C$tShhM{js0SNL Ne[^_U WVS}5@ xAࣀ@ࡐAu,jjtPà ËA5@֡#AteWuu SE؍e[^_thrd_sleepUVSuU M]F$F$F(F`FdFhV,N0^|FxFpdžjjhNjFP FlFttZ@ Aࣀ@LAtLA5LAdžLA@ҡ#Atje[^ÐUVS]C|u5ܞ"jjCP,EPuu S ƃC|u5ܞ"jjCPEt jP e[^ÐUEt@hÐUVS]ChPShЅs0s,S?3 +A `A5@ xAࣀ@ = ~jS-AAuAAZ5@֡#At e[^Ðmapent_alloc: out of static map entries, check MAX_KMAPENT# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplUSAA"ࣈAACQA5A5A5AA5A`Q5A4A4A4A5A4AxQ4AxA|AA4AAQA|AAAxA"|AAQA`A\Al?1ɻ@\Ap?\A<<9~jhhjhQjjjhhA(jhhjhQjjjj @ӡ#At}Ve[^_Ðvm_allocate of PT page area failedUWVS}w uhjVF|Pv0v,;EE߃h' jjh8EPEPw0thpW@ Aࣀ@WxEG W- @ӡ#AtlV e[^_ÐUS]PupC|u5ܞ"jjCP{`t(EPs0s,SEtjP3&ShAj]Ðfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)UWVSEEjhhP/UB|u5ܞ"jjЃPMA|Pq0q,Ej PEPސEEUz( $U9>WthHrUЃ uhriUG$@tjjjjWMQ谆 E@|u(d"9EttjhA}F8P@ xAࣀ@5\AtF\A@ҡ#Atu hQTF8j8SWƏC({0tjSWqCtPzt PBЃUB`R$MA$@FrF0wGW )‰PvM1EP UB|u'd"9ttjhA|C8P@ xAࣀ@\AtC\A@ҡ#At譨u hQSC8j8SW贎{0tjSLpCtPzt PBЃC(K MA`Q$A$@CZCG0t'@u (t;jjjjSEP臄 (t0SURË}0t.Gu#G tG$Pw wM1|O1 G wGW )‰PsM1EP tC$Ps sUR(;}MAdUBdA|u5ܞ"jjȃP"E߃h' jjh8EPMQ thpQEe[^_U PAgfff)9uh A*""9xAv hAUWVS14At+B1<|<~<uw wGRu1۾"ʋE)  ENy[^_ÐU7̬@9sGEPu h>jjjuSh@ 79re[^_Ðvm_page_physget: called _after_ bootstrapvm_page_physget: out of memory!U,WVS"EI̧AUUUU萐{th=ЧA;ȧA;C uЧApЧAȧA;"uhC=H"M9U$E쐐ȧAȧA $$E];"|sԧA̧A2;:9ЧAH ]2X2 :;ȧA+"u h 0x%lx vm_page_physload: tried to add RAM after vm_mem_initUWVS="Auh9}vEPh9"u&h@E>U RMQjh1>#E9E} =ܧAu1Ґ$E9E} ܧAt"9UEuhU9E19}!M; ȧAr$E9U} M;ȧAsUҍȧAE";U~1H܉MÐȧA<u E܃J;UދUEM HEUBEB }t BMAAUEP"}u]e[^_Ðvm_page_physrehash: WARNING: could not grow page hash table UWVS1ɡ"~1҉ƋЧAԧA)É$NuE9M}e9M|Uwrw6 w0AApA@PAwAAzAwmЯAfw0 w0AwIABpA@w5PA.wAwAAwаA5@ xAࣀ@ujj[RثÃË5@֡#At謋uh';1;u}ؐDF;u|졀@E xAࣀ@=DAHAEDA]HAKLA19uSt C B C DS CCK K#LADADC # LADADC C#LADA\uF;u|E@ЉE#AEt蓊Ԭ@+A `A@ xAࣀ@ = ~j[W袬.AAuAA8z@ӡ#Ate[^_Ðrehash: physical memory config [segs=%d of %d]: 0x%lx->0x%lx [0x%lx->0x%lx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d UVSj5"h 81;5"}-ȧAs ss3hQ8 $F;5"|كhnh8h[85HAhH8e[^Ðuvm_pagealloc_strat: bad strat %dU WVS} uE("A;D"A|;H"A}L"A90"A}h8A>1ҋEu}tMAw("A;@"A;<"Axh4"AH"A9} TDžl\l8[^_ÐU WVS"A("AP;H"A}"A臇 "1"A"At=T"Ath Au6h(Au""Au=T"Ath A"A)؉á0"A=L"A)1 ("AH"A9}\"A;X"Au9`"A}u)΋AEC$C*u{u K, fC*C$~eC*t+C x t"jC p !C @ c$NC* t.jC Ps9\tjPk!c$N~ js06S#AO ]t4,e[^_UPhPh+Dh4>u/PhSRDǃ1ɉEEDMEEEEPJ`ǃ|Uȉ1O?t7.xpt /Bt@ ?vjj\jzƃjPbà t!RVSj\V|vjPÃt ljj\hWzÃjj\jGzƃhS'[C4zpu Bt@ xpuUB0PVSjj\y jPbBthRzSURǃtVjPpzpuj\t{j\Si{ f@4􋕬RtEPjjh&Arx[^_swap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap U|WVSE 40;=4AtURB0jWÃGpuvEP@0EPWWÃJEU ƃGDPEPGDDPwDBЉÃGD@LU @ǂD?u*҉)Ћ"tVЉƃu E p  EpuJUE1} sjj\j vÃ5""h:Sjjjj\EHPjSU 0 t7jVjPwthE/E $5\"A5`"A;=4Ah@PDDB B  ;]~ hljSVU 0th)U $\"A`"AShE)Ph  EPU RUE @$ U BEX"AURu@1;=4AtEP@0jWO؍x[^_ÐUu h@EhujhdgxÐUu h@EjujhdBxswstrategy: vnode type 0x%xU WVSu^T S^u!F4F0F0VH1 +( 4@ptPhH%=@ lAࣀ@VT4FDC1 tM{8uGf{4u@SLt CPBP CP,@SPCLCL$ACP$ACL$AC8F0uV"Cd~\t V^\=@ס#AteSV RVQAe[^_Ðsw_reg_strategy: swap to sparse fileU,WVS@ lAࣀ@j58@&E@ӡ#AtRE@@@ U MHBFE@U lAࣀ@C@S<)‰)G@N C4tF{\t S莄S5#A$~tG0G0FG4Fu1~ u+@u!FuV58@I$W+ EPU@ҡ#AtoNe[^_ÐU WVS=T"A:5@^~9CE$; EPjjjjR0p 0p00N89u <F <<<9tR888F<9Nu^ F8^U$\"A(ED8F믐89 v E8~} t 1e[^_Ðwarning: resource shortage: %d slots of swap lost U WVS]} SjW+(S0 tWh )$)=\"Ae[^_UEPuuu BUd"A `"AEuPju EPt t`"AUWVS}E EPjEPuEte@ lAࣀ@Ӊ}e1}ujua4bj\ ij\Sh5ܞ"ju9e[^_sbrk: grow failed, return = %d sbrk: shrink failed, return = %d UWVSMU q E:E+EYK$9u ;C  U%E)Å~>hjjSEPVk} t Ph|6 B};ۃSWVtPhN  )1e[^_ÐU WVSM E@ E;rSU )9sI) )UBP4@0 9u9v1E[^_ÐUÐuvm_coredump: user process with submap?U,WVSE@ EEUBRЋMA(1][(]E$E9CUBth\MAI][ ]߿vEߋE;r! );M]ff% HffUME)ȉEURjMQj jWVCPEP] SjE0uZMAƃ]SjEPj jWVuuU RjE0u uMA][]E9Ee[^_uvm_deallocate with null mapUMU Eu ht %PRQ#t1uvnsyncU@@jjhjh`A*Zuvn_attachU|WVS]}  CjhjjSsW Cu݃{puCtP )Ѓ<"t1CtR{ufC4C`CV@C$t @S$P(@C(@K)C{puGKtQ )5ܞ"juVhhdq "Љ u8EV@("'ܞ"P@0EPSu EUt C t SC1w u =vC"CKK CCKCCC t)@C$t @S$P(@C(@KfC4 t SY؍x[^_UE@ÐUS]CPSc0CtjjjS%S\a CjjjS{tK?CtS$tC(B(S(C$CC t S譮S)\]uvn_termuvm_vnp_terminate: io sync wanted bit setUS]Ct$CKHjjjSB{t%KjhljjCPqT {u܋K{t $C9thtS$tC(B(S(C$C t S裭]Ðuvn_releasepg: kill flag set on referenced object!U WVSu} ^jv0MtVyCtO{t h{u6tS$tC(B(S(C$C t SѬC1e[^_Ðuvn_flush: strange, got an out of range flush (fixed) uvn_flush: obj=%p, offset=0x%lx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushU|WVS}EEEEt$E Uz ESe UB %9vhd+E U9BEEtoUBx$tc}t&ZtVC;E r 9sfc$[u8E E9s-UREPHÃtfc$E9}rՃ}t UZE EPUR ÃEE}tC;E 9r*Eu9}EPUREtC$t1C$tkEu`EWtjjP5K fP$UE<VUREujjjjVEPE uh2'뫐U<urjjjEPEPǃ t,E@$ t P&E`$σumPV:F$K~ F$;F(r@F(5ܞ"jjURA1e[^_ÐU WVS]u {CECT@t [j h@I‹K8D|BtK8D|JHK8T|K8D|BCtCPS SCBBJJ rBB$B ;~ ǃ}t+}KWEVu WEVt}uBE+9fwVQt E9}eEX]C(UBHl9v}t:MQ] SEP:$EE }UBXE3EiMA0E} E];C,UB0MA,Y<)É؋U ]KTEP(v ʉKT1Ɖ1UJTMA(]C"DtC9|h("ȉ؋TTdG`vE"9}$"Duh׸C9|ߋ"Ӌ "9}""Dth裸C9|߉""e[^_ÐUS"h5d"2‰"jPR5d"wYjP5"hANh5"]S S^]ÐU""j"HRP5d" YÐU""j"RP5d"Xgdt_get_slot botch 1gdt_get_slot botch 2US XAjhjhXAJwXAuڀ XA"tá"D"d";"thh"9|0=~h}߶="AuK"""XAƒXAt$XAhXAz؋]ÐUS] XAjhjhXAZvXAuڀ XA "ࡀ"dࡄ"=~}9" @?""fD"XAƒXAt$XAhXAy]ÐUVS]Dƃjjjj hS"Pshe[^ÐUE@h%PÐU WVSu ]ǃjjjjKSV"P'Ex`e[^_ÐUE@`%PUSVWl$|$11 $ 3u] m9r)߃!$"6[fVvfv[6v[ !؍4$" VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV)y$$"6fffvfff_^[]54"袳d$real mem = %u (%uK) startup: no room for tablesstartup: table size inconsistencyavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory UWVS )A11jjjSAPh@D Fv΃h 5A[h? C @ y PRhhԶjƃj%P5d"\+Ãuh~S)؃9thuVjjjh@V]S5d"n&p",jjjhVS5d"N&x"jjh&@hPmjjjh@Vh$A5d"&t" Ɇ("A PRh踵`"P P5\"h蛵 wAp"ta`@ AAǃ4CdH1ҐHBvC` CtC ACSChC`Ћ[ðAe[^_ÐUS]$Aࡀr"@Ã=`"u> @gfffgfff)‰`"=\"u`"\" \"=\"9v \"9\"9`"~`"=X"u!$X"=~ X"@\"+\"[Ðcpu_startup: cannot allocate VM for bufferscannot get physical memory for buffer cacheU,WVSj jj\"PhA5d"q; th豮 `"ș=\"EU~EEEE@E}jjPjhhjh0k u>`")~j9vjjWjhhj P- tʅ~6jjEPjh5 )Aj S thҭ}tEP}EU;\"}kEu5AE9E}]C] t,jjjw0Vh@}?? uԁEEU;\"|e[^_586NexGen6x86486DLCCyrix486DX486SX386DX386SXIntel686486386Dual OverDrive mP6RiseRiseRiseRise686 classWinChipWinChip 3WinChip 2WinChip C6IDTCentaurHaulsM2 class6x86MX (M2)M1 classGXm6x86 (M1)486 class5x86MediaGXCyrixInsteadK7 (Athlon)K5 or K6K6-3K6-2K6K5Am486 or Am5x86Am5x86 W/B 133/160Am5x86 W/T 133/160Am486DX4 W/B or Am5x86 W/B 150Am486DX4 W/T or Am5x86 W/T 150Am486DX2 W/BAm486DX2 W/TAMDAuthenticAMDPentium III (Coppermine)Pentium IIIPentium II (Celeron)Pentium II (Deschutes)Pentium II (Klamath)Pentium ProPentium Pro (A-step)Pentium/MMX (Tillamook)PentiumPentium/MMXPentium (P24T)Pentium (P54C)Pentium (P5)Pentium (P5 A-step)486DX4486DX2 W/B Enhanced486SX2486SL486DX2GenuineIntel3DNOWSIMDFXSRMMXSERPSE36PATCMOVMCAPGEMTRRSYSAPICCX8MCEPAEMSRTSCPSEDEV86FPU%s: broken TSC disabled U} u%p"uh@ Ð%s: xchg bug workaround performed UE t t"#€"#"#À"#1"#1"#2"#2"#3"#3"#<"#<ɇ"#"#À"#uh%p"Ð%s: F00F bug workaround installed US]Sh ì]Ð%s: disabling processor serial number UE u }% p"u; p"t22 0uh 2% p" p"CeleronPentium IIPentium II XeonPentium III XeonUE1҃ttJkp"w\$!!!#"!!!m!4u!,!$p"CuC| E!cpu0identifycpu: strange family valueUnknown" "%s %s%s (%s%s%s%s-class, %dKB L2 cache)%s %s%s (%s%s%s%s-class)%s: %s %d MHz %s: ,%s%sWARNING: CYRIX 486DLC CACHE UNCHANGED. ULWVSE p"uQp""M|"Mԋ"MUЉŰ"U؋"EE)MMp" hH"AE}eE1E("EF}!j E0h p"kAu؋UUȃ}uLEEj"= p"tE p"~}E)MMMEEȋE܋UȋRUԋMȋIM"]~}~Ew}u&u!}t}uEPEFUЍMȋDE}uFUȃPEFUȋT U؋MȋDTEĺ}u-= p"~$}t"p"w~URE4")ЋM܀9t"PЋM܀9tPЋU܀:t"PMQEPURh"RM4")ЋM܀9t"PЋM܀9tPЋU܀:t"PMQEPURh"h@0}tMQEPh'"U҃h@h'"h"Np"tt55Ah"&h"=p"tg1h'"h"1۾p"#"t&""u)Ph#车GNyǃh"覦M؉ A=p"u h#脦= A~  "e[^_UWVSܞ"P$E ( t9u5M It"  C8 (Dž$E,C(|C$xpEt艅048C;Zr;J vh(?EP=`@PujuWQSRÃ0u~uEU$U(1iE(Pu Wu`ÃtE=`@PWu5؎AtWuhh?όh?ŒEU$؍e[^_U WVSuE %E)P5d"eǃu `E0;]sKjjjSWh@ }u jjjjS_!;]r1e[^_Ðbus_space_unmap: bad bus space tagportpabus_space_unmap: %s 0x%lx, size 0x%lx bus_space_unmap: can't free region UWVS} }t }t~#AE}؎AU+Dp" U=v[E8Vh@ulj})SV5d"` hA=`@PUREPURvt0EPURA}uAPhALh(B?e[^_ÐUuu uÐUUEU 1ÐU WVS}4EPjV[Ãt6VS8E {ECEC E$CCE 1 e[^_ÐUju MÐUEl@l@Ku'GPWЅhI~E% t\ E_jjuPS5Ah@RWO )9vȃWPARu)EAPRh@ _9vȉƃPVSPu WVSiuG1ub=Au'jjhjAhPG S9vЃWP5A(E!Q}u! )KGW )Ot })}u =l@~ hl@@l@Ee[^_US] ܞ"Ett/U@ 9v2PB0u0 .hhSt  ]ÐU1ɰC1@@ź.#Au v t))ʍRȍ PATA=@Br-@BBL$AUS];XAA A@@@f@XASh@/‰t@ @x@$@APAA \AALp"%Ã4AXASXA]ÐUUM XAApmap_init: CLSIZE != 1pmap_initUVSDA"~'11ɉȧA̧A)ƉÃ$JuDADA@jR5d"|uhLN.z"~)1ۉAȧA̧A)Ɖ@ $Juޡ"~#1ۉAȧA̧A)Ɖ$JuXA\AXA"e[^Ðpmap_alloc_pv: kmem_alloc() failedUVSA5@ xAࣀ@Aujj#h2à ËA5@֡#Atu hpOxSSRB IuC SASXAt XAX\AXACXAS?HAXAC PS utCBC\ASSCЍe[^UVSUӁC HK ȃt =Tt2\AC\A\ACSAAtCBC\AS+A `A5@ xAࣀ@ = ~j#S0AAuAAZ5@֡#At=e[^INVALID PA!UWVSEMIXAL;{ q~@tCGC\ASACAYC )AC t =AS}uE"tDMȧA19r;̧As tۉAMJuuhQzyURA4~=@ xAࣀ@utvˁC uXXAC PS ut CB C\ASSCABABEUMU u=@ס#Atb6D];+A `A5@ xAࣀ@ = ~j#Se-AAuAAZ5@֡#Atke[^_ÐU WVSu] }9s,jjEPSVh@ 9r։e[^_US}u+jj"jMÃjS0S1]ÐUS]jh5d"=hPh3h@ ‹ fC C ]ÐUS]tfK uSj"S]ÐUEh05d"UEtf@ UVS]$C 0h@g F;ܞ"u"؍e[^ÐUÐU,WVSEu E%E%@;uVMQ t֐?uMu@VEPG Eu%@Mut2t @t &@ttCKt H`e[^ÐUVS]M t u1Q %9t@u %9t 5 "ظ [^ÐUS] Surtt% 1]ÐUÐUÐU$@U "؃h5x@JU @E% $@E %  "؃h5x@5t@/ÐUMU E}tI@uA߿v9=w2)=u)RQtt%jjPrUتAAܪAAAAAAÐUWVSu }E"tEMȧA9r;̧Ast)މ7AMJu] [A<5@ xAࣀ@AE u#tCt?wwBU t 5@֡#Atf!?u‰5@֡#At@1e[^_ÐUWVSu }E"tEMȧA9r;̧Ast)މ7AMJu uvA=@ xAࣀ@}t AU {tFt9re[^_ÐU WVS}u M@ xAࣀ@;yu*;qu%tBABA+A-ыt;zu;rutR@ӡ#Ate[^_U WVS} u="tX@ xAࣀ@~u~EF_‰zEB@ӡ#At褸[^_USUE ($S\P %x U,WVS=ܞ"u,Et"AE0tEEEE="t9@P PuBIOS disk mapping UWVS=@g4A =TPyǡ(AE$M9Q#ƉwD%)5ܞ"h jV"ЃtPEPhX{GT4A G_EWD   Ӂ ("WEGD EPHMIMG0 G0Wte[^_qU WVSEu }ɉv)׃FFFFFFFFF F F F F FF˃rt FJu~U +UU)ѡ~U +UU)Ӆ ˉ[^_USPAu1=X=(Auh(AS%uuu S"Ћ]ÐUSPAtJX(AtPG(AEPjStut1"%uuu S"Ћ]ÐU="tPAtxt1/PAtBuu r"ÐU"tPAtztPlPAu#P%uu R "ÐU1ÐUS] Mbtu+="tBjA0ud"1V"tPAtztPlPAu%P%QuuSR"Ћ]ÐU="tPAtxu=PAu uu PApUPAt p@1US]PAt*t&Sp@ Ѓ uPAj p@ Ћ]ÐUS]PAt)u "="u Sp@Ѕt"]ÐUUS,"=,"t1SЋS~PAt;P~PA;uҋPAt SCЋ]ÐUS],"=,"tDJ8Bu/;PAu 9u1,z~PAZRB1 :u]UWVSu] }CEjuVC,ЉEjuVC,Љ‰U Et=uZtuN ut?uuugjuVC,ЃtR=tKftE]}hhPEPV#ƒt"CB0t CJ0H4SCB4C EPUЃe[^_USMQ0tA4B4A4Q0YDC HQ<9uS u Q(]ÐOUI 0x%06x model 0x%04x rev %d at %s phy %dUS]E t1PS ЃP%PC Ph G shEG]UU MB 9At t1QRu@ÐUVSuF$F(^tjVSC@Ѓu [0u1e[^ÐUVSu^tjVSC@Ѓ[0ue[^ÐUVSuF$F(^tjVSC@Ѓ[0ue[^ÐUVSu^tjVSC@Ѓ[0ue[^!A  !U WVSu~DWB І̆B t@Qjv8v$G0ЋFDSjv8v$@0Ѝe[^_UVS]CHu6SDCL% Pjs8s$B0ЋCDhjs8s$@0Ѓ } tC1CDjs8s$@,Ѓ u"hF~͸-1'CHu CH`r"PSh~e[^ÐUVS]5@ pAࣀ@cHCDjs8s$@,ЃjsDSC@Ѓ 5@֡#At蔕e[^ÐU WVS]CHtCDVjs8s$@01hGcCDjs8s$@,Љƃf|̓{<tCHuCDVjs8s$@0Ѝe[^_ÐUUBHt$BHRhÐUVS]sDCHujjC< "PVe CMtjjC< #PVI CMtjjC< #PV* CM tjjC< &PV CM@tjjC< &PV f{L}jjC< (PV CLtjjC< PV e[^U WVSu^DCEC$C( FDjv8v$@,ЉǃFDjv8v$@, ǃ tK$FDjv8v$@,ЃtK(C$@tK+t~ uK(yFDjv8v$@,ЉǃFDjv8v$@,!t K(Dt K(3}K('@t K( tK( UBC(e[^_nsphyUEPH uu 1ÐDP83840 10/100 media interface: %s, rev. %d fxpU WVSuE@ PhxhAC U B<}GB8B@pZDF @p1t u { uE HHU R} GDjw8w$@,ЋU#BGL fGLt We[^_ÐU WVSu}E Xt:tryC;F<iC;F} GDjw8w$@,ЋU#BGL fGLt We[^_ÐU WVSu}U Bt:^tBI@;F<9gP;FVN uu hGVN u$%=puQh͘h h3G C}*NVA A RhOh?e[^_probe%s(%s:%d:%d): UUBPBPB PBZtPRh`ReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional SenseASC 0x%02x ASCQ 0x%02xCheck Condition on opcode %x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02xU WVS]s ]s4CPhbjVPhI Ftr hѺ1~}j hߺ,F@tPh,F tPhhVNB B B tQh*~qVNB B B tQQh=\jVÃtShW7~tFPhjjVÃtSh} tw<7uCw<3t WhujhٻERWhٻzE7}uEWhQ7Ph<EKG~vhe[^_%s, CDBParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %dUS]U t tuC$u"4d"ht@t@[uC PC Ph-u;4d"hvht@t@C PC PhR{KH$lllt;ȃPCS P@t{Phht@ CS P@t{PhǾht@ CS Ph޾CS Phht@ 1]USjjh<}ÃhS^ @ lAࣀ@ࡸAtXACA@ҡ#At\؋]ÐUS] @ lAࣀ@t CBC @ѡ#At\jS~]ÐUSM@ lAࣀ@AtC9u@ҡ#At-\[User command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code U WVSu~0uv h Wƒuv h ƂFXF,w|$(<`t|F(v$)Ɖs$C[hCY CXPC(PF4P@C[CQh"C['C[QhT C[ WB7e[^_user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistrU WVS}1ۃWYuhG  B 9G SCSI%d %d/%s %s%sUWVS]E tPh{Pt@pUeG|1ۉ%@t. t t1`t)Džx+Džxh@DžxcE$ qfx^VNF>6.&hjGPE܉lPCjGPUhR+jG PuVxP|t PSEPG$PVhRlPpRtPh H[^_DECTZ30TK50 not configured UWVSUB4M U<yjjj$dÉߋMq0 E fCUfSC"C" PSj2h@D5"h@S^ @ƀ@@~ ƀ@ @~=@uY@w1;"})"?hujFPVSaC;"|1;P"}*"?hujFPVS{a(C;P"|1e[^_ÐUE0PWÐUWVSEEeEPh"ƃu N0MQÃw~htGQhWFÃ6hjWMÃOhjWÃGuA fGjVt jVEPM E%U)ƒt(9}uY} t }`t Fd F`Fd F`FhMQV1:g~huhjWgEPsV؍e[^_U WVSU)ǃQh"Ãu C0EPƃtS+} t }`t!Cd!C`Cd C`ChuOh@j`@t!jj)f`EPfS1e[^_ÐU WVS}GDPh"ƃuG4O<1s(t G4@u G4WD%)ƒt' PW)~\@ lAࣀ@WP$VgV@ӡ#At29+G0G0GuȋXjV@ ЉE"w7V _C,SuVGPGPPEPZE EU Ѓ9v؃PwVajj]SjjURE Mȋ@u EffẼjWSTwu5@ xAࣀ@ЯAujjh$Oà ËЯA5@֡#Ate/E=+ A `A5@ xA@ = ~jSoQ/AAuAAZ5@֡#AK.AjEPSGPPEP)E t[+ A `A5@ xA@ = AA?uGCS)ЍH|6TB$ Buȋ@uBffBIyЋUȋ@u ff;EvEPwCPME+ A `A5@ xAࣀ@ ?tE5@ xAࣀ@ЯAujjh$KMà ËЯA5@֡#At-j@j SjjMQ E fSuȋ@u(BffB@u ff1f; v zvB+ A `A5@ xA@ = ~jSN-AAuAAZ5@֡#A,EȋXjGPGPGPPMQxuȋXjWV@UȋXjWR@MȋXjjjjjQuȋXjjjjjVUȋXjjjjjRMȋXjjjjjQuȋXjjjjjVjEP JjUR 6jjM/jjuhjEf?tEHjjUkjjMOj?Pu+fH0`EP?MȋXGPPQB WuVS WEPE?%)ƃt E%uURWSMQuE EP>)ȉ>у}t*}uUUE}u 0E}0EE9E9}jEP%EHs@f}M+ A `A@ xA@ = ~jURF9AAu MA AMEB@ӡ#At7$}u}u1uURWhdUE%% R~e[^_ÐUWVS}u @t!LJLJj ]S$E%Vjh NjjuVj Sct1rUMB B B ~tUF F F Bcwe[^_ÐUWVS] uj }W#EEEEE]EEjjh@ jjjj WEqe[^_ÐU,WVS} ]u }9tVEPEu_C@9~))x>D2 PD2 PD2 PD2 PD2 PD2 PEP[^_UWVS}] j uV"EG]EEEEEEEEE Ejjh Njjjj V^e[^_ÐUWVS}] j uVG"EK]jjhjjjj Ve[^_UEhjhjjjjj۷ÐUWVS] uj }W!EBuME@EEEEEEh jhjVuj WEhe[^_UWVS] uj }WS!ECuMEEEEEEhjhjVuj WEe[^_UVSu] jjSjjVl u(CS)ЍjPSjjVCu1e[^ÐUu ut1ÐUÐUÐU,WVS}u j EPK j]S=   $H8EEEhjh0ujjSj EP軵EF1EEF Ehjh0ujjSj EPh0Nj FPEEE F Ehjh0ujj Sj EP0jFPEEVEEEUE F Ehjh0ujj Sj EP袴0UF $F VjFPEP1QEEF Ehjh0ujjSj EP(E$F1EEF EEj EPFP'hjh0ujjSj EP³1EE F EE jEPFPhjh0ujj Sj EPbtJ1BEF ?Ejjh0ujjSj EPu 1e[^_ÐUlWVS} j uEPjT]SEE EETGEhjh0ujjTSj VE蚲0w]jVC€FC€VFC€V€V$FC€VFSC C C ‰V SC C C ‰VC C C ‰VCF O(1e[^_ÐUWVSu j ]EPj}WEE EEFEhjh0ujjWj SE6uGFGF1e[^_UWVS} j uEP hSEE EEGEhjh0ujhSj VE裰0uhGPP1[^_ÐUWVS} j uEPdh4SPEE EEhjh0ujhSj VE0u>45 ‰WB=wRGP8P 1[^_UWVS} j uEPhSEE EEhjh0ujhSj VED0u> ‰WwRGPPK1[^_UMU wX$$0<HTRQ5RQ)RQRQ"RQ|8tUWVS} ]juV_jBWTE]EEhjh NjjBWjVEe[^_ÐUWVS} ]juVEM]hjh NjjBWjVE踭e[^_ULWVS}u Vjj]SW# uE$ EVjSWle[^_ULWVS}uVjj]SW u"E EЋEEҋEEԋEEVjSWe[^_ÐUTS] ujjEPuuEшEӈCEՈCE׈C1]ÐULWVS] }WjjuVEPD u,EEECEӊCEՊCEWjVEPue[^_ÐU T   U,WVS}uh NjVj]Sj/ u1E EEEEEEEh NjVjSe[^_ÐU$SU] h NjujEPjuEECECEC1]ÐULWVS}] uh NjVjEEPji udh NjVjEPjND u?"EوEC"EۈEC"E݈E["]߈]h NjVjEPe[^_ÐU1ÐUWVS}] j uVE]EEjjh@ jjjj V蚪e[^_sdUUEPjjh"rE %s: %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec totaldrive offlineunformatted media%s: WARNING: unable to establish shutdown hook UWVS} EU2B$XF|"~f~ vfF LJx"GEGX_0S%WSSF ttLJx  LJx "FuUB@uh z|" PjRSÃ1ۃjUBPYPcjUBPbPHjUB PsP-t #x5"RWЉÃEPh tO t ctKYUJQZ Sr2r1É1Qh  h  h wh gWh)i| uURh ;e[^_ÐU1ÐU WVSEE@ lAࣀ@uEt)B$F$B4B0B0R1V$u׉@ӡ#At%Ur1;"}*"?ujFPVS3C;"|1;P"}*"?ujFPVSs3(C;P"|܋U|t PJh1e[^_UE0P;ÐUWVSEEeEPhd"ޢƃu N0MQ軩Ã~htGehW*ÃJ|hjW+Ã'OhjW辢ÃGuO fGxjRVЃu jVEPe E%U)ƒt(9}uY} t }`t Fd F`Fd F`FhMQV螡1:g~huhjW財gEPCVb؍e[^_U WVS}U)ƃQhd"ܠÃu C0EP t `t!Cd!C`Cd C`Chur txxtjS@Ѓh@j`@t!jjf`EPS>1e[^_U WVS}GDPhd"ßƃuG4O<1s(t G4@utG4G4WD%)ƒt' PWn~\@ lAࣀ@WP̟Vs @ӡ#AtN V!+G0G0GMO8t ؙ؅} EEMEE]Vjh jSu jEPwLX}e[^_UWVSu ExLGudj]S:EVjh0ujjEPjSW}u.EU ЋMAPUE E ‰QT1e[^_ÐUlWVS] E@LEUr@ j}WEMSjh0ujVEPjWEPr|@uvUE E ‹MQ\UE E ‰Q`EAd}}I0E`0UB@tPPEP>MI1e[^_ÐUlWVS]u CLE{@ C4u E@t 1jEEPEEWEEPEU⏈UCXO(tDN@?UB$<u8C4tE@u C8 C0uC0G$G(tF@1e[^_ÐU WVSujjhEu jVÃulF8;~8~tF8=t=u ǀN0 f0jVdÃu#j WEPV.jjVaà tjEPujEPq1e[^_ÐUrd%d: fixed, %d blocks UU }u)#ࡠ#BBh jhA8ÐUatapiscsiUUt:uE @ R9t t1 UWVSu E@hA踋VTvPfF6fF8FL>FD>fF:fF>fF@19,CPPPunjFPR"F @C,PS% f=uK fuK $`C c44GLF1jhF0PVd~1tbv119,"@4tj@PV!S 44G~[^_ÐUWVS]CE{j uVqEEEE]jh"VEPce[^_ÐUEx<~@<PfÐwdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: driver failed wdc_atapi_get_paramsU,WVSu vU|,EGj ]SwEEEL"fEESW t'VEp@PhCÈh1D.EuYG UjRЃhM EPL"PWDt"mrh̐e[^_ÐUWVS}G P pRTUvD,EG UBuG,P4Ãu hGt C { G CG$CC,GC0(H5@ lAࣀ@UB GH$,FFFFFFFFFFFFFFFFFFFFFFFFFFFFE@uKCGHPA A ‰SPGP@BBC4pY SURxGۉ5@֡#At؍e[^_ÐUVS]E K41C,C4Qt uA FtI tI@t yuC,[^ÐUSU] jRЃ9]UE @LKjPuzUSUJ@ lAࣀ@jRQE@ӡ#At]ÐUMU u j$jRQU WVSu 1E FjC PjjjhPVC G<OHF(tcC GLKpEPGPvFPhkVxtE@, %s: %d-sector PIO, LBA, %dMB, %d cyl, %d head, %d sec, %d sectors CHS, %dMB, %d cyl, %d head, %d sec, %d sectors %s: WARNING: unable to establish shutdown hook Uhffv < ǃ<<sVh[ott@t@tK ‰xR|PvPrPЅ} Ph[Qrv|ЉxR|PvPrPЅ} Ph[:o ǃ8>sXC0PBW@Shdu uVh,\ne[^_ÐU1ÐU WVSEE@ lAࣀ@uƼ%B$F$B4B0B0RV$u׉@ӡ#AtݾUr1;"}*"?eujFPVS_C;"|1;P"}*"?eujFPVS+(C;P"|܋Ut P1e[^_UE0PVÐU WVS}GDPh$>QƃuG4T|O<1s(Åuv G4tu G4WD%)ƒt# PWR~\@ lAࣀ@WPQVW @ӡ#At2VQ+G0G0GSkhla#fe[^DMA errordevice faultdevice timeout, retrying %s: soft error (corrected) U WVS]dTF@ƅ\>\$cdcccccF0F0F4bCb;c3`t`W`Ph(hXHjWh,[VKO0/hcBi`r"`r"PShd=xhciF0F0F4&8@u ~CPhchF@V<)‰PC0PRVlS)[^_ÐUSUd@ lAࣀ@QR@ӡ#Atʸ]ÐUu h@Ehujh_'ÐUu h@Ejujh_U WVS}Ph$>KÃu "C0EPRƃ{httuOtu8 tpPjSD jSMQ0%)ƒt*9}1u W} t }`t Cd C`Cd C`ChMQQSK1EPQSJe[^_ÐU WVSU)ƃQh$>wJÃu |{0W`QEuW} t }`t!Cd!C`Cd C`ChujS. W"QS>JEe[^_ST506/MFM/RLLESDI/IDE diskUVSu] hSC(vS0|K,rC4щS8hxufCjhgfCjhgCP jPCPxSGu  tuDžhd0wBedAwsd rdAmdndt4wgdffdZQCMu M@u󥋀HX􋅼PjjPEPRMQ }eM)ÔYkE􋽼0WL<tjMQVuYhx tHgdu;h_U% RtWBLUt@M9t to$t[EuUuDž ;ËNjuEx@ UBǃBǃǃǃ$EPh@E$PURCPhw 3C8CPCDCLMK4CP }S Dž􋅼PC[^_ÐU WVS]ۉ؉Vh$>8Cǃu )ƻ#_hujh`jEPuGtr( ujh`jMQtWBe[^_wddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeUWVS=<>uu<>]ۉ؉Wh$>Aƃt)Ëhx w J(E1t ] E 1E |; v "U =@><D>@>B M Dfdž8=D>u8 f8t@t8 f8D>9vB(TMX`8Pht~#uhnWh oW\\$xqHrqqqqh3ohLo h`o[MƅS`PhShro[ h}oVt<=D>tD>hc`[xhcK[AD>9v)׉9vU 9vB(E/<>1[^_UWVSUp@}1fxHt\1ɐFEUB8T1 }W,T1 Ћ}9dC}Ef<uEdC~~[^_ST506wd_get_params: bad return code from ata_get_paramsUVSu]SE PhjttVZuS\j(h"sC6P}f@fCfCfC fC^fCdfCbh@1h,s Ue[^Ð%s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault U0VSuhxj ]SEE@E@E fEE0uShh tFPh tkXE}FPhLtOXEtFPht2Xe[^ÐUju=ÐUSjjhtÃhST @ lAࣀ@4AtX4AC4A@ҡ#At؋]ÐUS] @ lAࣀ@t CBC @ѡ#AtçjS]ÐUSM@ lAࣀ@4AtC9u@ҡ#Ate[user_strat: No ioctl physio split wd ioctl request... cannot proceed U,WVSu1V9Ãuhv_Vj EEP諧V<;thv$V1q(uw u \t E  t E fEt EfEE fEꋃE슃E$EfE⊃E䊃E劃EE@E@CPECDEEPht ƃEt1E@t ƃ_Et ƃVƃKƃt8EሃEfE䈃E刃E戃E鈃F4VF0F0~4Vρe[^_wdcU WVSu] ~0jƒuft F0t u @BZ C BCBB,yB0HB8<RWͿtЍe[^_ÐUVSu] C u`r"PVh-'SVe[^Ð%s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: not ready, st=0x%02x, err=0x%02x UWVS}E X @@T,UEB < t3PU BPwGPh(z ju FPW茽E@ jjU RW M @tfƃutuE xt \t EsM Q1v(EKAXt=1FC,t-+S xuA,I<))HC ;U} fEtS UC $ @E!S s1v,UE1v0U΋U @MKBCEʨ tEȃWEPsM AAPAPwr@BDЃ tC$C(u VM A PjWBh'j@j@Wm *jEPEPEPPEPu FPWֺ WEPFPwr@BHK;MvMKSB(C~uEŨ tEE0 tE M A PjWBh'j@j@W覮 cCfxu @\1PEPEPEPPEPu FPW -K~#E PЋs1v(E9~ CU BC h'jjWtPG)PG(PM APwGPhzNSuVN tC$E PSUR' uM QWbsu FFPEPϱu O$~jjU RW yUG)PG(PM APwGPhzMSuV~ tC$E PWe[^_Ð%s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: polled transfer timed out (st=0x%x) %s:%d:%d: intr with DRQ (st=0x%x) %s:%d:%d: read intr before drq UWVS} ]w G@ET,UEz w1B PGPUrBPhKh4XG@tfƒUtUDuF$WEP;1u'PjjURêtu 1wwGPEp@Phh;K @t&UBURWRUrp@@LЋE@ F$WURVEPË@tLh'j@jHUR}3UB(PGPrBPhJF$ UBURWRUrp@@LЃtt F$E@(t8t8@(PGPUrBPhJF$ u[E@  tEE@(u#GPUrBPh(IvGGPUR覭FF FFGFW)‰ЉG~u$WEPF$WURpe[^_ÐU WVSu] { Vh-SV" fG$G( u(e[^_ÐU WVS} w G@E\,Ph-RF$uC { v S虮GFWEP臵 fu(EPܣe[^_Ðwdc_ata_ctrl_intr: state==RECALrecalpiomodedmamodegeometrysetmulti%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) UWVSuE x @@\,E}uE'C K$DT~Ć0Z༇>hHBEhURj@j@VgF(!JF@0C@jC PjjjhPV跱C  EnEPj@j@VF(!C t jC @ tVjC PjjjhPVH C ,EvURj@j@V若 F(!nGfxu @\1PG@,PjG@0PG@4PhU BPV輰C  E~EPj@j@VF(!tRjGPjjjhU BPV`C GEEPj@j@V裤ux~E|>} uhƌVA1ېE sU4WhٌV@ƿߌC~֍e[^_mainbusU biospciEISAeisaisaU0VSu hn?EpEEjh]SV j$t4EuEEEH?EjhSVjhyDp"PDu-E~EEE,?jhSV?=4Au*EEEE?jhSV e[^%s at %s bus %dU WVS]E tP3h>3uush>e[^_pciUVSu ]Fp3u"F t;Cu{w 1e[^ UlWVSEEȃPM QuYhI>Eȋ@EċMȋIMEȋxHMQW\E}u @EE9EjMQEPWxÃjSW!ƃ fBf9j SW E}EEM9MEPMQEPWÃjSW ƃ ffjSW{ Ejyt2Ef9>tytEf9uf9QtAtAuEEEEAuI M0>=0>tE;Gt ?t;Gu1?twt >tE;Ft t >t;Fu}u#PEPhhS7à 0}tMQEPhPMQh4SÃ}}hVSÃuEPEPht;PhSÃtuEPh PhSà EPhSlEPhSUe[^_UEP %=t= e=xrJ=Y9w9=xP,w=x$=xU=Y =xaw=x`=xp=xq=xw;=xtw=xs=x=x=xtsw =xtjr=xt_=xubV_tLw tEw wHrC7Qw;Pr6*=t#w=w$=r=t=u 1: unable to map registers : error allocating pci data %s: OptionMode = %x %s: couldn't map interrupt : couldn't establish interrupt at %s : %s %s: Using left over BIOS settings %s: UM@jjEPEPjjjW貮 thhMEPjww +jjj iTƒ u(hS8‡^G GBGBSLCPpMEPUREPVu7S[CPp {4tS8t{4u S8C8@{4u S8C8@$E{4u S8C8@ƒU{4uS8C8E܃S``t?u UBE@K4uS8ŸS8Ÿ $C8!ƅt܋S8 K4uMS8JS8MS8 QS8 US8ŸZS8|ZC8@tC8@{4tC8@ {4tC8@ {4tC8򈐟{4tC8ƀ|EPG1PG0Pw,w  tCPhguw rƃCEPShVjuw C00uAhDtVh/hS2YtVh5@ lAࣀ@K4uS8„K80C8 t 罁πtˋC8EPS;K4uS8K8?ЉC8@DžtC8?Pt3{4t C8ƀD1S8D"S8†{4tC8ƀt\}t-EPhS8ZE `"EE{4tߋC8U`PZU㈓FS>CPh;} EtSt%SpW5@֡#At'/ 5@֡#At/See[^_ÐUS]CLj@p0d t'{4u S8„ C8v 1tt 1]ÐU WVS]{L t{4t;C8j@w7tWs4uS8„S8C8E} teMt,C8U5}t } t[8ÄEɀ}tQj@w7e[^_, parity checking enabled%s: External SRAM, %dns access%s UWVS]S+E1}jjjSSkƃ 6EjjjScSBƃ K4uS8‘uOC8t@u/S8’,S8’6S8’6C8 u{4tȋC8ƀ{4tƋC8ƀjWjSS蜜 9umK4uS8‘uOC8t@u/S8’,S8’6S8’6C8 uE{4tƋC8ƀ{4tƋC8ƀEPWEPSe[^_%s: Reading SEEPROM...checksum error done. %s: No SEEPROM available. UWVS]C4E܋C8EEEE t E EfE fEfEfEfEfEuVS@ Et\Dj P}WVEt!11WB|tf;MtE}t E묃}uE‰EfEfEE19}|E@tcmS8ZS82EfmS83ES80ES81fmEF;u} w@t@1;uufE}U:tMf M@t@t&Ef ES8pcEtUf UM9ЃfuEfEtf9Ef!EtK1ɋU:t{4tC8LpM9UfUt-(S8 /U:t tɀ{4t͋C8L EF;uEFEt @t@}}t@u EufE{4C8HZ{4S8EЈB2{4S8fmEЈB3{4 C8UP0{4C8fmMH1EtMt{4u S8C8@u1tu QEPSEPh[^_%s: Manual SE Termination %s: Manual LVD Termination isnot%s: internal 50 cable %s present, internal 68 cable %s present %s: external cable %s present %s: BIOS eeprom %s present %s: Illegal cable configuration!!. Only two connectors on the adapter may be used at a time! %s: 68 pin termination Enabled Secondary %s: %sHigh byte termination Enabled %s: 50 pin termination Enabled %s: %sLow byte termination Enabled %s: Primary Low Byte termination Enabled %s: Primary High Byte termination Enabled Primary U,WVS}uEEM 9I] SC C u EEEEtyEPEPEPEPEPW uEMu %EEEEEQ] SSC COtEPEPEPWQEPEPEPEPW uEtEu&}t }t}tGPht}t }t}tM@}}t@}t@~}t#tM W8M&] }tE4t؋W8MB}tMEPW\W8]>E PP@QtM tM@4tW8]BEPW~E 8tHP@ e[^_U WVSu}]u3@ U ƒƒMe[^_ÐU WVS]u }jSSЃ4j SSЃMсEe[^_ÐUS]{4t3S8B {4tS8B{4u"S8S8吋S8 ɐS8BҋM ҋM{4u S8S8RM[UVSuE E u*DBu,(V8)V89t~4tՋF8Xjn^ ]~4t‹F8XjR^tV8~4tF8Xj^tV8~4tF8Xe[^ÐUS] uDBu S8 t{4tC8Hj]K4uS8S8C8@EtC8@E]ÐUVSE] t1x4u P8@8@u1SSC;tKSC K;u S S SC uh\NuK3uS SSSxSC ut܋SCSe[^UE8u PP P@Ð%s: Data Parity Error Detected during address or write data phase %s: Signal System Error Detected %s: Received a Master Abort %s: Received a Target Abort %s: Signaled a Target Abort %s: Data Parity Error has been reported via PERR# %s: Latched PCIERR interrupt with no status bits set U WVSu~L~4uV8’ F8@u1V8’jw71Ã}FPh@tFPhx tFPhotFPhStFPh7tFPhuFPh8Sjw71t~4F8ƀe[^_UWVS]EEEE9ES2SU;tFSCM2K s u S S SC t܅u,SS,SSE2C뽐SSECS1='?'?tS 0U;t@SCM K3u S S SC t܅u(SS(SSESSE2CCStSCM2K s u S S SC t܅u SS CS'?tS 0UG'?9{OMsC 0E;tASCM K3u S S SC t܅u(SS(SSESSE2CCStSCM2K s u S S SC t܅u SS CSUsK 0MO"fE;tCSCM K3u S S SC t܅uSSSSECSfeK"u#SSu%'SSE2C)SCtMt؋SCM2K s u S S SC t܅u SS CSOE+EMU f BCE;SCM K3u S S SC t܅uSSSSE2CCStSCM2K K3u S S SC t܅uSSSSECStSCM s u S S SC t܅u SS CSEEE9Ee[^_UE@ f=u%=tw =t =u 1Ð %s: unable to map device registers adv_pci_attach: adv_init failed %s: couldn't map interrupt %s: couldn't establish interrupt at %s : %s UWVS} ]C EfLJj ss BC"=t=u0=u<w0 Rj ss EPEPjsEPe uEPjuu3x5 tGPh@G0EG4CG8C ffLJWthnEPC1PC0Ps,EP  tGPh8uEP衫ÃwVWhLjuEPG@0u6VhXttShz_hOSh>W e[^_U WVS]{0s4F fFfǃƃƃƃƃƃƃƃƃƃƃƃfǃƃƃƃƃPE+ƃƃƃfǃqfǃPVW < fǃƃ ƃƃƃ ƃ&ƃ,ƃ2ƃ9ƃ?ƃEƃKƃRƃXƃ^ƃdƃkƃ< u(t4F `V1fxV ]< vktF PaV `WV POV `\V Ixƃƃƃ#ƃ(ƃ2ƃ<ƃFƃUƃfu tF `ƃVW f=utF IfǃtVW)1ƄƄƄ@~e[^_ÐUC<u7EЋU MQEPVW EUM؈E%PEPVWjj@VW=fE"PVW8EE@%@PVWà tiEU؀tYjKVW EPjKVW2ME }(u(v#ˋU؈PE 'PVWjj@VWe[^_ÐU WVS1E $EG /u]Eth E8uɸe[^_UVSu1ې؃PVC~e[^U WVS]EPCPU REPCPU REPufEEUB}GBCPE PURHfEEUBwCPE PUR fEEUBGB<SE PUR#EUBe[^_U WVS}] EutfC uSfS f됐CfEMuSfC u SfCfEEFMAFu SfCfEEFAFuSfCfFuSfCfEEF AF uSfCfEEFAF[^_ÐUS]M uQffAu Q1ffA[ÐUS]M uQfQ$fAt$fA[ÐUS]M uQfQ fAt fA[ÐUUE E@t)u Pf@f$t<t<u1% uPf@f$<u ÐUWVS}u EËUfU@tC<vuVfVfNtfNVWuVf^ȉfN؃ tfNVWFHEtUu uVf^ȉfN؃ tfNEPVW1e[^_ÐU WVS}u 1ېjjVWƒfCf|uj]VWEeE Pj]VW u VffF1ۅuVfu+VfFttfFfCfvEPj]VWe[^_UEt BuÐUE }uPf@fu1ft ÐU WVS]M UBfwQBfuuQfyfqf ƅtfqQSZ1e[^_ÐU WVS}u jVWu V^jVWÍe[^_ÐUVSu] E$EjSVRu SEECjSV.SVde[^ÐU,WVSuE fEUUEEUUF0E~4j]SjWPU C<C<E{v ECKE8r : v EUS}tVCPCPVÃu9M@E EPEPWEP,UE0]{u3eE EPEPWUR}tZE@tS$EU CPCPVEPPWEPU2M@CPCPVE CPCPVà EPPWEP3U2EIu#U}uB<uBjRjWUREjEPjWEPM@ EPEPWURe[^_ÐUWVS}M EEG0EG4EEU ‰UeuEFQWÃ:vFjVjEPEP1jVjEPEP]Ee[^_ÐU WVS} f]uVPWEP0VSWEPe[^_ÐUVSu]E PV$:we[^UVSEU UM: 2wJ9} ]:0v@9|B[^ÐAscExeScsiQueue: Queue with QC_SG_HEAD set but %d segs.AscExeScsiQueue: Queue with too many segs.UWVSu EX0H4V(UfEfEFFuFEFE€F$8uYF}tK PQSƒЃPH!:PW[N` VtYEfEfujh;ʌf}2v h@;贌f}uMAFA F V}Of}F$EFMtkucFt11}9}}E A9|^ t7v5t#t%tCttt UtZuE}t F$ Ff#F}ftAt=t(u3M] UD€tFu FV)MfAEPÃWEPEP 9s F WVURuMft<t8t(u.N F€tFuu F)N VjEP}WzuF tjVEPEEe[^_UWVS]EE{0s4E PUEjXVWfEUEP҉URVWE VEPVMQTEPWWE]1B@OvCC MKECK4K$Caj jVEPMMUE MSW2 EhSVMQ>VEP)uTVMQVEPw MtjAEPVMQUEPWY EM VEP#MEx[^_U WVSEx0X4ƀEPKSWiUƂSWmM)ЍPEP1UƄ"tjAPSWF~΅tfC uS ff=u S fC f=tESWYuESWEƀƀEe[^_ÐUSE] Sj0p4p0T؋]ÐUWVS]E E{0s4EMEEЈ ˆ "EMA$<w A$<vOEtMAtˆEt(MAtQtEM:tdPjRVWPjJVW PjSVWEPfE PVW E:tMQEPSe[^_QUANTUM XP343011071US]{v8jhMCP%ujhMC P u1]HP TANDBERG TDC 36WANGTEK NEC CD-ROM DRIVE YAMAHACDR400UWVS]}E E$EMErf}u#jhNGPVu EU }t}u E ˆ}ugjhNwVu%jhNGPu E }u"jhNVu E }jh NwVu%jh&NGPzu E }ufCSfK@fSf,S -SMfPSMfhSMfSMfSMfSMfSMfUfS P f{ @f{MtTtfC"uSfS"fCuS"ffC"f{C ӋEuXu SffCUfCu SffCMfCu SffCzUfCu SffCbMfCu SffCJUfCu SffC2MfCu SffCUfCu SffCMf P fCu Sf{uC4f%?=?tC4%?=?u t E0ujtWxa\0UNKfSLfM$ȸSf EUu" t ~t u EUf% ǁuKpȋpffC6f{u SffC"fCLu SffCM$ȸfCEukfǀUu$QMS@f@ $PEPvU@ u S`ffC`uMS@fU@fCuSbf fCbZM@fCEUu}jMS@fSS*f$S @f%SEfZSEfsSEf@ $PUR6M@ u SdffCduUS@fM@fCuSff fCfU@fCCtfC(uSfS(fCf{*fC @Mf}ȪUu SffCEfCu SffCUfSu SffCrMfKufSf ffCuSD( D(Cv EP tfEEX[^_ÐU\WVS]{0s4fEEEPVW/f;EtXfE1Ґ0?D*BIvjVWfE܃jVWfEڃjVWfE؃EPVWzEfEfEfEfEfU҈EӈE$EfEȈEfEfEfEfEfw wuEEE<u ƃ@.<u ƃ`<u ƃpƃMEe[^_ÐUWVS]{0s4fDžxfDž~EtPVWf;Et]fDž~1ҐD1?D*BvjVW$fEjVWfEjVWfEtPVWEfEfEfEfEfEfEfEEE$EfEEfEfEfEfEffǃu /u u  ufxxtʸf fx€vENwt3owirdx@ ǃ?ǃuQSSfu \HuZPu+sC @ph\P56_ǃǃ x<tr dxr ǃǃSMCS~\߃ SCx$L4So9u]RxrF{8u LS< CsC @ph\U-u)$fǃ_$\ǃ,ǃ,uǃ ǃS\߃Se[^_Ð ԝఙ ఙ\ @@@@@x U WVS}EjPW:ft 1:jPWÃjPW   t$9uf~ t-^ F PPWf#Cf;CuE}utf~t-^FPPWyf#Cf;CuE}u:f~t-^FPPW?f#Cf;CuE}t.f~t'^FPPWf#Cf;CuEUe[^_ÐU WVS}] jVWt=t =vt/KFvԅu(jjWt=t=v 1  e[^_ÐUUE @t ǂZf}ǂ I tǂ5tǂ!uǂ1ǂǂÐ%s%d(phy%d): error: reset of PHY never completed! U WVS]tMr*_hjE PSǃ dǃjE PS)ƃf}GE PsC @ph<x(\ǃjE PSǃjE PS‰ 9tPjE PSDVjE PS.jE PSgǃǃ jE PSAƃ u(~ SN=_ǃ*jE PS!PSu_e[^_ÐUWVS]thh]ts tnx uhPtu*%;h Ah.PS<1u{8tS!| E}d&EEh荪O}d~7ǃ5LS< LS<ǃ|@@@ @@@ @@ @@ e[^_Ð pఙ̧4UEh Ðఙ4USM y8uQ<A<K[U WVS]{8u@S<S<@4SH{8u@S<S<@4S[{8u@S< S<@4S+{8u@S< S<@4S{8u@S< S<@4S{8u@S< S<@4SOu{8u@S<S<@4S_{8u@S< S<@4S/1{8u@S<S<@Se[^_ÐUWVS]SE{8u@S<S<@4SH{8u@S<S<@4Sk{8u@S< S<@4S;{8u@S< S<@4S EMMME }{8u@S< S<@4S;}t{8u"@S< {8u@S< S<@4So{8u@S< S<@4S?}eMA{8u@S<S<@4S1}{8u@S<S<@4SK8u @S< S<@ ǃu@S<S<@4SkE}gE @ H{8u@S< S<@4S1{8u@S<S<@SE}?Se[^_ÐUWVSuMIEeN8u@V< V<@EtEEu@V<V<@V;}} #};}t5~8u@V<V<@V~8u@V<V<@V}~8u@V<V<@Ve MHe[^_UVSuN8u@V< V<@} u@V< V<@V~8u@V<V<@V~8u@V<V<@V~8u(@V<&u@V< V<@VK~8u@V<V<@V~8u@V<V<@Ve[^U WVSu~8u@V< V<@1E~8u@V< V<@VoN8u@V<uF<@tu@V<V<@V M_~8u@V< V<@Ve[^_ÐUVS]s8u@S< S<@ u@S<S<@ Sc j jSjhSju S|juSnhSS7e[^UVS]s8u@S<S<@%%u@S<S<@S j jSjhSju SjuShSjuSe[^Ðd n;0&AvQkkXaMfSC fVfSC fVfSC fVw tdt t.}fF fFfFEfF fFfF]U|fFfF?fFd/MfFfF=fFdSCV SCV}XW<1|ECFCC*EFFCFCC*EFVSME9Uslj 誌Ex8uGЋMXQ<'E@Mt'Gu ǁGE"M;Yu9Et׋Et*GUu ǂGM}~PA Ut)@u ǂ@E M}C%EU_uuf;|o)A WEBEBEB fEUt&9uURqP WP貄M]EEE@L@tU<1Ҁ;}M8t#tE0U4tIM^u=RGPPEp@ @ph6U^ MAHE;XuUZ}u5@ xAࣀ@pAuj5"hMZà ËpA5@֡#At:tQfC@ xA@fAࣀ@Ћ#At9CK KfCjjȐÃ5@ xAࣀ@=&Aujj苎&AS t!+$A @ |AC &A5@֡#At@9C t#CKC(C$C,C0CuSw1ۃ}t%GG EGUWWEPRv߅uEM^]S B% BK W % ЉAC C PS ;CuC G]u xEXUυ\؃~^EXE11}܃}tUXMQ 9e[^_ÐUWVS]XEEEh9l`lMQB \\@t @\\!She{8t`S<0{8t6K<8d {8VK<4h v8S^ t3l4HpsC @ph< ttPSǃt^lS ltlP$luRsC @phaCPuǃǃ\S{S] (invalid EESPROM checksum)%s%d: %s%s pass %d.%d%s address %s UVS]sdfF4"dž\dždžfF2F| PP`%=uRƒRPPsC @ph4S@hLhjCLP荙_SS8V|V肏 jjVP2oe[^ÐU WVSu] E؉ Mɍ$M(U,UUډ0K4E+}8<E؉@UҍDUډHLMىP{TE+EÉX[^_ÐUS] UEC KPR"SB%? B]UE@ f=u!tt tu 1deUEx8uP<P<j ^Ð: not configured; limit of %d reached or exceeded : not configured; 21040 pass 2.0 required (%d.%d found) de%d: not configured; 21140 pass 1.1 required (%d.%d found) : unable to map device registers : can't read ENET ROM (why=%d) (%02x%s%d: %s%s pass %d.%d address unknown, couldn't map interrupt , couldn't establish interrupt at %s: %s%s: warning: couldn't establish shutdown hook Utryloop + sizeof (scrh->tryloop)assertion "%s" failed: file "%s", line %d (u_long)p == (u_long)&scr->data_in + sizeof (scr->data_in)(u_long)p == (u_long)&scr->data_out + sizeof (scr->data_out)U WVSuU л ߁@:`4PIy9thj h h4 ht džPp@\PIy\PP9th h h ht džSPp@PIyPP 9th h h ht Oe[^_%s: ERROR0 IN SCRIPT at %ld. %p: <%x> %s: ERROR1 IN SCRIPT at %ld. ncr KVAR out of rangencr_script_copy_and_bind: weird relocation %x @ %ldUWVS}u uE}$EE9.}uePtSGTUEu++EHPGPhE1h@BK  '$UWT뭐UM롐lllllXE%=pu1ɋV%=pu11t++EHPGPhnrh@B)K tuG}uo}u:PtHGTU\QE>E~8tF<@VCt ht+Vu#u(tt =u "BBEtt'>FFFE@DFE@HFFFE@BFUr$r C PW8ƒ}=uF,EPSWy3U@ҡ#AEtGhC(D'EtGhC(D GhC(C0C(C,[4WhˆS$C UB @UBKBEǃE ߋ%e EuFǃƃF @ƃ ~Tt FT4 % Љǃ UBICx}tCyW< CyCzC{C|uFEC}EC~FKC 5CUJMb)¡ADǃi  wh4  4ff 8CG<@ uE죀@ЉE#AEtzu&1,W<yW< Urt/Bh3W2 Nt E@tۋUBwVh 腥8tG<@h+38nG<@ WE@uO8u W<,G<@,PVh0 jhL Wb UBuCySW$]C,tu e[^_CCB=%lx STAT=%x/%x %d parity error(s), fallback. extraneous data discarded. illegal scsi phase (4/5). extended error %d. %s: sense data: %xCOMMAND FAILED (%x %x) @%p. CMD: GOOD SENSE: STAT: %x HOSTERROR: %xU WVS} YE iF9ǀǀ@UJh选H$PR|9E ǀV BMRCpsc_link->target & 0x0f)%d.%d MB/s (%d ns, offset %d) UWVS}M EEUU8u W<G;us9}t U{Pu sTCTPWh <蚏CPh$<膏1{8u S< C<Ph1<XF~σhBe[^_F <%d|%x:%x|%x:%x>%s: have to clear fifos. %s: handshake timeout %s: INFO: LDSC while IID. %s: target %d doesn't release the bus. %s: reg[%d0]: %x%x%s: halted! fatal errorUVS]/S< tC<@PjSs8u S<C菋{8tC<@O{8tS< BttCPh>O{8jC<@h{8UC<@{8NC<@\ {8r8S<\ !%fu3Euu-{8tۋC<@\ {8NSu S<C<@PCPh>؉EƏuu}{8tOS< B;S<,ChS<,ChkS<,ChWS<; CS< t{8tދS< Bj h?She[^Tselection timeoutUVS]{8u S<Cccb = %p P%x%x RL=%d D=%d SS0=%x CP=%p CP2=%p DSP=%x NXT=%x VDSP_BASE=%p VDSP_OFF=0x%x CMD=%x OCMD=%x TBLP=%p OLEN=%x OADR=%x internal error: cmd=%02x != %02x=(vdsp[0] >> 24) phase change %x-%x %d@%08x resid=%d. newcmd[%ld] %x %x %x %x. Uheader.cp%s: int#%d t%d+- (remove)+ restart job .. -- remove trap in getcc reselect by t%d. negotiation failed sir=%x status=%x. sync msgin: sync: per=%d scntl3=0x%x ofs=%d fak=%d chg=%d. wide msgin: wide: wide=%d chg=%d. M_REJECT received (%x:%x). M_REJECT sent for M_IGN_RESIDUE received, but not yet implemented. M_DISCONNECT received, but datapointer not saved: data=%x save=%x goal=%x. queue full. %s: queue empty. UWVS]K8u S<0C<@0E1u S<C<@$EUUu S<CC,FFMAh@F FQlHVF % ЉC,ME4Uf Ft :Fjjh9ÃFMf hS ߁% ‰CFCVCEPhSF^e[^_Ð%s: actlink: diff=%d, new=%d, req=%d UVSu ]VF8v((tCfS Z f9vJ f)fZ (N!8v(ыS ffB Ns 0e[^Ðncr?: scattering virtual=0x%x size=%d chunk=%d. seg #%d addr=%x size=%d (rest=%d). ncr?: scatter/gather failed (residue=%d). UWVS]fE1EhE EPu 1E ߁E% t )ƃ9mE9}wEMu}tPtL%)9v9vEE))ËE ߁E% t9tEuU uU4fEtf} kuESh]rne[^_ÐCACHE TEST FAILED: reg dstat-sstat2 readback %x. UMEy8tQfF9EFEU?8?u?8?t`FEV~wFEfF8E;~8wF8fEfEFE V8F9vЈEEFfEF8EURDu#E}v}vDMAPjEBMAPjD*-EPMQpEUBPjEP EE}Dt%3P EDt EE}v}t ExlkMQ@pMLEPj@Ur`r\,MQe[^_UyhpEPEPEPWU R tPWt#]Sj@v`v\g"EPURWE Pt W!EU;V8e[^_ÐU,WVS}GEEjHp`p\6!EjPMq`q\ !E+O!E!EWZEw,V0u^yG@0tK tFfV+G+U к@⸀ F?$ U^fVVFX9Ӹ MEFF1 ^F?$E+G+UЍBe芃?$ EE E4E}}t+MyluWQpEWMApMLW_EPjHMq`q\_  EPjPMq`q\H e[^_UWVS] URjPs`s\TE js`s\>EmeC|U<u LJYx LJcxEG_~jjjuCPhxE;}t&UuCPh;hEPEPEPWUR t[}uCW t3eEp XjPSV+0E PjPSV UREPWURe[^_%s:%d: bogus intr UWVS]EjPs`s\EjTs`s\E1E;C8}auFuEu u7Et1V荖uWCPh9 EG;{8|Ee[^_ÐU WVSu} jv`v\ۃh|9FhF|FECECECEu҉UC(EC,EjhEPWe[^_pci at %s bus %dUE tPhڪ"Epho"U WVS]} πt${8uS4PS4P /S4BP "{8uS4PS4P$ S4BP$BPjd軯{8uS4PS4P  S4BP BPh舯{8uS4PS4P$ S4BP$BPjdW y8uQ4 1 A4D C~ƁUƁT1[^_ÐUWVSfEE@EUZ8uR48fȍAfEUB4@8HfMu&EP4:f#UBLEPUB4@:f+EfEEx8u EP47 UB4@7]E< f=ltƍFfEUf9UMC%9uʍ)9~hjEPjGPBP,à t4jS$E<)PWSjSÃuUBL)fEUjEPjFPBPà uUBL%EP48Ef8jSFfEfEeUz8tŋR4EfB8sE@H@(t SPnjS@SVUR Qe[^_U WVSu^@fC2~8uTF4TETF4TUE@E%CXTDtPTf}}CPZV4@CTE`t~8tF4@@4V VE@t= 42TJ%(Tfc4U8Te[^_ÐU WVSuE~@~8u V4<1f F4f@<N8uV4>fV4>fF4X>ft tF4fX>ftYt Vt V t V-f}VV Eh~8uV4<f F4f@<t W Ee[^_ÐU WVS} 5@ xAࣀ@pAuj5"hà ËpA5@֡#AtQbtQfC@ xA@fAࣀ@Ћ#AtbCC CfCjjÃu !`5@ xAࣀ@=&Aujj讶&AS t!+$A @ |AC &A5@֡#AtcaC t#CKC(C$C,C0CuS蚽gswjW"GC CWpS ;%<)PCCPaC<C <EUD1e[^_U WVSE8U1X %W4 U4 8Dw4 KȉRWzMQ(tU4R^8aU_4p % D 8bU_44 D4 FDUJ%(UUD<uShW-jjjuVW>jSV@<S?Ph$jjjEPWE f=9t f=tf=`u Ƈ0.f=)tEPURh<Ƈ0UBGvrUVS]up싓p Bp Bpup싓p Bp Bpj0up싓p$Bp$BpjNye[^ÐU WVS]} up싓p$Bp$BpMIt4up싓p EBp 2up싓p$Bp$Bpjup싓p$Bp$Bpjup싓p Bp Bpe[^_ÐU WVS]@E xAࣀ@U BBfB@pup싓p Bp Bpup싓p Bp BpS9jU PSjU BPSjU BPSjU BPSup싓p$Bp$Bpj\up싓p Bp Bpj up싓p$Bp$Bpup싓p$Bp$Bpj贉up싓p Bp Bpjxu$ppppup싓p$Bp$Bpjup싓p Bp Bpj踈Oyup싓p$Bp$Bpjhu:upu@ptU f zj*up싓p Bp Bpj=up싓p$Bp$Bpj訇up싓p Bp BpjlE@ЉE#AEtIu1e[^_ÐU WVS]u =@ xAࣀ@up @pup싓p Bp BpFFup싓p Bp BpSjPSjFPSvjFPSfjFPSVjFPSFjFPS6up싓p Bp Bpj܅up싓p$Bp$Bpj蠅up싓p$Bp$Bp=@ס#AtH1e[^_ÐUVSuj]SHCE CSV~Ce[^ÐUWVS}u j]SHUCCf{SRe[^_UWVS1E؃1t NyG~[^_UWVS]11C4EEu1.EAG@EUB5toMtUPt@@%1&1.t܋@tӋ@U-Pȃ  AEEtPUuȃ}tJMHw:>EEetËptxtUPe[^_US]hjSnhm jSf|jSPjS,]Ð%s: autonegotiation not supported %s: invalid autoneg flag: %d %s: autoneg complete, %s: autoneg not complete, link status good (100baseT4) (full-duplex, 100Mbps) (half-duplex, 100Mbps) (full-duplex, 10Mbps) (half-duplex, 10Mbps) no carrier UWVS}] uEW4U@ jWu&tGPh !E@# ]t/ t zt_qWh@KL覀 m$tƇWUfB2ƇƇEf@2ƇSGPhCvjW t&tGPhaIjWtGPhx#jWÃjW thjWVƃjWI t"tUB( httE@&!ha}}E@& h=@t @tUB#߀hE@# ރhSWfSjW thWtƇƇURe[^_ÐU WVSuF4EjVdž# t$jjh# S蓷jjj#S臷 t"jjh#Pgdž# t8E@Djjj&S6jjh& S'dž& @t,E@Djjh&Pdž&f})E@Djjj(PŶdž(tjjj P螶dž e[^_Ð%s: canceling autoneg session %s: selecting MII, 100Mbps/T4, half-duplex 100Mbps, 10Mbps, full duplex half duplex U WVS}_4tHGPh@ƇƇfC2jWÃ%PjW+GPh__jWÀ王u  uhs4 uh uh߃e } uhhSWSjWge[^_ÐUWVSMu 1ufuG@t6uf틑$fB$fBt4uf틑fEB2uf틑fBfBt3uf틑 fB fB[^_%s: reset never completed! UVS]uf틓̀fB̀fB1j yuff|@f} F~uCPhhye[^UEP fu=C0t,=at%fu = tf3@u u1: failed to enable I/O ports : failed to find i/o space : failed map i/o space : couldn't map interrupt : could not establish interrupt at %s : %s address %s %s: no memory for list buffers %s: MII without any phy! U,WVS]C E@U xAࣀ@hsMQ<hss ƃjss eEjss RE܃jjjVjPV jGPVjGPVjGPVjjVjjVjjV8jjVjVƒUjjV }t*jjVjjV KyJjjVS}ujVGtf _jjVujjVjjV }thjV]E@ЉE#AEt}u1e[^_ÐU WVS]u S@=@ xAࣀ@FFjSx$EthjSQjjSjPSjFPSjFPSjFPSjFPSjFPSjjSEjjSjjS }thjS=@ס#Atq1e[^_ÐUVSuj]SCCE CSVhjVCe[^ÐUWVSu}j]SCE Cf{SV>hjVRe[^_Ðtl%d: autonegotiation not supported tl%d: invalid autoneg flag: %d tl%d: autoneg complete, tl%d: autoneg not complete, link status good (100baseT4) (full-duplex, 100Mbps) (half-duplex, 100Mbps) (full-duplex, 10Mbps) (half-duplex, 10Mbps) no carrier UWVSu EEU4UjEPÃu(}UPh@ҽt{ thjEPhLKjURÀPjEPh@KLKU u ƂhjEPhJjURÀPjEPOUfB2 EƀƀUfB2Eƀ#VUPh蟼MjEPjURà t6}tUPhTjEPS!}tUPhz}thjEPǃjURƃjEPÀ练t2t*UB( }ht,t$E@&!}hz}&} UB& }t]h K@t(@t E@#߀}t-h%UB# ރ}th<ܺtjjEPjjUR< %PjEP}thS腺UREtƀƀUR%e[^_ÐU WVS}!] ujjCWjjCWe } ujjCWfjjWjjCWjjW:jWƁE Ee}u@}u}uKfƇjW] PjWPjWIfƇjW%PjWQhjWA}uB E %=ujjWjjW}uBe } ujjWWjjWPjWW6e[^_ÐUU2BB2B B2B  1‰11ʃ?ÐU WVS} E@p1ې;PPEPiC~e[^_UWVS11]4EfEEEPEPEPE}~jj(EPjj,EP C5t iEJ}EPSEPE4S  ANj]t CEuVj(EP6Wj,EP'e[^_ÐU WVSuf1ېVC~1ېhLjVC~ƆhjV~hPChDjVaV( jVf|e[^_ÐUVSuù̀u1ېj0VCv1ېjjVCvhjVZ} t!uhjV8hjV!th jVj3jEVu/,  8@?tʋʁ t@jjVOhjVcj@jVVj jVIjjVE=Zt4w=Ur4=Vv$=Xt$=tw =t =u 1Ð%s: chip is in D%d power mode -- setting to D0 %s: failed to enable i/o ports : can't find i/o space : can't map i/o space : couldn't map interrupt : couldn't establish interrupt at %s: %sU,WVSEp U BQhEpVr<hUrVrÉ߃jEpVrEjUrVrEjt-Sh=)Sh=E P{e[^_UE@ f=u=0t=)u1: can't find i/o space : can't map i/o space : couldn't map interrupt : couldn't establish interrupt at %s U,WVS} ]s ES$UEPEPjsVV th@G8PjuuEP th@܋UW4EPC1PC0Ps,Vq th@蠋uVrÃGPWh(juVrG00u4h A[tSh+AFh2A6 }ƒhSEPW e[^_US]D?f=D?t'S f;uA9u  f9u1[Ðdc%d: chip is in D%d power mode -- setting to D0 UWVSEU r 8Ej4rVmۃSE pVm <]SU rVmljjE pVemEjU rVQmEj~E8@ xAࣀ@pAuj5"hPƃ ƋpA@ӡ#At!tQfF@ xA@fAࣀ@Ћ#AtFV VfFjj ƃ@ xAࣀ@=&Aujj&AV t!+$A @ |AF &A@ӡ#AtDF t#FNF(F$F,F0FuV{%1uBEPh`RzxMQR%E@T MQ8vEpjP.UBF FMAEFV % ЉAUR$u EMU@MfA EP<9sЋUfBfMy48A8Ef@2@(tURP3MtEH5e[^_ÐUWVSEMBUuf\UBfE;5@ xAࣀ@pAuj5"h; pA5@֡#At t[f@@ xA@fAࣀ@Ћ#At@P Pf@jj;5@ xAࣀ@=&Aujjn&AB t,$AR )‰ @ |A@ &A5@֡#AtB t-BH@(@$@,@0@uP@"u)EPh`R9u;EfU{@ ߁% ‹EPfWUuTw]_ _UB|t WPCG GGWEPV.UEfIe[^_ÐU WVSuKIB73!t f؃t Pf}w fe[^_ DPE APE PTAPMA%s: PCI fatal error occured (%s%s%s%s) U WVS]EK4uS8S8%C8pEt׋C8p tNS t:K4uS8S8C8utC8t-SGutCTPfQ`jS@tmS ujSdjSI% PjSS S Sv jSjS uS8{4tC8@ttYtYPtYPtYPtYPCPhYNqSSS~tt^=vS8@{4tC8S SN S1 Gu fǃEe[^_Ð%s: device timeout %d packets, reinitialization seems we can continue normaly U WVS}5@ xAࣀ@CPh]oSo t&GTh ]oS% Sph@]ot W5@֡#Ate[^_ÐUSUC@% t#B4tS9 ShS1]U WVSE] 8@4jWjWjWC CuC u]C"TC t C&C#Ct CuK uKe[^_%s: failed to init rings U WVS]{T5@ xAࣀ@{4C8@ {4C8@ h{4t~C8@ {4uS8 C8@Iy߃Sv CPh%_m5@֡#AtSS8 1끐S8 OS8 1* %K8 Љ %K8 ЉS8@S8DS8HS8  +{4FK8 % Љ{4BK8 % Љ{4>S8B@{4:S8BD{46S8BHSSSS{4u$Q`uS8S8Q`uB{4C8@  SG4t @$fG4fg4S5@֡#At蒻1e[^_UEtx4u P8`@8H`%s: WARNING! cant reset PHY UVS]hjSEj _1 jNFwjSf|׃jSlf}CPhbGjjjShDjS Q`u:{4uS8 C8@ jS PPjS~e[^ÐUVS]CDpSf t tt  Du ǃ ǃPjSs8pȉ;s8pȉǃ{4tC8HphjSlhjS\ Q`t=h-dS7 u{4bC8HpSe[^US]jSW jSL $ f$u jS5 @jS jS tojS PjSw jS jS u2jS %PjS> jS jS 1]ÐUMt(y4uQ8Q8y4uQ8p Q8BpÐUMf}~y4uQ8P A8@Py4uQ8T A8@Ty4uQ8X A8@Xy4uQ8\ A8@\UEx4u tP8H8 t%s: can't stop Rx DMA %s: can't stop Tx DMA %s: can't stop TX DMA UWVS}4tVG8a1ې4u W8G8@%=tjC~ȃ4uW8W8a멐G8@uGPh:gze4u W8G8@uGPhQgJeWW O4uW8|pG8@_u W8G8@@EeUEe UPEUfE85@ xAࣀ@pAuj5"hà ËpA5@֡#At轴tafC@ xA@fAࣀ@Ћ#At胴CS SfC!W8$jjX à C <E@<C CWTSPsC UBS % ЋUBE@UfB C<9s‹EfPf42G8$1ې4u W8G8@ujC~̓4u W8G8@uGPhhgb W/e[^_ÐUVS]5@ xAࣀ@fǃ{4u S81 C8@{4u S8 1 C8@ S-{4uS8  C8@ h{4uS8  C8@ S)5@֡#At1e[^ÐU WVS1]Uf@@t PONy1]PUff@@t PNye[^_Ð%s: WARNING! rx_desc is misbound or misaligned %s: WARNING! tx_desc is misbound or misaligned %s: WARNING! frag_list is misbound or misaligned UWVSEǀǀǀǀ1UfFu ߁% ‰W G uG %=vEPhl_5@ xAࣀ@pAuj5"h pA5@֡#At襯t[f@@ xA@fAࣀ@Ћ#Ati@P Pf@jjD;5@ xAࣀ@=&Aujj&AB t,$AR )‰ @ |A@ &A5@֡#At诮B t-BH@(@$@,@0@uP uEP%'@ ߁% ‰WGfu1UPfFE ߁% ‰S C uC %=vEPhl] E % ЉCCuC%=vEPh m\u1e[^_USMU Ѓy4u Q8A8P1ۃy4uQ8 u A8@ t fCfv[ÐUEx4u P8 @8@ÐU WVSu] WVpPV`WVVVe[^_ÐU WVS}u sj jWKyߍe[^_ÐU WVS}1jWUt  Kyƍe[^_ÐUVSu] jVV @t؃?  شPV4VkÃjV^Íe[^UVS]E {4t\S8 B01{4uS80u !C8@0tjdF~̃{4uS84S80 뤋C8@4e[^UVS]M E{4u S84 S8B4{4uS80 S8 B01{4uS80u !C8@0tjF~̍e[^Ð%s: cur_rx: %d, pending_txs: %d, dirty_tx: %d, cur_tx: %d %s: COMMAND: 0x%08x, INTSTAT: 0x%08x %s: PRCDAR: 0x%08x, PTCDAR: 0x%08x %s: dumping rx descriptors desc%d: %4d 0x%04x, 0x%08x, %4d, 0x%08x %s: dumping tx descriptors desc%d: %4d 0x%04x, 0x%08lx, 0x%04x %4u, 0x%08lx, mbuf: %p U WVS]CEPhsX {4u S8C8@P{4uS8C8PEPh tW{4uS8 C8P{4u S8„ C8PEPh`tWEPhtW1 1B PBPBPPBPVhtGW F~ÃEPht*W11P4B PBPB PBPPBPVhuV0F~e[^_)mnopP@ & 4JPJ.0US]vhws#S f;uA9uhwr1[Uuu1 ne_pci_attach: impossible: can't find I/O base : can't map I/O space : can't subregion i/o space : couldn't map interrupt : couldn't establish interrupt at %s: %s U,WVS}G E܃WƃuhwThwRPEPEPjwUR thwTEPjuuS thwyTEPjjuSH thxLTE EU EjwEP7 PjwUR.8E ǀ ~t0EPEPEPU RFЋFU FEEEF U EPG1PG0Pw,EP9 th.xfSuURI:ÃE PE Ph@`juUR:U 0u6hHxStShgxRhwR'ShnxRuuujE Pwe[^_U WVS]} πt4(u$$틓$$ E$B$ 2(u$$틓$$$$B$$B$jd(u$$틓$$ $B$ B$h(u$$틓$$$$B$$B$jdpe[^_ÐU WVS]1(u$$ $@$u S(u$$$@$(u$$틓$$ $B$ B$jd(u$$u$@$t u$$틓$$$$B$$B$jdHU(u$$1$@$Ef8e[^_ÐU WVS}fE19}?] EPEPEPz}t EfEfF9|ōe[^_ÐUVS](u$$틓$$ $B$ B$(u$$틓$$ $B$ B$j!(u$$틓$$%$B$%B$jNse[^U WVS]} (u$$틓$$%$B$%B$MIt4(u$$틓$$ E$B$ 2(u$$틓$$%$B$%B$j(u$$틓$$%$B$%B$j(u$$틓$$ $B$ B$e[^_ÐU WVS]@E xAࣀ@U BBfB($@$(u$$틓$$ $B$ B$S6jU PSjU BPSjU BPSjU BPS(u$$틓$$%$B$%B$jQ(u$$틓$$ $B$ B$j (u$$틓$$%$B$%B$(u$$틓$$%$B$%B$j(u$$틓$$ $B$ B$jM(u$$$$$1$p$u$$틓$$%$B$%B$j(u$$틓$$ $B$ B$j(u$$틓$$%$B$%B$j=(u$$틓$$ $B$ B$jOs(u$$틓$$%$B$%B$juB(u$$u$@$tU f zj[(u$$틓$$ $B$ B$j.(u$$틓$$%$B$%B$j(u$$틓$$ $B$ B$jE@ЉE#AEtu1e[^_ÐU WVS]u =@ xAࣀ@FF(u$$틓$$ $B$ B$S:jPSjFPSjFPSjFPSjFPSjFPS(u$$틓$$ $B$ B$jA(u$$틓$$%$B$%B$j(u$$틓$$%$B$%B$=@ס#At]1e[^_ÐUVSuj]S/E CECSVCe[^ÐUWVS}uj]SE CECfsSWe[^_ÐUEP`ÐUWVS1E؃1t NyG~?[^_ÐUWVS]EE{4E(u2$-$6$8;$pG5titƋ$p(tË$@8($@<$81&$<1.t܋$@8(tӋ$@<,Pȃ  EAEEtxu˃}tIG$U (t$@ $U4fG2e[^_Ð%s: initialization failed: no memory for rx buffers U WVS]{45@ xAࣀ@SSfǃ2 (t$@(u$$4txtE (u$$$@낐(u$̀X$̀G(u$@0$@(u $ $(u$틓$%$B%B1ɐ(u$@$D@A~ɃS7u>> probing for %s* %s%d: irq %d already in use >>> probe for %s* clone into %s%d %s: iosize not repaired by driver >>> probing for %s* finished >>> probing for %s%d >>> probing for %s%d succeeded >>> probing for %s%d failed UWVSu d^ UB88B< jdP{dPCPCph 4뚃=l"tCPCph4WVUR@ЃfltMjlPMqDu.lPCPCphijV.{=l"tCPCph7hWVEPXf}tM̸U BHf}tDMҸM AH1=l"tCPCphjVzH[^_nonepulsededge-triggeredlevel-triggeredisa_intr_typename: invalid type %dUEtt.tt )!PhvisadmaUEǀÐisadmaattach: can not create DMA map U WVS}=A1۾AtG@VjRRjRP@Ѓ thC~hFe[^_%s: bogus drq %d %s: DRQ %d is not free isa_dmacascadeUVS]M ΃vQCPhNSHsQCPh`y ‰SHu3{8t SL B 1SL #SP {8tSP Bu{8t6CLP 5{8tCPP%hxSP SL e[^%s: drq %d is not free isa_dmamap_createU WVS]M }vQCPhN[t9v RSHr( ‰SHS@DXPuVWjWRB!QCPhtfhe[^_%s: drq %d is already free isa_dmamap_destroyUS]M vQCPhNSHrQCPh<!!‰SHS@CX4RBhX']Ð%s: drq %d, nbytes 0x%lx, addr %p %s: drq %d, nbytes 0x%lx isa_dmastart: no DMA map for chan %disa_dmastartUWVSuM E Eeȃ} vU RFPhNm] ]etD}w}uUtPMQ]S} WFPh }vEPU RFPhy] ]eVX}u%t AE Ph4F@QuURMQSP@ Ѓ }t9F@x t jSP@ иM 7VL E RF@x t jSP@ иM !{E]D3x}~8tVLE B ~8tFL@ VL VPE VPVL EM ?E?VTVLVLMVLBE~8nVPE B~8jFP@M !}.~8LVLE] ?B ]ۃ~8AVTM? ~8:FL~86FL ~8.FLMUT~8tFLmML+VLBmEVPEM ?{?VTVPVPMVPEVPڃmE~8tVPEM ?B]~8xVT? ~8lFP~8jFP m~8_FPMUT~8ZFPmML}u*~8t FL]X )VL EVPE~8tFPUP1hYe[^_Ðisa_dmaabort: %s: bogus drq %dUVS]u v%VCPh4SL #uK{8t݋SL B {8t CL@ ISL =SP SP!{8tދSP B{8tދCP@S@CX4RBи!e[^Ðisa_dmacount: %s: bogus drq %dUWVSu} } v(E PFPh4VL U UeuH~8tދVL B ~8t FL@ IVL =VP VP!~8tދVP B~8tދFP@}uJۋF8Eu VLB FLDH}u VLBFLDSV8Uu VP FPDH}u VPڃ FPDɁFxU ; u1Ƀ}u*~8t FLP *VL VP~8tFPPȍe[^_Ðisa_dmafinished: %s: bogus drq %dU WVS}] vSGPhu#8u WLGL@%8u WP GP@ e[^_isa_dmadone: %s: bogus drq %d%s: isa_dmadone: channel %d not finished U WVS]u v$VCPhSL 'CX<uI{8t׋SL B {8t CL@ ISL =SP SP!{8tދSP B{8tދCP@VSZuVCPhS@z t&tQWRB ЃC@WP@и!e[^_Ðisa_dmamem_alloc: %s: bogus drq %dUSEU vRPhThtUH@uEPjEPShRQA$Ѕu UE1]Ðisa_dmamem_free: %s: bogus drq %dUME vPAPhEEUEBA@jRP@(Ðisa_dmamem_map: %s: bogus drq %dUS]E MvPCPhtEEEUJC@uuQjRP@,Ћ]Ðisa_dmamem_unmap: %s: bogus drq %dUEU vRPh@@uuP@0Ðisa_dmamem_mmap: %s: bogus drq %dUS]E MvPCPhTe|(EEUEBC@u uQjRP@4]Ðisa_drq_isfree: %s: bogus drq %dUEM vQPh@H4UWVS}u ]jEPSVW upjEPSuVW uJuujkfƒt&:rZEB MJ؂?B؂?SuVWASuVW61e[^_Ðisa_free: freeing unallocted memory USM؂?؂? P@t9Huuh41CsQs3ss s3u Sg]Ðisa_mappage: mapping unallocted memory UU؂?@t)9Put juu pp p0hbt(bt probe)%s: bt_cmd, host not idle(0x%x) %s: bt_cmd, cmd/data port full %s: bt_cmd, cmd/data port empty %d %s: bt_cmd, host not finished(0x%x) UWVSE }UUEtEE N} uE}t> Nj2NtUtuPMQh0:tUBUumrmuj2誀NtUu1}t}tMQhp@UUBMAMmsrkuj26NtUt-}t}tWMQh>@UmMEUBˆs}tJ Nj2NtUtuPURh U1e[^_US]jS uǃhǃ1]Ðbtattach: bt_find of %s failedUVS] uSV tCPhF|C@CHtP5A S'S ǃǃ$f ǃ H?ǃX?fǃCPShjjsDvrC< jhPShe[^Ð%s: mbi not in round-robin order %s: bad mbi ccb pointer; skipping %s: bad mbi status %02x; skipping U WVS}d{u@1Ґ{u"T9u\B~GPh0cC C C RWXƃuGPhp6C}2t u du5PGPhVh(bVWx CT9u \{?de[^_ÐUVSuN@QÄ|1J t-EfEfEjjEPjVQVt Vwe[^ÐUE ǀdÐU WVS}] 5@ lAࣀ@SWPtPT PTPu P5@֡#At=e[^_ÐUVSu] hlS> ߁% ‰\|h X SVe[^%s: can't malloc ccb btccbU WVSu=@ lAࣀ@t6PtTTTTPxKjjhl\ÃuFPhLFSV'E u%jhjP艧Id=@ס#At_<؍e[^_ÐUM |UhXt9\uUMU ǂPTPQIÐUM\HT9uQ\~ztՉ\ÐUWVS}G@E`"~CW~.EfEfEjjEPjWEP/PtTT TTP ߁% ˆVVVdtFFUB`@u2h `r"Mb)RSh(T9uw\`e[^_Ð%s: exiting ccb not allocated! should call debugger here (bt742a.c)%s: host_stat %x %s: target_stat %x U WVSE `du!EPh!h{,U zt)Bu C,PEPhVM yt_At t!+{4u (C,9C,.PEPh'C, C(E PURMKSte[^_bt_find: illegal bus type %c bt_find: illegal drq setting %x bt_find: illegal irq setting %x UWVS} Ep|jd[uhCuKtP<0uh'uj]S8EEEPjSjWV EEt.~MuAt}FtPhHڐfE@fEE]EPjSjWVFC <@thtE UEPjRjWV0E t) tt4@t=t &)1$ PhpjEt7 t t#I t3 t$:@t+1 = 5 - %PhtE$Ãw@WDOHSEf8t89tx]f8Eft9tNUf@4A@1e[^_3.31parityno paritysyncasync%s: %s, %s %s targ %d: sync, offset %d, period %dnsec ULWVSE@@EċuS@r-EʏfEʀfEʃjjEPjURMQ E EURjPjEPURE EuEPjVjMQEP ELtER[tVR}Wha!1ۃUΊD3 C~MyS2~!ĚEERjPjQEPF 1ېD3 },€upt!D+΍PPSWhp C~1ۉUDcƄcC~\M\\dǁE؁E % ЈEEEE݃jjEPjQURse[^_542B: model BT-%s, firmware %s U,WVS]C@ECSEEUEPjRjSEPECSCT.ECUEu}WjVjSEP@CVSWE <2 <3u.}2v(EWjVjSEPFCWSX J;Uv B< tt}2EEUEPjRjSEPaECLECMECNECOSP KLJ9v B< ttEBEBKLJ9v B< ttCLCPCSPCLPhne[^_ÐUEx<~@<PXÐ%s: bt_scsi_cmd, more than %d dma segs U,WVSE@ EP UE@EPR ƃuUB,E`@hUt F,Ex$UBFPFPrUB$OVHUEEE@ E ߁E% VL1 BBB}tN%E)ȋ]9vÉ)EE%E}t ߁;MtBBBBE}t+} ]j!EPhPE %e EVFBBBEVFBBB&FF@@@FF@@@fUBFBFV( % ЍV$F$BBBF FFFF F @@@@ lAࣀ@VEP@ӡ#At.Uu1ohEPUR^tJVhEPUR8 t$VE@,VURe[^_U WVS}]w@t9V} WE @t1hOkKuɸe[^_timed out AGAIN U WVS]`@ x P'h6 5@ lAࣀ@dth 9h&`@,ǃhdSW 5@֡#At*-e[^_U WVS]sEPjj s|VL t18uVǃj uV Qtǃhǃ e[^_%s: could not map I/O-ports U WVSu ]{EPjj s|WL tFPhNZ~@EFDhjFPVh jj8Ps]F<$Vme[^_aha(aha probe)%s: aha_cmd, host not idle(0x%x) %s: aha_cmd, cmd/data port full %s: aha_cmd, cmd/data port empty %d %s: aha_cmd, host not finished(0x%x) UWVSE }UUEtEE N} uE}t> Nj2gNtUtuPMQh.tUBUumreuj2gNtUu)}tMQhX@UUBMAMmsrguj26gNtUt)}tWMQhD@UoMEUBˆs}tJ Nj2fNtUtuPURh U1e[^_UÐUS]1ҋ @9}C|94At4B9|jjS uǃhǃ1]isapnpahaattach: aha_find of %s failedU WVSE] UU@ @p7tP5AVSEP tCPhXUB|C@CHtuP5ApSS3 ǃǃfǃ?ǃ?fǃCPShjjsDEpYC< jhPSʰe[^_Ð%s: mbi not in round-robin order %s: bad mbi ccb pointer; skipping %s: bad mbi status %02x; skipping U WVS}Wd;u:1ɀ;uB|9uZ@A~GPhKSA A RW ƃuGPhe }+tu uEPGPhXF,Vh ƩPjhVJaVW0WdB|9uZ@;8e[^_ÐUVSuN@QÄ|1J t-EfEfEjjEPjVQVt Vse[^ÐUE ǀÐU WVS}u @E lAࣀ@tPjhV `KCAQRҍKCAQ!CC@@CC@@C€SMQ$ЈCQ$ЈCC CCC C C @@5@ lAࣀ@SEP_$0GjhjS@t⃻t>UtPw$w }OPw$w "OSMQWI 5@֡#Ax5@֡#AtZEu1dWURYtBSWMQ6 tSG,SEPe[^_ÐU WVS}]w@t9V} W_E @t1hOKuɸe[^_timed out AGAIN U WVS]5@ lAࣀ@PjhSM@ x P蘭h| th 9h {@,ǃSW 5@֡#Ate[^_UWVS]1hhVwStxPjjs|R 10u}C|URjjS|RP0 utCPh c0]ÐUEj}Rjuu誺1ÐUÐUE71UWVSu }_f8t&W|tuEPjj RS- t1oEPjjuS(3 u>E EVV0t LJ j uS1e[^_ %s: can't map i/o space %s: can't subregion i/o space NE1000NE2000NE2000 (RTL8019)%s: where did the card go?! %s: %s Ethernet %s: couldn't establish interrupt handler UWVSu EXh1}}}EPjj Ur|S+0tFPh跻EPjjuS1 tFPh脻XU Et ttuU HU tIM ]ǁǁ$$ǁ\!ǁp%ǁ%ǁ&ǁ&ǁ`UhhA @A4  E Xtt}uUU EX}tEڀʀP}uU u E@ t}t/EX7}uU EXtUQjh?U R jjjM Q!5tE PhLOE uM E t-uM Bj<E Xt)}uUU mUB B_U  t(}uUU 8UB B+Mf8uEPE Ph0CI] SU Rh@`jjM8PqN0U  uShPe[^_Ð%s: failed to clear shared memory at offset 0x%x UWVS]EhUt6}t 1f2Ef"MEB}tM򪐐t+1;MsE}u 1f1fu3;Mr"1;Ms}u11u A;Mr1QCPhƬut,uBj:e[^_we_write_mbuf: negative lenU,WVSEEUUM IMEt2u M BEu @M @jO9Eu`} }}U rJ }u BM I ME E uKUUEf7EfEfEE} U R UM Y}tVffu fuCM}tEUf4EEgMMf␐ff(MMee}}M}tщf]EE}tECE}V}}h>!藥U U }tE}EMUf MuEUt1uMEBj87Ee[^_ÐUWVSEfEE U;dd+} f}߉ًEtKUt=} 4}t }f:}ff'}BU 4}t}򤐐Ef)EUlU ]]ً}}UtK}t;U 4}t }f8}ff'}B} 4}t}򤐐E [^_ÐUWVSEu }t/օtf*ffBօt򤐐[^_ÐUS]t.u  Bu @ @j4S7ut,uBj4]ÐUu.1ÐUU E@@BÐUUpRÐUWVS]} XtguQQ Yt AuQ A u  Q  $t A t$YHuQIu!Q!ȉt鋃H[^_WD8003SWD8003EWD8003EBWD8003WWD8013EBTWD8013WWD8013EPWD8003EPWD8013WCWD8013EBPWD8013EPCSMC8216/SMC8216CSMC8216TSMC8416C/SMC8416BTSMC8416TUWVSu E1ۃ}u VE VUE*$())*)******************************))))**$*$**'J'>(2(&(V (N}u Vu Ft@((1(:(C(M(@h(}+uW(}uVV ^}t F}uV F 0t%t/B t0u70&@V (}+uq( }t݈^]1Zt"}t}uVFu1ۿ }tUE}tU:}tE}tEU[^_ÐUWVSEu }MtAt+օtf)ffBօt򤐐[^_elink_reset: can't allocate state storageU WVSu] }=Ȱ@uİ@Ȱ@İ@t 9ztoujjj ƒu&h+Ŝ===zİ@t İ@Pİ@Bİ@ttte[^_UWVSuM ]t}0 Ou[^_PP0 ecU,WVS]Es{EEEC|tY\tN1;,tBw ;,ut/1ҡ,t9tBw,t9\uu 1VEPjjs|V EEPjjC|PV EEPjh \W Eu UE@tvЍBulu,9C|uVu UE@t>ЍBu4u,9\uǃǃh E}tjuVt}tjuV]}th uWCEe[^_ %s: can't map nic i/o space %s: can't map asic i/o space %s: can't map shared memory 168%s: 3Com 3c503 Ethernet (%s-bit) %s: configuration failed %s: wildcarded IRQ is not allowed %s: invalid IRQ %d, must be 3, 4, 5, or 9 %s: memory test failed %s: can't establish interrupt UWVS] h/EpxEPjjUr|V 0tCPh/远nEPjjUB|PV tCPh3/胜2EPjh E\W CPhQ/CUUUUU!#PU'U+EE Eǃ1ɐ A~1E@j2)#E@h(E@1ɐuUU9A~̅E@U!UPUuPUu,EPtǃU!Fǃq/tn/P{Wh|/)tU!ƃ\ HtI]ǃH6ǃ9ǃ7ǃ$;ǃ;ǃ;ǃ`ǃh j$jh?SStWh/膙5toC @tfǃp fǃpfǃfǃ  f`l\U`UBcfǃpfǃ fǃ&  f`ltUtUBU8@ wW$485L5L5L5,50545L5L5L5(5| x@tpWh/FU8PWh/'U=U =U =U =U =tEHtE@ tE@ tE@ tE@ StWh'0芗My1Ґ1ۉ]MtEE}~hAB~ȋtApA Ћ lA xAxA |A ӉtApAhAAE1M㋖!AtB hAR u@E}~1EU<!AtE}~=~ У\r"\r"!\r"[^_U1intr_alloc: bogus typeU WVSu }uhNz}1Ƀwftas\p@tJ t B: E1HE;u#1ۋ!AtC@ ut9]~ω]A~t E81e[^_ÐUE Uw7t2t.p@ }t t t1Ð%s: isa_intr_establish: can't malloc handler info %s: intr_establish: bogus irq or type U WVS} u=0p"PjjÃuE Ph\Ow tuE PhOi}1p@ tt " 4 ;4 t t1d!A!At p @ uE??EECCC EC{E C؍e[^_intr_disestablish: bogus irqintr_disestablish: handler not registeredUSU Bwu hPw!A!AH @ t9ut @ hP{wjR!Au ǃp@]Ðisaattach: ISA bus already seen!U=4At hQw4AUWVS] SEPuuuE PEPVǃ 3FEE= )AvEt  @;FvMFEEPjEPoÃu >EPS?E^tEtPE PVEPJǃt#~tjvbVEPe[^_U WVS}] st SWjVSWe[^_ÐU WVS} w(AEPw wEPEP u%EPEPEPEPWEP`)AuEPEPWEPOÃukEFEFEPEPEPv WEP à tGu WEP EPEPEPEPWEPÉ؍e[^_Ð_isa_bus_dmamap_load_mbuf: not implementedUh\Tit_isa_bus_dmamap_load_uio: not implementedUhT)t_isa_bus_dmamap_load_raw: not implementedUhTsU WVS}u ^tFu VW#VWe[^_ÐUE U@t r4u/t*pp p蛮tppp 肮U )A=vRju$u uuuuu uUuu uÐUuuuuu uÐUuu uiÐUuuuuu ulÐUWVSMUˋEE]E E1tB EiaE@9sSSEP[ w̅t"9t EE9E}t1ׅ}uׁ9r1e[^_U WVSE XUSURSRp{Wp hsEP<ƃ u$URC PssWEPxƃ t#sWURCCC ЪAe[^_Ð../../../../arch/i386/isa/isa_machdep.c%s:%d -- Already 0! UVSuE XЪAuhehWhX?uHЪAss VsCPVsCC#e[^ÐU WVS}UAp@EPӃ؃Pu1t Ph@tPE PVFЃ t1jSjE PuuVF Ѓ tuVF1:1ۋU;Z}'1ɉTU D CU;Z|ۋEG@e[^_ÐU WVS}Ap@_tSVFЃSVFGe[^_ÐUUA@@Rx t jRP@ UUA@@Rx t jRP@ clock_batteryROM_cksumconfig_unitmemory_sizefixed_diskinvalid_timeRTC BIOS diagnostic error %b UE$pqthZPhNZrÐUS4C`r"4}@4}@[ÐUuUU pq@u1R7UC@@ ‰ÐU WVS]ƃxF4@BÉș=`r"Dž~%9~ )))))΅[^_ÐUÐU4C@@ HuT¹)Ѻ Й &AÐUVS1Éփh@B91) jh@BRPAe[^clockrtcUt&A&Ah?\jhZjjjjBhE\jh[jjjj&) pqB pqÐUM pq|! pq|1҈pqB ~1ÐUSM pq؀ˀ pq1ېpqC ~ pq pq[ÐUUBÐUSMgfff)ˆÁ) ˉ[US1ɺpqB-~.pqز/pq9ȉ[ÐWARNING: NVRAM century is %d but RTC year is %d WARNING: Setting NVRAM century to %d U WVS}EEEU<=?5@ Aࣀ@t 2pq1ۉ5@֡#At<SoÃ;]WSh]n=?}u{usEPh$^fn@ Aࣀ@URƒ2pq@ӡ#At"蕾u=?u ?e[^_ÐWARNING: preposterous time in file system WARNING: invalid time in clock chip WARNING: RTC time at or beyond 2038. WARNING: year set back to 2037. WARNING: CHECK AND RESET THE DATE! WARNING: file system time much less than clock time WARNING: clock time much less than file system time WARNING: using file system time U@VSu2h_k@K TA@ Aࣀ@EPt,@ӡ#At h_kA@ӡ#At޻u]ЈCuCuCuEӃuE҃uPfEЃ0f=v0h$`jfEhd`jh`jS¡lr"+lr"PA=pr"tPAPAPA9|-PAf 9~,h$anjhdaaj h`Oj@ @5PAh`#je[^U@VS=@i@ Aࣀ@uVtj(VB@ӡ#At1lr"+lr"=pr"t]SPA)PCPOE؃CP?ECP/ECEUйdf1fP ECPECPE@ Aࣀ@V_=?~3Ufҍ))Pƒ2pq@ӡ#Ate[^ÐUt&A9Eu) pq & pqÐUE pqÐUE pEqUWVSE0E9}mEuBEQ)9u)9E}t En EmC9|1u=Q)ڍ9u)ٍ9t MyvEUB~1ҍXDeMKuUBMLMIMAЉ)Q)A[^_ÐU\WVSuj0EЉEPhDeNE.‰)ЉÍ))Ɖu̍K$I)‰)(U JqlEuBEQ)9u)9E}t ÒÓFEuFEQE)9u+M9Eă}3m3U f2EuBEQ)9u)9E}tEU;]|11ɐ+F;}E HÈXųEU E)‹M Q))E̺EUE)ˆQ)U(ˆQe[^_npx6,@P X60@ϐU,WVS]8p XE"LUMUMj jjjh iPjjjjh iࡔ"P=\r"8 У\r" \r"!\r"桰hj $"ǃǃhh7}fE}U%?=?upUm,@,@0@0@t$@%,@t$@$@fǃ8$@1 "=\r"\r"!\r"桡"M] \M]艈]SЍe[^_D$D$j$X : using exception 16 : error reporting broken; not using WARNING: Pentium FDIV bug detected! UVSu ]$@ttMt\vh#ka $"FPjhljj8PsF0 2h%k_ahHkKa$@; $"h/h@t hk a "e[^Ðnpxintr: p = %lx, curproc = %lx, npx_type = %d npxintr from nowhereUS] `@t"At =$@u%5$@5ܞ"Qhlb`hl[=(@$Pxpx*BBlBBp; ܞ"ugC4u\C(Blt0t$tt 1Ҩ ts0RjjQP jQ%]ÐUU=$@u 1$`t,uZ ,`@t!9t(@$pxHt(@(@`@-Ѕ?=`@t"(@$pxHt(@`@$`xÐU "`@$Ht`@ÐU(@`@$pxHt(@ "`@UVuM F1F^Unimplemented FPU Opcode at eip=%p : %02x %02x (%02x+%d) /%d USܞ"$$Eܞ"$$@PޗÃEPܞ"$$h@o]v؃P%PPhko؃Ph{or]j]EmptyNaNInfDeNormERRORZeroValidAt %p: %02x /%d, mod=%d rm=%d SW: b=%d st=%d es=%d sf=%d cc=%d%d%d%d ef=%d%d%d%d%d%d CW: ic=%d rc=%d%d pc=%d%d iem=%d ef=%d%d%d%d%d%d st(%d) %c .0000 0000 0000 0000 st(%d) %c .%04x %04x %04x %04x e%+-6d Whoops! Error in errors.c %s [data] %c .%04x %04x %04x %04x e%+-6d UVSܞ"$$蓕Eܞ"$$@PuË ܞ"$`}Nj$ B|EP$$hOp [v؃P%PPhko ؃PP؃Ph\pZ ܞ"$@|$P$@|P$@|P$@|P$@|P$@|P$@|P$@| P$@| P$@|P$@|P$@|P$@|%8 P$@|PhpY4ܞ"$@x$P$@xP$@xP$@xP$@xP$@xP$@xP$@x%P$@x% P$@x% P$@x% P$@x PhpY1@ܞ"$Cw$ttt,u,utttWu+;t-PVhqEC@PCPC PC PCP+;t-PVh@qhX hqSXC4ԅ?hq8XF#A@PA%PRA%PR+=At-PhqWA4ԅ?hqWe[^ÐINTERNAL BUG in wm-FPU-emu version BETA 1.4invalid operationdenormalized operanddivide by zerooverflowunderflowloss of precisionstack underflowstack overflowFP emulator: Unknown Exception: 0x%04x! FP emulator: Internal error type 0x%04x UVS]1f}"ܞ"$H|Jܞ"$ Z|$BxЋJ|!Ȩ?tɀJ|`tuܞ"$`}ܞ"$@x!ب?uuU1ɋ? A?t!9uH&A@ܞ"$$H&AB<uR<u0?f H&A?A??AQ ZR4PBH&Ax} #H&A8u @Gx}@ܞ"$$H&A܊?f H&A?A??H&A8tu @} lH&A@ܞ"$$H&A?f H&A?A??AQ H&AH&A:B|^uTz uKzuEBܞ"$$H&APB= up7H&A@ܞ"$QH&Axu!@ܞ"$=H&A7%@ܞ"$=H&AWe[^_U,WVSܞ"$@S "A%;H&A ǁz| {} 5ܞ"$P|UHxM@x?H&AS!uh?EPS5H&Ah?EP5H&AS(uVth?VVh?th?VVh?stuܞ"$MHx$UP|EfECEUCS !tuj&tuSS5H&ASt EuOH&A8u%?f?C??h?Sh?h?K{} b}H&A8?f?C??9H&Ax} 4?f?C??CS U MH&Ax} H&A8uE܊?f?C??CS H&A@ܞ"$?f?C??CS EFu?U{} (uG?f?C??CS M H&A@ܞ"$ye[^_ÐUh =ÐUj(ÐU WVSܞ"$@K"AEH&Ax| {} Pܞ"$x|px@x?H&APPtSuܞ"$px$x|h?SS5H&A?F} ШtjS=}Mu{} H&A0H&AfH&ABCBR CS uSNSS5H&AW}u]H&A8u3@|Sc= g3Ex8E&uoH&A8uEx|x uxtSx} z3xVSS5H&AW}uSS5H&A:y}uSS5H&AXH&A8tu S;{} uA ?f?C??CS H&A@ܞ"$e[^_ÐU VSܞ"$@Krx"AH&Ax| {} 8{~Y;u\uH&Ax:0H&Ax} u.H&A?f H&A?A??,H&A܊?f H&A?A??AQ H&Awut$tu ;tu:ugSuCu{}W-Pu;tCt>u5H&A)u utH&APSP e[^U4A?U4A$?U WVS}ܞ"$p,}EUfEEj h?SEP[ UJUEfVEUFV V>51e[^UWVSƅEXxu$܊?Uf?B??1ff|1?Uf?B??MAQ f}Ex ƅMAQ EUf}!PEP=}EUEU؃ډEUEuV74MAQ EUPEP~= }EUEUEUMEUBh?REPV8MYMAQ EUP]S=}EU}WSS uVWWfEE jh,?V]S_ SSWfEE jh?VEP3 U؋M+UM̉U؉M܋EfEEԉEUM]Sr h?SEPSW:fEuEPh\?WPV;h?URVS th?MQQh? h[^_US]jCP;KC]UMfiftQÐUMfQi) ftQÐUMfQi) ftQU|WVSExEP 4v)GEEh?EPURh\?6EMAE؉U܋EE܃}} E܋EE؉EE܉EEEEP"EEh?EPURMЉMQ?6E Eȃ E]SuVVSE jhd?SEE]SfUUEMQ0}t.܊?U f?B??M AQ EEE}t;MAQ ؃ډE؉U܃EPq0h?URMQRZ EPL0EEEh?]SURMQ h?EPPSt7 h?U RMQS4E P/UM SVSMEEEEE9EvSIMEEf} u Dt=}EE Et+}}SE]U]f}GO߅}ۉ1ftFEt@EEPft'EPtMffGfuۋUJ‰UEM fQEUM AQ Q.x[^_UlWVS}Eh?uVh\?WKE Et h?]SVh\? h?UURSWaEEă | }̰vE PV>EfEMĉMEȋỦEUQ]Su7uVSSsVjhd?V]ЍEPEEES-h?SSUR5 h?E PSUR1E @U1e[^_UVSuM ]1EE!EUaEUUF!EUUFaEUEtEUu3us[^U\WVS} EPxu+܊?f?G??GW %MAEA Ef}!PEP6}EUuVEPP ]SVVfEE jh?SEP^fEEjh?S]S@SSVE)EȋEE̋UJUċEfWEȉGẺG W , h?WMQW*h?WEPW 0G |%w  t hɷGe[^_U|WVSEEHxu.܊?U f?B??M AQ Tf|:f|] SY8EXP X P6+UJE]CS EUf}!PEPi4}EUEEUUREPPLMMQ]SS8fEE jh?EPuVfEEjh,?URMȉMQt]SSEPU؋M+UM̉U؉M܋]K]ԋEfE]UM}W6* h?WURW(h?WMQW3.fEE jhE 2fFCFV CS   U zu3u~} 蹵fFCFV u_t.uE x} yuwfFCFV ]U 8ufFCFV ?S77u1u~} uM fACAQ CS e[^_ÐUWVSu]}VE @E EU RUN)u/M A N )u"FEM Q9ȅu 9UsEU UP t~WSM QV-uD}u} ܊?f?C??CS WSVE P(-zWSM QV)fWSE PV)Rt}uSU RV迱4}uZuAM 8fFCFV CS  ~}^u;}uE x} U fBCBR uS}t}u+M y}βulU 8u S趱VfFCFV CS <}u4u~} 耲uM fACAQ CS 3e[^_UVSuH&AKV4u>uE~} ,>uu {}(C<umw8u~} 辱H&A8uLuO:t1'u<wL{?-{t ~u,C@t ~uF@u Dj2H&Ax| ~}t H&A:tupiFQ)‰Ѕu)F Q )‰ЅuYV9u 9s~9u$}9ue[^US1ۃhA`t@tjM+1Ft~"tt@Eܞ"$b}$ X|]ÐUS1ۀ="At$ܞ"$Eu"ܞ"$`}$H}EjA;P `tQ@t9ܞ"$`}$H}Ejaܞ"$@x\ܞ"$@xGt~"tt@Eܞ"$b}$ X|]ÐUS1ۀ="At$ܞ"$Eu"ܞ"$`}$H}EjABP`tV@t=ܞ"$b}$H}E}ujNܞ"$@x]ܞ"$@xGt~"tt@Eܞ"$b}$ X|]ÐU4APU4APtH&A@ܞ"$ÐU=4At ^jntNH&A@ܞ"$$H&A@ܞ"$ÐU4APU4APtH&A@ܞ"$ÐU=4AuajtXH&A@ܞ"$$H&A@ܞ"$迡UVSuܞ"$K؃zt ͬ<H&Af H&AFAFV AQ ܞ"$`}[^ÐUh\?qÐUhl?YÐUh|?AÐUh?)ÐUh?ÐUh̊?ÐUh܊?ÐU4A ?UVWSu] }F CuJ~ 跪 { 衪 G8 VC)ƒW ~t{uWSV菨W\~u&{t{tk{b5 +S{u~tW2P`k{u~ug~^ O{ FGFGFGF G 8 u8ue[_^GU WVSAS6ƃCP6ǃS65A=A࣬Af=A} AAA%Au8A Au A| j*AK=uAA?A=u=Au AO| jޥA7A%AA|j諥hAe[^_ÐUVSACP~5ƃSs5à } AA%=~9uuA?AA?A=uAu= A܊?fA?࣬A??ࣰAA Apj覤AA  Ɖ5A AhA,AA  Ɖ5A Ae[^ÐUS5A'4Ã} AAuA A܊?fA?࣬A??ࣰAA A%}=j蛣AAAAhAm~CuA?ANA?AAA%AAAA]ÐUSAS2ES2‰U M u2܊?fA?࣬A??ࣰAAWuv A]U]AEUAAA?AhA]ÐU5A$2u1܊?fA?࣬A??ࣰAAH~ A AAAAAhAU5A1u0܊?fA?࣬A??ࣰAAJ~ A AAAAAhAoÐUWVSAE11EEEPX1Èƃ؃ƃMyE P1 A u7܊?fA?࣬A??ࣰAA A,5A=AA?AhAre[^_ÐUWVSAEH&AZ?"A~&j輟ܞ"$@xs~{j艟H&AfEJMBR EU=@MEP t& PCܞ"$@xu11ۋMujܞ"$@xt11H&A8Jr <u111x<u1ɾf<uJr S<u0jA芞ܞ"$@xC1ɾjZQEP/VEP/ PEPR/e[^_ÐU,WVSAE"AH&AfEBEEBR EUEE== j襝E2EPƒtV}u%}uH&A@tR`+RLܞ"$@xu1]u}1ɡܞ"$@x% =t; tC=t17 ‰ у}t }uс}tKE=v0EuEE@E=?J@EEEM U ց}~%jܞ"$@xu3E% <u 11<u 1۾<u@H&AH P  ց uj薛/@<ut̀PEPE E E E E E E E E E}菚e[^_U WVS}u ]2EOVuuSVW`OJu ~| u} 觏܊?f?C??tuSVW菍u/t4u~} Du_fGCGW @uFuS6u} ufFCFV CS Ee[^_US]S C x$u t31k ʃ)KS C{@}"{~[CCS [S袎[ސUS]S C xu tlj1k ʃ)KS CUVWS}G _U MM"-?,?΁Ft t7 thtt?uS?tL u&^r)u u ut*%1,? %1,? t5 tctt?uN?tGف u#فr&u ut$,?rف t|,?m t. tMtt ?u8 u=?t- u2rut,?sG t,?-?=,?t%=,?t%@9GG _[_^P蓋XP躋X-?QOك@sK sO 1YO 1 ˉډ1Yy@uO1  ȉ11YUG11Y?G`-?,=-?tb u t41ۃo ȃ)O,?Pj$XXP賊XPjXXGW_PjXXUVWSu} ~ 螊  舊 ~N+O} ^F f_G }VW1f s ?f@s t t1"ډ1fAs t 11^F ssG[_^UVWSu] }F= Ɖ C= 诉 {uJK V F9H?r)D?1@?1H?tGD?@?F4?F 0?18?\?X?T?\?X?X?\?σ)X?\?уσw+ r,=r= rP‰}GM }Ӊ x u u 1ĸ뽃։Ӊ x u u노{qpccomUSMu1R|HP~/˸ P}؃[UVSuM tMAtˀjSSW> F8tP{[v8L\ Vh Vh 1e[^_ÐU WVSuU 1@ tAࣀ@tt ?-7F^@t )ttVdž@ӡ#Atde[^_ÐUWVSU;?} ?€Vpiu u WWE@ЉE#AEt8Jiuf| FpzU@ҡ#AtFhVUR"Ѝe[^_ÐUWVSU?C4ESPUs8Fp uUKFhu V"Ѓ=@ tAࣀ@Fqt.Ce$Ce}tUB`r"PSh — S7fpCi=@ס#AtV$1e[^_ÐU WVS}w4_PO8Gf$Gft_CtPC@tG_u Get-CtCjdPu/,SSЍS묍S랐SjdPtCG\t_!|`S S S u?tCtCtCtCSStCe[^_USEHeHex4uXPȉ@PH[ÐUU?P8Bhuu R"ÐUU?P8Bhuu R"ÐUE?@8ÐUE¨tÐUWVSu U?{8C4ESPUGhURURURVW"Ѓ EPUREPVW. p]t@w9yt wxt zt th{t tLktwjt@\t^lttxmttlCf @Cf}Cf$Cf}zUBCe ChCe}e_Ch"CeCe}WEceE0s CeCe}?!E0S"CeCe})UB0Ce!tCd}@t tDt΀}uE@u UBtE0S_Ѓt t t U1E2PUB0Dt UuC^@ttttC_KFU:U.U"UU U1e[^_comprmUWVSEPl?1> 6A  ډQl4> C??9|ǡ 6Al@輊E Pjhl% jjU8Pr`/U B0 jjEpU R ue[^_ÐUU)Ѝ 6A1U WVS}Eҍ)Ѝ45AWÃu Mǃ& ǃ) {lCp t$E@xttCpS&ǃ"+ǃǃKǃǃ%ǃ%PS S`7Cp Cp uEChSW"Љǃ}ua@ tAࣀ@fFffF)f ~Puffǃ@ҡ#Ate[^_ÐUVSMҍ)Ѝ45AQÃt4Chu S"ЃS% ƆV/1e[^UuƒtBhuu R"ÐUu{ƒtBhuu R"ÐUu;u1ÐU WVSu}VÃu EPWURE PV2 |St‰uWURE PVT}\WURE PVk{}FChURWURU RS"Ѓ }EPWURE PS}e[^_ÐUE =w  ÐUS4@ђf=Ȍ?j=KÃte@?)Ѝ<7AtI;ul@PhPj"Ѓ%l@PhPPC"Ѓ;uۋ@ tAࣀ@f=Ȍ?u4@@ҡ#AA7]Ðpcvt: keyboard buffer overflow USEđ=I?j1Ju </EEEEEEEEEEEEE` Ȍ?f~hL% j\]?A?@ tAࣀ@Af Ȍ?@ӡ#At=?~ ?d,}uO=4@uF@ tA@4@jjh\$ z@ӡ#At'E]ÐU WVS]@ tAࣀ@֋Cp{Huu ΃ Cp@ҡ#AtE>Sl)Ѝf<6AthizMHClPVjW]hWCHP >ƃu@ tAࣀ@֋Cp$ CpjShHy9CH-Cpt$CpCHPe􍃈PX5@֡#At[^_Upcvt is not in cdevsw[]US]1ҋ P"9}"=" t1(B9} " u;P"uh=( _SC]ÐU9? U} ujjjh( [jjjE P[ÐUVS@ tAࣀ@jFƃ@ӡ#At证> t e[^USE I?u6@ tAࣀ@j@ӡ#AtV]ÐUSME XP$@(1[ÐUVS1۾=AjVS踀CvIAhVh=A Cvލe[^U WVSC?D?X+AAEt }}B P &t f t P #CG0?,? u1 f  P f7) AAP PW 5@ tAࣀ@ t$  P8,? t  P75@֡#At,? u* f t4 P 0?&APRaS1e[^_waitvtUWVSU }]Mɍ)ȍ45Av Zs0?c 0?$ =117A F~#@?@5HPdpNt@?9uz=@ tAࣀ@5@?) AAjhU h@APH.Ã@?9ut=@ס#At}v=@ tAࣀ@1@?9t@) AAjhU h@AP-Ã@?9tt=@ס#AtSE>E2PUB0u =A A?<t<t tG ƒ Y;5,?Mjj@?P4   ;5,?jj@?PSWhKEP@L -|)9 ;5,?u S tHɅn`r"Mb)R4P;`r"}Ph7t ƉuSEPh KURHWSEPhK@EP1Åu< "':; Ll Kk JjHhGgFfDdSsAa|\}]{[PpOoIiUuYyTtRrEeWwQq +=_-)0(9*8&7^6%5$4#3@2!1~`dfUE=K?t L? Ppcvt: kbd led cmd timeout pcvt: kbd led data timeout pcvt: kbd led cmd not ack'd (resp %#x %#x) U WVS5@ tAࣀ@,?     ;Ԍ?tzԌ?h-t h[_ JǃS t hv_ )ou=uԌ?PWh_ m5@֡#At`e[^_pcvt: kbd tpm cmd timeout pcvt: kbd tpm data timeout pcvt: kbd tpm cmd not ack'd (resp %#x %#x) UVS@ tAࣀ@E،?ht h` F_ƃ5،?t h` 7u=tPVh` k@ӡ#At0e[^ÐUSddthYKuIEEEEEEEEEEEEEd1]ÐUSddthKuIEEEEEEEEEEEEE`1]ÐUSduhaKuGEEEEEEEEEEEE`]U}u;?=?YH@j5d+A u ٜ?4$ˆٜ?wuٜ?ug ٜ?]Zu#ٜ?t~$<uBٜ?7uٜ?4$ˆٜ?|u ٜ? t=>?u#:؜?uٜ?u1É)? f}D @D% ?$xu v Tv lv v v u v v v v v v u ٜ?:؜?,? ٜ?:؜?,? ٜ?:؜?,? ,? uo P\ٜ?4$:?Fٜ??>?,?     X3LSP?S3SPK#3jn1]ÐU\WVSh EP蚤UfYEMԛ?}9EPQfeEH ^$z { { { { { z { { | | | | | z E| ԛ?E PE΄| ԛ?E PE߄| ԛ?MTTM| ԛ?}}8}T8$} [31~[19~U=} .,?t A  Ah} U=]$$ x ( x x x x x x x x x x x x x x ` P x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x 0 x @ V2V/3V;VHVHǃ߃Z$ l ` x x x x | x x x x x x x x x ( x x x D P x ਓ x x x ณ x ȓ ؓ x x  x x  ( x x x 8 x x x x x x x x x x H x x X h x x x ਔ ̔ x x x ؔ x x x  x x ЉÈW@ ;F5/Vs;F5 F5 V)V)V+*Vk*V+V*wV +gV:WV;GVg<7V<'V=V7=V6V++V/2V1V7=Vw1V%} ~f}V7vV$jV1^VW2RV7FV#7:VP<VǃptqtAVC VCF5&fpuV+} uFfEF5V NЙN~,tVFH9}F,EMm;5,?uJ?e[^_Ðvt_coldinit: impossible equipmentU WVS8?Ajj0t$ 0h 2Dp"X+AfǀZX+Af8Zt#Dp"X+A4?Af4?At+A?E?=Au'"RB?A?E?=Au![Dp"X+A4?A?A'Dp"X+A4?A?AE?=AtfAf?&fA=A?u f?f?fA??15AX+AFFF fFfF AfFF"F#F$F%F,F0F4F5F6F7F8F+F)F*fFF&F'F(uD=A?u+4? 4?Q숆 4?B%ƆƆ7A7AƆƆƆƆƆCdž`?dž`?dž ?dž ?dž`?dž ?ƆƆƆdžFPƆ Ɔ Ɔ Ɔ Ɔ ƆVK>V' 4? 4?Q4?@ f^ N1NFE1uV:F)r>^F)P)ӃVPRFÍBP/j(^Ff)^ VF*F )…~!RF BPA PhƆ fdž fdž fdž dž dž dž dž G 61ۿA3ǃĨAA?t2~<u74? 4?QD3 4?BD3D3 ]D3M D3 D3ǃ̨AOyA4? 4?B7A4? 4?B7A=H?u_e[^_Ðpcvt: scrollback memory malloc failed pcvt: screen memory malloc failed, NSCREEN=%d, nscr=%d U WVS=8?tA?t~t.E_AGt35A DT*PQA Pf??  F~e[^_ÐUS] uYC S(BK9|aK?jS=fCf)C L?tP蘵L?K?C S)K9| fCf)C ]ÐUSMYt; ,?t14AQ 9uAPSACPfBQ ]ÐUVS]u VSlu 1CS*P3A PdSC5CCfC C8C&C)C'ȈC(C$ƃCS:St_fC)fSfCfCPu fǀ fǀ CfǀCxxtjjpx&APS e[^ÐUU1Ƅ@ ~ƂUVSuE ]҃=fVwl=uVuw/=pVw=tVz=sVh=dV w=gtXK=oV!8=gVw+=hV0w=eV,tW=nV=rV w=qV=iV0SGA?<S7A?<S"A?<lSfwVSPVS:A=A?+VS$=A?VS 3&SSPu%jP)Ѝ5AP=u$h)Ѝ5APuu}xfw f&Afdvf&Ad f&A&AP5,?.,?x*u!=AA 1e[^pcvtUE1 5 P@@ ÐUE@F @@ @4@@@0ÐUWVSuu @???H9~}1ۊ A?A<w=)؍#6A|E?9| B1ȨA$uF| 9~1ɀ=D?u uF| 9~ 1)؍5A88@?9u&4? 4?B4? 4?B[^_ÐU WVS}|E?E9|JU EUAGG $ @D=A?uG]~]G=~D uD$HD =A?u<uؙ#"tؙ*n#at tU/t%ؙ8ؙÃ',!ؙ1' ̨A5A1#6A9EuEPW  KyՃjj@?P艩e[^_ÐUVS]|E?9| B1ACD$ƃs D C̨AC[^ÐUSE| E?9| Y1ۋP|с~ 1ɋP| ~ 1҃ PRQS> ]ÐUSM] A?AAE?A??A Y@?A)ڍ5AD+̨AAD?A$B?A(C?A,A [ÐU WVSUBu]  ÃSH5@ tAࣀ@CE)؍< AAtjjEPhv U R脮 5@֡#Atv@?9u~Exux to#6ĄAUBEx t @ ?9,?u jƃ]ÐUS]*$ 8 8 D T \ d p ƃHjPS8C7/C6'>?9,?u jƃ]ÐUUwq$                    Ƃ ƂÐUUwq$4 Ƃ ƂÐUUu BD]<u1D]@=~ÐUE@8PP9PP:P fP<PfP>P6PAP7PBPDPHPLPPPTPXCP\PP@ÐUUz8uqB8B9BB:BBfBBAB6BBB7BDBHBLBPBTBXB\CB@BÐUS]1ɀu _2A?<"C+ĨAH|R8Iy8A?<C+ĨA|:uuh`?SqƒЃ*$ % % % % % % % % % % % % % % X % % % % % % % % % % % % % % % % % % % % % % % C5 $p % % % % % % % % % % ๠?w?k?_ ?S`?G?;ƒЃ**$  % % % % % % % % % % %  % % % % % % % % % % % % % % % % % % % % % % % %  % % C5 wi$ % % % % % % % % % % `?&`? ?? ??QS][?62;1;2;6;7;8;9cUU ?B0B4RUWVSufF F1]V  AEf P^ CtDك Dك!fF FGF)V9|fF FF[^_UU$?B0B4RUu[[?13n[?21n[?27;1nU WVSuj$ (?F0F4@@@[FP ~gfff0@FHgfff))0 ;C;;CFP ~gfff0;CFHgfff))0 ;C;RC;~0È^4,?0?F0F4VK4?F0F4V3e[^_ÐUVS]C:C&:C( S(C)9~fCf)C CC&8CuVSQ eKC(S)ЍV)QS QCƍBPC AP5CPC BPA P^4e[^ÐU WVS} WG)9~փWG@)RG DBPG BP4W  A f P_ CtDك Dك!we[^_ÐUVS]C:C&:C( S(C)9~fCf)C CC&8CuVSu oKC(S)ЍV)QC APS QCƍBP3CPC()@S‹BPA P2e[^ÐUVSu VF)9~ӃrYVF@)RF BPF DBPO3F BVTPF)A fse[^ÐUM A)H9~ƒRQ3 ÐUM A)H9~ƒRQ7 ÐUS]KC)9~ʃRC BPA P^1]ÐUÐUVSu] $   8 | 09~;tAw{tn|tMhK@ 2C$S ƃC$SS ƃ/t;H9+Ј+ƃFK$  L L L L L L L L L L p p p p p p *t)J)t*t)&)N*t7)ƃ*)@=+))ƃ*Sƃƃ\{SmFw</,//< /:FЃN/,/ //ƃ/t t 6;t-ƃƃ0S0t3F?w131@1mF?w2;2@2:\u SJC$C5ƃƃC$C5ƃe[^ÐUWVS]EtSƃ+<wM+xE<u ,)ֈEE4 S3RN1BA9} )9|Ƅ‹E}t ASe[^_ÐUU1ƄƄ@~ƂÐU,WVSuF+ĨA<Uߊt <~v~tVvƆ]S3P!}߉ȨA$ tEt< tt"0EPSC.EPSEPSoEPSEPjPWV&e[^_ÐU WVSuVM=uF# tF%e[^_ÐUEu ƀCƀCÐUM1ҍDBvUMt/ t ktCaAQ)PA BPA@PQ PA)RQk!APQ PA)RQHÐUMt3 t Vt7LAQ)Q )PA P A @P1QAQ)P1QscrlckU WVSu~&uzF':F)ur,?9u:F*uc=A?tZ9u  t~=X+AV)+U Nҍ:9vRWFE CP;)>KM K@VF'+E RF&V‹APF&E VAP(FE PF(+E @V‹BPA P' t't=ܞ"tjhm j2 Pae[^_ÐU WVS]{&C':C),?9u:C*u{=A?tr9u  t{=X+AKU ҍ:39s=C)+E QSC)E ЍWRV'CS)GG)։3ASC'+E RC&E S‹ APC&SAP'CE PC&S‹BPA P\& t't=ܞ"tjhm j2 P e[^_ÐUUM  B5 $( \       9u9u9u9u^9u9u.9u9uUS]tGK09t?{4t9CPhPPC0"ЊC4ʈS4K09t<uʋ]ÐUEƀ)ƀ*ƀ+ÐU VSE@+ĨA<t<U1ېu3C~VjPEPdC^~e[^UUƂ/Ƃ0Ƃ1Ƃ21Ƅ;Ƅ3@~U WVS} E+0E5E0UDكu  fEE9E|[^_fdcUWVSu^1EPjjv|S] uEPjjF|PS] t!1UU%tE@jd.{t׋E@juS|;huSjuSdždžh juSajuSae[^_Ðfdcattach: couldn't map I/O ports U,WVSu }_EPjjw|S\ uEPjjG|PS\ th ^@EFDEFHFLFxFpFpFth VURVhD jj8Pw*nF<0~ujjrÃEEE|EPSEPPEEjh8 EPVEPUЃ~e[^_ drive %dU} uE0h+ 61fdcresult: overrun fdcresult: timeout UWVSE@@EEpDE1}uVF$F4@w@F@7edAtX'mt4wmdn =Fgd\f?5hV"#h@,(P#H F(@F8@F0F,@ F4jh tPhfF jh PhP$V= Rev E, aic7770 <= Rev C, %s: %s%s: couldn't establish interrupt U,WVS] E@EUB C %s: couldn't map interrupt (%d) %s: couldn't establish interrupt at %s %s UWVS] }7G Es0C4EPjhG PV) t ht!EC8SPVth!S ǃfǃ?ǃ?fǃGƿx!u!]ƿ!u !Cƿ!u !'ƿ!1t !u!Rh !虸EPsC,2BPEPh!KC, C(C CPE PMQS;e[^_ÐUVSMU @ lAࣀ@BDB0tr0p4 B0B4z0u Ps@ӡ#Ate[^%s: can't malloc ecb ahbecbU WVSu=@ lAࣀ@t*S0t C4B4 C4S4C0{jjhn#ÃtIhSG %ځ ЉC<|NHS8uč uÅu  ƒwT$D!`!h!p!x!!!! M E = 5-%Ph!E  t  u }t UJ<1e[^_ÐUÐUEx<~@<P'%s: done or not in use? %s: ahb_scsi_cmd, more than %d dma segs U,WVSEx W U@Et#ЃPh$!֮UB$ BEPURVƃuE@,`UV@EEeNDUzDt /EpD@ lAࣀ@hGPUR]EuUJ@@ӡ#At~UrREPfFċUz$tfFf~UBF!p % ЉFF P % ЉFƆRƆSEx$VH ߁% NUEUZ$z ߁% twEEtH%E)ȉ9v‰E)É%t ߁;MtEUBUEt} ~UV tEj!EPhT!mE@,URVEPJFF F}uF!PF$PUr@ lAࣀ@Vj@EPUuNEH `r"Mb)RVhp"!@ӡ#At1e@ӡ#AtUrREP#t.VGhUREP t V"e[^_timed out AGAIN U WVS]C@E@ x Pߖh["! 5@ lAࣀ@CDtIh!ĪC@@KDSW 5@֡#Au'he"!vC@@SWz Ph!OC@@,CDSjPW UBu`r"PShp"!~5@֡#Atke[^_ahc_eisa_irq: illegal irq setting %d US]M u $t uQ\Q\Ѓ | ~ }Ph#!O]ADP7770ADP7771U WVSUrG$!tƿO$!uQEPjhB  PS u*uSƃhuSw1e[^_Ðahc_eisa_attach: could not map I/O addressesahc_eisa_attach: ahc_eisa_irq failed!Adaptec AIC-7770 SCSI (on motherboard)Adaptec AHA-274x SCSIahc_eisa_attach: Unknown device type %s: %s %s: couldn't map interrupt (%d) Level SensitiveEdge Triggered%s: Using %s Interrupts aic7770 >= Rev E, aic7770 <= Rev C, %s: %s%s: couldn't establish interrupt at %s %s: interrupting at %s U,WVS] uEV UFC-!E,ƿd+!u[-!Ey-!Ph-!iEPSEP, tSh-!CuURƃE PE PhOjjuURU B00u7h-!tVh-!ٜh-!ɜ*tVh-!貜jEPU Rye[^_UÐUeisa_intr_map: bad IRQ %d eisa_intr_map: changed IRQ 2 to IRQ 9 USE ]vPh 1! uh81! 1]Ðeisa_intr_string: bogus handle 0x%xirq %dUE t uPh1!Ph1!hԲ@Բ@Ðeisa_intr_establish: bogus handle 0x%xUE t uPh82!u uuuuPj"Uu jqESS0002CTL2011CSC0004AZT0500YMH0021ym@@@1001OPT9310CSCA800CSC0100wssCSC0000CTL0045CTL0044CTL0043CTL0042CTL0041CTL0031CTL0001AZT1008ADS7180ADS7150@X@0001@@@2001OPT0002CSC0003AZT2001@X@1001ESS1878ESS1869essESS1868OPT0001ESS0005ESS0001CTL7002CSC0101CSC000FCSC0001AZT3001@P@2001@P@1001@P@0001efTCM5051SMC8416@@@1980UMC9008CSI2203PNPC001PNPC000joyPNPB02FmpuPNPB006PNPB003PNPB002PNPB001sbPNPB000PNP828DPNP828CPNP8231PNP8201PNP8200PNP81C8PNP81C7PNP81C6PNP81C5PNP81C4PNP81C3PNP812APNP8128PNP8127PNP8126PNP8125PNP8124wePNP8123PNP80F8epPNP80F7lePNP80D8PNP80D6PNP80D5PNP80D4nePNP80D3wdcPNP0600PNP0501pccomcomPNP0500ADP2015aicADP1520ahaPNP00A0isapnpUVS]j{8uSHCH{8uSHCH{8u SHCH$0Ny[^%s: Too many pnp cards UWVS]Ej{XuVCPh6!ESHDSLHSHTSLXSHpSHSL{8tCH{8tCLKD{8tCH{8tCLKDh{${8tCHh_$1Eh?${8uSPCPEh${8uSPCP}Uu !)19sJsh3>!CtPh8>!G9th<>!F9re[^_%dU WVSu }tLuh.>!襎1ۃ9s3Ph>!苎G9th<>!tC9r͍e[^_ "%s, %s, %s, %s" at %sportmemmem32irqdrqUVS]u uh+?!C`PCPPC@PC Ph-?! tVh>?!܍CrPCxPhE?!wCuPXPhJ?!^CvPPhN?!ECsP8PhT?!CtPPhX?!e[^Ð%s: error in region allocation U WVS]U B@k5!ǹte5!ǹu[f{ruSf{tuLuCSssuU SRu@U Bph<@!蚌1e[^_U WVS}=d?1ې1G@Pd?%tGPPd?$uh?t^U BpV$uEWww.tU Bph<@!'U WRu@d?T1e[^_ÐUVS]S{8CH{8t~CLh?Sh)S;%sDSM;uSt CD12SL뀋SHi} tSue[^U|WVS]jE܉EP'jUUR1ExU Br9}1u-SH@SLEGSHXSLE_u\?VUЃ{8tCH{8tCLUЈ\?HFEσ{8tCH{8tCLUψEGZ1EXU Bu9}euaSHpSLEwSHSLESHSLESHSLEuX?VU΃{8tCH{8tCLUΈX?HFEȃ{8oCH{8jCLUȈX?HFEǃ{8RCH{8NCLULjX?HFE{83CH{8.CLUEG1E8U Bs9}MSH(SLE/Mc?U{8t׋CH{8tҋCLUA$tC t:tt,E*E"ESH(SLE/Ec?H{8t؋CH{8tҋCLUEG"1}U Bt9}ESH SL$e?{8tCH{8tڋCLEGv1EU Bv9uSHSLESHSLESHSLESH-SLE4SHISLEPSHeSLElSHSLESHSLEug?VU{8&CH{8"CLUg?HFE{8 CH{8CLUg?HFE{8CH{8CLUg?HFE{8CH{8CLUg?HFE{8CH{8CLUg?HFE{8CH{8CLUg?HFE{8wCH{8rCLUg?HFE{8ZCH{8VCLUEGnx[^_ÐUVS]h\VC8EEVw4 uLV}uUE}uUEhV<4H[^(isapnp probe)UWVS]CEEpjI!f\V3t11Cs@M 1881<f<CsEAs9E|EE xtt@1Ct@M 11fCtEAt9E|[^_ÐUWVSEPUjP71}uthE@EFu F*ÐVS[u^jVu] _uuuEe[^_ÐULWVSM u}U!tLUHto>'#V]SE0.jS@P@OV]SSxPjSPP@_uP‹EBpqUb0u#j VU P?U@?1jV`P!@o Euu / tg  $tk_tFAs@A8AsffF fSV'>#At@AAtffCVC$ЈCQr)Ѝ\xArCFV ЉCFV ЉC FCFCQr)Ѝ\xArCF ЉCC CFCmQu)ЍXAuCVF ‰SVF ‰S FV ЉCVFQv)ЍAvCVF F F ‰SVF F F ‰S V F  F  F ‰SVF F F dQv)ЍAvCVF F F ‰SS CVF F F ‰S1e[^_Ð%s: card %d violates PnP spec; byte %d %s: Maximum tag size exceeded, card %d %s: No current device for tag, card %d Too many tag errorsResource timeout%s: %s, card %d U,WVSuDžDžDžhPjjhhPv1Vk~8tFH~8uVP VHFPËU :\0Yt2t-u W@PFPhCFF $l!!!!,!@!T!F xAHp"tPh!Ph!L xAyQ QAQ  AQ yuF @Ph!o^ Sh!kL@ZF 4APh!?F ܛAPh!+~v,F?v F P6h ! Lv>h$!Ke[^%s at %s function 0x%xUUE trP2h!KÐU}u1ÐU}u1ÐUÐUÐUÐUÐUÐUÐU WVSUM }u]t:uCHp"t}t.t mtWe5("ft%0AtArAu (j PSVW54ASVW-e[^_ÐUS]@t4 t&%=u9Yt9u܃t1[apmpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateNo pending eventsNo APM presentunknown error code?UE+tjtStVtcitT tw t` tc=tm`t^t=tekX!ft!^!V!N!F!>T!6s!.!&!Ԅ!!!!apm0: APM %s: %s (%d) US]E @PPPSh !>GT?]ÐUÐUj j*jjUjjjjUVS]u 0AC@PAPjvSe[^ÐU WVSuAuF8uAV@~@Ae@ Aࣀ@ND|HBV@AFD…}A$)‰VDE APAЉG@ӡ#AtWF0P跍F84e[^_get capabilitiesreserved systemreserved deviceOEM definedreservedUWVS]u VB 6$8!!,!܉!܉! !!!!h!!܉! !=0A= A AvSl "A=0A= A=4Au =PAtA AvSl4Aa=0AS= AF A:=0A+= A=4Au =PAtA AvSPA}Wjh SutUth;$?s`C8%=tQ=@u9S*@t @ @h!>]system defaults faileddisconnect failedAPM disconnected U$Sj]S蛏S=AuPh S- tSh !SjhS tSh#!hh5!=]ÐUWVSEEX=P?0T!CC= wC = C= wC= C= w C= wtEPjs sEp : uSs uEp 迱EPjssEp 0usuEp 花1e[^_get power statusapmlkU,WVS}wOV F@%)‰V VF@%)‰VVF@%)‰V (@fDA0F@AF^9vÉV F9sЉ)ًV9w9s 9wkF9rbF@L9s9v)EPjQF9vRw ګMMV 9s)MA)щM5EPjAPSw 蚫EPjF@Pvw 聫 UF9u N))ЉEjjjjv R"0P蔟jjjjvu血"8Pujjjjvu졀"@PV Ft jjjTE P$j]SSjh S uSM QVSh֐!jjh!j E P订E P2M Qhē!"H0PP4H8PE E5ܞ"jjMQEe[^_ÐU WVSU1=P?tu@?u S5ܞ"jjV膞} u{@tC0Pu{5ܞ"jjVNe[^_USVW]KS ] =\?tE.@APX}_OW _^[]Vadem VG469Vadem VG468Cirrus PD672XCirrus PD6710Intel 82365SL rev 2Intel 82365SL rev 1Intel 82365SL rev 0UnknownpcicUEt=t0u%=u1UVS]jjSCЃjSC % =u2jSC u t jSC =t  =t%=t 1jjSCЃjj7SCЃj:SC  @Pj:SCЃjSC t.~j:SC %Pj:SCЉe[^Ð%s controller %d: <%s> has sockets A and B A only B only UWVSu1ۉvd^|Fp,!Ftp!F8FhF!PPh?!, ftPhS! h`! th:! E Phb! UB0hh! } uM1ۃt54u!t0!Ph5! C<ũh3!c e[^_ÐUEXtxu@`u @(txu1Ðpcmcia_function_init: function is enabledUUB`t hx!DE B(Ðpcmcia_function_enable: function not initializedUVSu~(uh!F dJduF P0p4B(ЃF`t+1B,F,B0F0B@F@ZD+Z ^DBHFH?F Xt-B`tBDJ )^ 9r CJ@9vRuڅufF P0^,Sjp4ЃAV J0FHPFDPSjv jr4AЃ tF P0Sp4BЃF(?@F Xtxt ~TtQjVF(P tQjVjjVF XtixtcFLVP)»9}9|K%Pj VFMPj V|jjVojjVbSjVVN`h*1/F dJduF P0p4B,иe[^UVS]{(uh!C`t $C`e$C`s XIt#A`tADQ )‹C 9rQ@9wڅu)F0sHv4@ ЃS J0C,Pr4AЃ C dJduC P0p4B,Ѝe[^ÐU WVS]u}C P0uWMQVu p4BЃ t C Xx{PuGCLEG9CLvCLwU29CPsCPCLSP)¾9|9}N%Pj SCMPj StjjSgjjSZVjSNjS PjS51e[^_ÐU WVSu} V X|xr1ɃxTtuX\ P\9~A@u߅uO@ tAࣀ@ӋEFTMNX~\F P0Phd!WVp4B Љ‹F ` h9~|@ tAࣀ@ӃF P0`p4B$ЋEFTMNX~\F P0Phd!WVp4B Љ‹F `0@ӡ#AtCV<@ tA@ËEFTMNX~\@ӡ#AtfVF `tOjV PjVjVu PjVB0MQMQWVr4@ ЉÉ؍e[^_U WVSuN X+x!1ې9txTtux\ P\9~C@uۅuOA0`q4@$ЃjV$PjVFTFXF ǀ`9~\~c@ tAࣀ@ӃF P0`p4B$ЃF P0Phd!WVp4B Љ‹F `FTFX0#@ tA@FTFX@ӡ#AtTA0u q4@$Ѝe[^_ÐUVSE1XtZ{TtLCtFjSt4sXCTЃtuƃjS$PjS [ue[^UxEEEP8Ufǂ@8Bǂǂ ǂǂfǂfǂǂ X$EURh!P+u Ef%s: CIS checksum failed U<WVSDžE@00UR4,]ShRЃt s EEEE4PEPShjj,Q0BЃ toS,Q0Cи 4,P0B 4,Q0C DžEDž(Dž$Dž DžDž}uUUUEE܋UEЅuE=u%EPEPU ҃&E}uUBUUE@E؋UEԋUЍBW$|!\!!!!!!!!!!!!!!!}vDž($uuU܃UUE܃E؋UȅuU܃UUE܃E؋U ˅uU܃UUE܃E؋U مu U܃UU ˉ E܃E؋U ʉ Dž(}vM uU܃UUE܃E؋Uȃ uU܃UUE܃E؋U ΃ uU܃UUE܃E؋U؃ uU܃UUE܃E؋U ك uU܃UUE܃E؋Uu܁q1=c119sQE؉U䉕 uG9r9EPh!;}}uU܃UUE܃E؋UDž9DžDžDžDžDžDžDžDžDžDž8}uE܃UUE܃E؋U<<uuE܃UUE܃E؋UȅuE܃UUE܃E؋U ˅uE܃UUE܃E؋U مuE܃UUE܃E؋U ȋ9N]SEPU ҃N4,Q0C Ѓ($uѥ 4PEPEPh P$tP,R0AЃ $t E mEDž(Dž$Dž 9}8<3uѤ+<4PEPEPh+<<3tP,P0BЃ <3umܸ<3tE}u UUU EE܋UEЃl}uUBUUE@E؋UEԃ;MuU܃UUE܃E؋Uth!+]4h!G<uăh!UPPVh!E E U2EEPh*!EPB $!8!H!X!d!p!|!!!!!!!hMQlAl@Al@AlXXAl@Ah$AlAhyl$EHlUzuR ]SS}G GWAxEHgxuP PPUB BRЉЃ@EЃ<@EEE9Myluyjjjd\]CljdP=SlCl@Cl@ClxxCl@Ch$ClChSl$Cl@]Kl}uW WWUB BRAMAl@ 1;us[][l][ }uG WWUB BR ؋MA F;ur]Cl@1;ust]d}l}GEUzuB }WWUB dBR EMAdCF;ur}?}]{d:ExuP PPUB BREu܁e܀@?u؋MAd;0tTjjj\ZE}wdE@XUBl@MBlXHE؋}t,zd'EuEuUEPd}t|MyuQ QQ]C CSE}UJ@tMI t]Kt}OEpUzuB M]SS}G EGWEuԃeuЃeũeuȃe`uąE9ME@EuUB ]}WWUB EBRE1ېs?}u}W UWWUB EBRE|C~E9M^}tgMyuA ]QQ}G EGWEtEtEtE}UE9P:xu@ ‹MQQ]C ECSE t}O@tEH UJ=}uG MWW]C ECSEA}G vUBhfmE9EDžh0 t~w t.0h\M]{uC }SSUB EBR\ Eh}EEUZuB M}WWUB EBRȅu]C }SSUB EBR ȋM] Eh}EEURUuMA ]QQ}G EGWȃ}uUB ]}WWUB EBR ˃}uMA }QQUB EBR ك}u]C }SSUB EBR ȋM] Ew @t0h\MExu@ ]}WWUB EBR\ Eh}EEUZuB M}WWUB EBRȅu]C }SSUB EBR ȋM] Eh}EEURUuMA ]QQ}G EGWȃ}uUB ]}WWUB EBR ˃}uMA }QQUB EBR ك}u]C }SSUB EBR ȋM] E}hD8hEU;W G]C CC}E}9G^ uG MWW]C ECSE}UJ@@tMI t]K}_uG MWW}G EGWȅuUB ]}WWUB EBR ȋMfA4E]fC4}q E}9G> } UB8_uG MWW}G EGWȅuUB ]}WWUB EBR MAtPPC^`u74>C C`uSM9u}t E E E}%T1e[^_Ð: unexpected I/O space configuration : unexpected number of i/o spaces %d should be 1 or 2 : can't alloc i/o space : can't get subregion for asic : function enable failed : can't map NIC i/o space : can't map ASIC i/o space port 0x%lx/%d: can't alloc mem for address : can't map mem for address %s: enet addr has incorrect vendor code : (%02x:%02x:%02x should be %02x:%02x:%02x) no irq ULWVS} EEEEEUBBXC u { t:uCC t%hD"Ph"MQB H0Vj j jB p4AЃ th"R RjjQPY: th"]SEpaUr軸 th"'LJPVjjjMq蚻 th"PVjjjEpd th9"VjhU"EE?1MQf=t?f;uf=tf;DtOUBtZ?<tOPMA[u34UB [uMQM?9t1ۅ{EPB H0uVj B p4ЃMQB H0EPEPVj sjB p4AЃ k1ɐEă}u EHUUEUĈA~˃MQB H0uB p4A ЃEPB H0VB p4AЋUĉŨ E EЃ}%h}tjCM8uC8AuC8AtPGPh"CPCPCPUBPBPPh"0 t닇 u  $P Pjjv诣 th"Xǃ$h"ѫ ~!tPh+"誫KlSp CtCxK|K0C4s`s\C\CR0"jBDP^SjPSFfFf"FfFfFf Ff$Ff&j ,j Lj lSjSFP4 PFf(@Ff*0F!FjDPVWNe[^_ÐU,WVS} ܞ"@ xAࣀ@E0t lURWF0PUR4=Ã~+@Љ#A$2i w$1i P i t0i tt}i |i 4UJ4Uxu&VEEPRR VlEP4%@f=@u7u.fDžfDžfDžPV+_@f@u8t/fDžfDžfDžPVVs@t VJ UB41V1ۃhWEp讽Ãbf=u(jTPPpfDž+kf=uN2PB0o tjDW-jDWPWVhEpWO{2PB0 ÃhWEp覼Ãu^f=tLf=u"PPV Ã,WV2ÃuWV+@ҡ#At؍[^_Ð%s: tx buffer allocation failed %s: mgmt. buffer allocation failed UWVS]C0Dž@ xAࣀ@A4@t SSsfEfEfEEPSfEfE$fEEPSfEfEfEEPSfEfEփfE؃EPScfEfE΄"fEЃEPS<fEfE fEȃEPSfEfE (fEEPSfEfE *fEEPSl ǰփj&EPfufE IfM эAPEP RdQS4Lǰփj&dPfdfDžfIfhэAPjPR·QSfDž\fDž^&f`\PS_,ǰփj&4Pf4fDž6If8эAP:PRQSfEfEjuEPP趶VS fDž,fDž. f0,PSLfDž$fDž&f($PSfǃ#fǃPS@5t8fDžfDžfDž 72 ffDžfDžfDž PSSj PSVh:SFtCPh?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzUE"  %cU WVSuE-à t(t9 ttwtG t gt^hT"xE}thT"xNM똃}thT"cxNMuu }G;} }hT"4xLShT"x}F0e[^_UE@@#Eg@@ܺ@ vT2ÐU WVS}uW?‰W9sGG@)9rFSE PDPGPW E PW@C?9r11ۃ)VE PDPPe[^_UWVS}] jCPuV'C?7w 8x)ƒRh$?S jVS tjSWjXjSe[^_ÐU\WVSEpxP Uj@u EEP!#E Uxj!! UċEV ؉E!! Uȍ:p $}#U! U̍2ν!#E UЍ|!! UԋE*ƇG ؉E!! U؍:F0}#U! U܍2F!#E Uؘi!! UED ؉E!! U荼:[}#U! U썴2\!#E U"k!! UEq ؉E!ډEUE! U:Cy}#Uщ! U2!I#E!} EEčb%!! E؋U@@ ډU!! U썼:QZ^&}!ډ#E U2Ƕ#UE! Uԍ]/!! UESD ؉E!! U:}!ډ#E UЍ2#UE! U䍜!!! UE7 ؉E!! U̍: }!ډ#E U2ZE#UE! U!! UȋE ؉E!! U܍:og}!ډ#E U2L*13EEԍB911EUq ډ11E썼8"am׉11E0 811EčD꾤11EЍK ډ11E܍8`K׉11E荴0p11E~(11E' ډ11E̍80׉11E؍011E䍜911E ډ11E8|׉11Eȍ0eV 1ED") 1E܍*C ډ 1E8#׉ 1Eԍ09 1EY[e 1E̍ ډ 1E荼8}׉ 1Eč0] 1EO~o 1E, ډU 1E؍8C׉ 1E0N 1EЍ~S 1E썔5: ډ 1Eȍ8*׉ 1E䍴0ӆEpxP j@jUR-e[^_ÐUVSu] M19s 2B9r[^ÐUS]M U19s @9r[UWVSu} EU11Ӊȉ[^_UEPEURPEU RP& EUUjEURPEU RP UVS]u UM9rw 9r9v 1[^UWVSEU M])Ή)9vIω[^_USM] ډ[UVSEU ىˉ؅tHƉ؉[^U,WVSEU |EUE؃ډEUE]u} ۃހu}uuSEPEUhSEPwщ‹E9ErE})E}+})9s)؀uEƉӉ΃}t)EUEU}t؃ڍe[^_ÐUWVSEU %uu 19r)E)E)9s)uщ }tӉ)‰9vI)Ӊ‰9sLӉ‰9sL9sAMUEU[^_UWVSEU M]}ƉރEƉE}ʉڃـuʉكEPQRWVEU}t؃ڍe[^_UWVSuEU EUv#?wF1EE't!U )] ‰UmEU[^_UWVSuEU EUv#?wF]1EE't!U )] ‰UeEU[^_UWVSu} EU Ӊȉ[^_U WVSEU M]}ƉރEƉE}ȉ؃ڀuȉڃjRPWV}t؃ڍe[^_UVS]u UM9| 9r9v 1[^UWVSuEU EUv#}?w FUU}'t!U )] ‰U}EU[^_UWVSuEU EUv#?wF]1EE't!U )] ‰UeEU[^_UWVSu} EU!!Ӊȉ[^_UWVSM] EU4 9sAω[^_UWVS}u ]uN)‰AGF8t.B<w`v zw B<w @vZw 8utKu1[^_D$fD$ffD$fD$ffW|$L$ D$uA_W|$L$ D$tA_L$tVWt$|$T$18uIu_^UVSuUt$M ACuJtCJuJu[^USM] Uu)C)‰EC8EuA}tJu1[W|$1эA_L$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuXD$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_WS|$ D$L$W~$ĉ Љڃ)ӉكX[_D$t@1WV|$ t$1L$u L$t@^_W|$D$ L$t uG_Ð1_UUE 9vUUE 9sUUE 9vUUE 9sUUE 9~UUE 9}UUE 9~UUE 9}UU|WVS]u UM u1 d?1MԉM؃}Ur9wu9v}tMq11}EEЍE܉Ẻ]ԉufEEfGEfGEfGufwUԉM؋UEfPE؋MfAEfAufqEfM}u{EXG1fEG ‰1fEG ‰1G ‰1}t E@UE ‰U؉ ‰UEUfzjEM)MfuMftuuUExEUfBMy+EM̍ AMEu^w Eہv}~,EPEEPW!UREHPEЃP EMIfMʋuvfuȉ}}}E@Mqf;Uu E3 ]ʉ1EĉӐUUĉ 9vMEÁv1ۋMM~?u4NuUMuNU))؉ËEf؃EIMʋU)؉ftAM1ۋMM~,E4HUMQfM}݋MfUċuEfpEEEFuM9}t|}tHMMu9~2EGMDG)ˉ ‹ufwNuE9ЋUfWEU ЉEEU ЉEԋEԋU؋MQEU ЉEEU ЉEԋEԋU؍x[^_UWVS}u1;] }#_D_) f_C;] |_f_[^_UE EEEuEPufSUU EBEEuEPud'(TfX04@ @@ @ @@ p@     P ``  ~sl    8)*,-IECF+T J%! ./UHPQR&'GSDAN""u" v"0"H"u" v"p"\"u" v"""u" v"""u" v"""u" v" "$"u" v"8"P"u" v"""r"u"""u"Dv"L"d"u"Dv"P#h#u"Dv">>u"v" >$>u"v">>r" v">>u"0v"'?"u"Hv""'?ؕ"u"Hv""0?"u"Hv""Z?Z?u"Hv""Z?"u"Hv""Z?"u"Hv""?"u"@v"%Z?$"u"Hv""?$"t"Ps"8v"/?H>ls"8v"/(?ଗ"s"8v"/(?ଗ"s"8v"/(?ଗ"s"8v"/@?p?s"8v"/@?p?s"8v"/?଄?t"8v"/?"r"8v"/?"u"Lv"7?"r"8v"/?"u"Lv"7?"t"t"u"@v"%ȹ?"u"@v"% ??u"@v"%?ࠋ?u"@v"%[XK l  !8!jjh2Xj j eYN`` |h@h>` |h@ h>>J`@xN@`MpN`j]Nj\S jjS]R1R T V P >t |> ePXe @ee>Xbx eep@  e exx 4 @ i j yjj6lQjIj]jjIj]j&n7 72    2 2 2 jVyeXfxf f2 @fh6lxeXfePfeHf f2 VyeXf f2 fe@j"jR.q xe@PQ`j\Zp(j4\eTAj4\eTAjj26lJie.A x ny7nj"eA@j> |n yj\jd4\ *y j4\4\lFi6^i6i6i6Lyj]jeYR>a jj]e,AjeXe@j\ 6Ryj4\j4\TijjzeYe @j\eXfd d2 [d( dldy rydxa 2 ddpi6le.AyjzDj\eA@jzj\jrXeBj\jz4\jj4\eTA6iCji j yj &j*i2 jj j &e]Qj"jrXj"jh6le\=dzdrdsd sd\sj"eA" y hj"j& j0jjzjl 110jj\e(Bjjyjj@=j5jeV\j 6i 6l1jj\0e\p08jj\88j5ji1i0jjj8Bb @z5Bz5ji5&  Fj Nj Hz5B\jj j j8p8zrb8jedJ38(d 91 jjz njj1j9j\jj j &e]jp]zY0e\j9r:t (j z (z5&  jeZR1R T V 8P 6y6l.y je.AeAeZj"eAjߓ& j&zzzzzjד& jj eV\ j10eJj1j&5j&21eC1jj\j j e\=j&j& k {kǓ& 8keAeV\D eA=4eHcjkn"{aj"jV*{W.{Wejk@ee L{e e\=Tc# e\=TcLCeLcejC@je e\=s@j4jheAdj\dkdsdsjvsdsdrsj"e\RqejCeAzk{jj]{qj"j@Rc jj]>t |ePXeA k7[eAe]eOj\R\Oj"@e]eA 6r{8F1X1`1j8j\jj\j\erC6lerCdd7nje\Rs@6{ez\eCe\=d dRj\et\7c{@ 6letXr{@ j\erC|e]eDe]1j"erC=eh j"eD | lz=>de  l@e@ef,t@e,|e,\jjjj  6|e  :| j"eAe&  Nl D|LlJ|LlǓ& 8Plj 6Tl!j"e Rbd7jnDRjnDrt elfd j@6|Z\etStS ft e ~ j] jjRE?tj?Z\et@6l l jejEj]j j|j4jEj]jj j j&e] ejEj]jjjEj]jj j j&e1 |j e2 &eE7j\S j" | lz  lllllll =d(Ud(eE.d(fd(lSl jl l$ejAj ] 5,}0jj(ee:Ejj1 4}j8ej DpDDp$0 7# 7%77$7& 7'@@7&|7(7# 7%7$7^;&`H@?@@)) ?THIS is A memory TEST pattern KpM  ##$PXĔTFPNܚRR\CESTNMTଘCL$0PL$0REx@RR\CESTSLRR\CESTERHCEST̮خt|""ܮ""\"8"@ܯ"H"\"వ"సܰ""\""ฺܱ""ĺ\""кܲ""h\""ܳ""\"ؼ"ܴ""\""ܵ"" "8\"$\"<"\ܶ""\""\""\"d!AЙ"""ܮ""\""dܯ"H"\"వ" ܰ""\""ܱ""\""ܲ""\""ܳ""\""ܴ""\""ܵ"""\"$\"<"ܶ""\""\""\"̪A8"""ܮ""\"ସ"ܯ"H"\"వ"Hܰ""\"|"ܱ""\""ܲ""\""ܳ""\""ܴ""\""ܵ""l"\"$\"<"`ܶ"Ŀ"\""\""\"|Aࠜ"@ Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2000 OpenBSD. All rights reserved. http://www.OpenBSD.org Anative$' D"h#1?3$s$- $  `kh(sy}sih vԅ  d s M[aOMM%  dD  t @td0es Ms$?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~4& &&&'(4)X). .. ""ܮ")",\"-"-ܯ"X.".\"0"2ܰ"5"\"\:"h:"t:\":":ܲ"="x=\"l>"Eܳ"`J"@K\"tK"dTܴ""t\"4"pTܵ"T"T"tU\"V\"T"PWܶ"Wܷ"PU":\"d@" 20123456789abcdef^^ "dପ iܮ\"",2"L8 T)H*$6"XPBt ԥ" Yओ8d "|LN|OP"xN|OP "hN|OPĪ"N|OP"|LN|OPdL $"" <8Q @,2(@AAA==(A* @8@8 @@@@@@@@@$?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@P"P"P"P"H< P<|<h,L<"")ܮ"d=ܸ"H"=\" >"L>ܯ"?"?\"\A"ܰ""\"pE"|Eܱ""E\"D"Eܲ"E" F\"J"TUܳ"Y"hZ\"L["`ܴ""'\"< "`ܵ" a"8!"pa\"b\"ܯ""X\"",ܰ"|"\"pE"|E"E\""Eܲ""(\""ܳ""\"`"ܴ""\"P"`ܵ" a"}"pa\"b\"P?d""&" ef_io0nd ` H(H*L+/3@hTd8xLLpMXNHLTL$଀d\0'''WEVrdrootWEVh  089  <  9}I!o /mnt`b<@`bT 089  <  9}I<@`bTU 9 !o pD@d  ?DLA 99/ 9/ QE[A9t9>9> A9t99  :/DA9t9f9f A9t9t9t hA9t9t9t ިA9t9t9t LA9t9t9tHyLA9t9W9W$*C9t9t9 kk'ѳA9 k9 k9 kDNjA9 k9F#9F#PA9 k9'9'ϭA9 k9[$9[$̀A9 k9 k9 kHSA9 k99e9~SA9 k9 k9 kH3U#C9 k9 k9 kDA9 k9 k9 knWBu!9i:9i:93;BBu!9i:9i:93;Bu!93;93;93; D!999-1-r!999-1-8%!999-1-,!999-1-!999-1-vLa999xma99951!999 O3!999 *Aa9,9,9J]{a9,9,9J]Mna9,9,9J]U=6!999J] %f!999J] YF!999J] sna999wd4a999wt !999w/+!999w/Za9'9'9+S la9'9'9+S ޼a9'9'9+S ~ fa9'9'9+S da999+S Ba999+S *a999+S J+a999+S A3Ua999+S +a9;X9;X9+S ^3ha9;X9;X9+S a9;X9;X9+S JCna9;X9;X9+S  va9;X9;X9+S aCa999+S OHa999+S tb!999+S $!999+S (!999+S !9h 9h 9+S L!9h 9h 9+S tj`>!9h 9h 9+S 6Z$!9h 9h 9+S !9! 9! 9+S ګ$!9! 9! 9+S o`!9! 9! 9+S {e!9! 9! 9+S 5n!9! 9! 9+S !9 9 9+S M!9 9 9+S H!9 9 9+S F,!9 9 9+S Wwa9 9 9vO4a9 9 9v a9 9 9v ȣa9X 9X 9vMJa9X 9X 9voa9X 9X 9vk'a9X 9X 9vg a9X 9X 9v Aa9 9 9v]ja9 9 9v|a9 9 9vkla9 9 9v0a9 9 9vu>a9 9 9vjN.a9 9 9vbda9 9 9v0[!9 9 9v-K!9N9N9v:s3!9N9N9v,Y!9N9N9vޡ{!9N9N9v$!9N9N9vBh!999vn7!999v !999vb%h!999vHs!999vSJ!9I9I9vn!9I9I9v :P!9I9I9v(!9I9I9v 9!9I9I9v!6a9v9v9*u Oa9 I9 I9*u!a9 I9 I9*u"V)@,a9 I9 I9*u#8Ha9 I9 I9*u$F+a9 I9 I9*u% Qa999*u& oa999*u']da999*u(c]oa999*u)ra999*u*a99z99z9*u+ERQa99z99z9*u,(a99z99z9*u-a99z99z9*u.Ua99z99z9*u/ !999*u )!999*u!ۥ!999*u"qK=!999*u#5A!9f9f9*u$gh!9f9f9*u%_!9f9f9*u&!9f9f9*u'dd!9f9f9*u(ˠ!9C9C9*u){E!9C9C9*u*Y !9C9C9*u+և!9C9C9*u,%GAW!9C9C9*u-ܒG!999*u.6!999*u/=,WIa9 9 9902{=a9 9 991a9 9 992)4a9 9 993s$ a9W9W994p@a9W9W995kNa9W9W996)qa9W9W997LGa9W9W9987 a9>9>9998a9>9>99:La9>9>99; S<a9>9>99<ʲa9>9>99=Fca9999> a9999?|Ps!99990dm!99991#?_!99992a*!9p9p9937!9p9p9944!9p9p995 m!9p9p9966q!99997 !99998=!99999]Y:!9999:!9999;j!9G9G99<7!9G9G99=|V >!9G9G99>!9G9G99?.<Ȅ!9t9t9t@ vIa98989`!G&a98989`!_sa94949`!)a94949`!fa94949`!t{a94949`!:a9e9e9`!݉wa9e9e9`!]7ea9e9e9`!a9e9e9`! $a9e9e9`! \a9e9e9`! jSa9e9e9`! ja9e9e9`! LRa9e9e9`!̊a9e9e9`!P[!999`! y!999`! X4Ot!999`! !999`! ]!9(9(9`! c_ !9(9(9`! D!9(9(9`! ~Q!9(9(9`! !5Z!9(9(9`! BK!9/ 9/ 9`! 6&!9/ 9/ 9`! \5!9/ 9/ 9`! \!9/ 9/ 9`! ~6!9/ 9/ 9`! B!9U 9U 9`! vLWw!9U 9U 9`! Ya9!9!96&ypa9!9!96&$ca9!9!96&Ga9!9!96&S a9"9"96&Z=ja9"9"96&Ca9"9"96&2J@a9"9"96&E]8a9*#9*#96&;aa9*#9*#96&a9*#9*#96&wa9*#9*#96&6Ka9*#9*#96&\y<a9F#9F#96&.?Ha9F#9F#96&a9F#9F#96&뢭!9F#9F#96& 0!9F#9F#96& +R!9[$9[$96& >!9[$9[$96& s1 !9[$9[$96& HGm!9[$9[$96& [ {!9s$9s$96& x]i!9s$9s$96& |!9s$9s$96& h!9s$9s$96& "7!9s$9s$96&  !9 %9 %96& /K3!9 %9 %96& L!9 %9 %96& Q!9 %9 %96& }!9%&9%&96& uPYa9V'9V'9B3 Aa9V'9V'9B3!o2aa9V'9V'9B3"ba9V'9V'9B3#nFa9V'9V'9B3$?a9c'9c'9B3%a9c'9c'9B3&\a9c'9c'9B3'?a9c'9c'9B3(~"a9(9(9B3)Wݙ a9 )9 )9B3*V Ra9')9')9B3+&a9Q*9Q*9B3,a9T*9T*9B3-(Oa9T*9T*9B3.W]a9+9+9B3/Vm"!9,9,9B3 O*'!9,9,9B3! d!9L-9L-9B3" R!9L-9L-9B3# lK!9509509B3$ 4[!9509509B3% P,!9509509B3& KL !9x19x19B3' !9x19x19B3( !9x19x19B3) yS!9x19x19B3* ,`k!9x19x19B3+ .#!9b29b29B3, cC!9b29b29B3- m !9b29b29B3. !9b29b29B3/ eͅja9B39B39C80x*a9%39%39C81"9a9%39%39C82p a9%39%39C83a9%39%39C84sa9%39%39C85u a9s49s49C86u*a9s49s49C87Ka9s49s49C88^a9s49s49C89çXRa9s49s49C8:2+!a9R 59R 59C8;/@a9R 59R 59C8<eXa9R 59R 59C8=^Ǔa9R 59R 59C8>]va95959C8?Ȯ!95959C80 !95959C81 U!95959C82 R`"!95959C83 .x!9=69=69C84 CAd!9=69=69C85 Ɵ!9=69=69C86 B!9=69=69C87 F|!9=69=69C88 t?q!96969C89 J !96969C8: m51!96969C8; !96969C8< bː!9n79n79C8= >eO[!9n79n79C8> b~!9n79n79C8? 4a9ٟ89ٟ899Fa9ٟ89ٟ899cMa9ٟ89ٟ899;a9p899p8999::!9p899p8999 !9p899p8999*!9p899p8999ܜ!9p899p8999a9i:9i:9a9i:9i:9Pa93;93;97a93;93;9a!93;93;9!93;93;9e/c!93;93;9ӭ!999M?&a999Ya9-19-19R!9-19-19̤J!9-19-19Za9Zb9Zb9L|a9Zb9Zb9{r!9Zb9Zb9(C!9Zb9Zb93a999pA"a999IL!999'C!9,9,9'zigm99'9' Ttm9'9h 9h  ( 0 8 @ H P X ` h p pVy9 9+S 9+S bس<"9 9X 9X e:$T9 9 9  {h9N9 I9 Ix PPD 9 I99z99z +799z99z99z/tmp/disktab.shadow(999/tmp/fstab.shadow9f9f9f/tmp/resolv.conf.shadow-"J 9f9f9f/tmp/hosts+ m9W9>9> ;*999 w8 9p99 P199999 "f>9t99/    ! 9949/ (  Ucc9e9/ 9/ 0 8 @ H P X ` h p x xC %Vqxj4) ZN4%B$gFsΥxv- ?;GI\3szL/^ "吓u҄m}PR DZ(v ៌x ѣ*"w,UHq)­'S}i~<  QPf @SLEHK@K0ʒUa[̨#Fn{o1hlz W"Q&8obA@@81I:px)xou$\OH)nRg]UrZ5FU0j(,H9݈4KɄL4yl@N . .. installbootbiosboot_ mbr`boot  . ..chownchgrp . .. bin dev etc mntmnt2 kern sbin tmp usr varl.profilem install.mdninstalloupgradep install.sub . ..misc . ..ktermcap . .. tmpdb ... ...He[^_ÐUx1tu u1Ux1t u@ÐUx1tu u@1Ux1tuu u@ Service unavailableUx1tEPjjB ЃuEt P\*1USE] 1Ɋ8ut@[instbin%s: %s not compiled in U WVS} [t8uj/7+pu7<t'PVxu;tWuCVhhh|*e[^_ÐUVSu] pSNVFe[^ÐUsage: %s ..., where is one of: %sU WVShhh|*(E<=<tW>ӋE؃OEhh|*]6hh|*>uhh|*juinstallbootfgrepegrepgrepsortgunzipgziprestorershumounttipsttysleepsedroutermhaltrebootping-shshkshcpiotarpaxnewfsmvmount_ext2fsmount_kernfsmount_nfsmount_msdosmount_ffsmount_cd9660mountmknodmkdirlslnmorelessinitifconfigfdiskftpfsckfsck_ffseddhclientdisklabeldfddcpchgrpchownchmodcatUuu uUbenstuvusage: cat [-benstuv] [-] [file ...] stdoutU WVS}] hja$XXXXXXXXXXXXXX 8L1111n1`1T11>jh$*=(1hh|*jrhSW54Ã=1u-=1u$=1u=1u=1u =1t SL Sh$*Jth6j 516rstdin-r%sU WVS])1u;tZƿt7hP)ƃu#3h 1,u1V*)t V~;ue[^_%6d UWVS}EE P  uv=1tM}u: ,*x$* $* h$*j )E=1tI=1u@EEP=1t)EURhh$*~0*@E uZ=19 ,*,*};<*|$*$$*$h$*j$Ei =1 ,*,*};<*|$*^$*^h$*j^ ,*,*};<*|$*I$*Ih$*jI=1? ,*,*};<*|$*M$*Mh$*jMAe ,*,*};<*|$*-$*-h$*j-ӡp,D  ,*,*};<*|$*^$*^h$*j^?tك@ ,*,*} ;<*| t$*ʈ4h$*Q: ,*,*} ;<*| t$*ڈ$*h$*S t2ދGPWЅ}WzG @t$51h 1g 0*@th6jne[^_U WVS])p1;t]ƿt7jjPvƃ}(3h V145)1V2)9t Vi;we[^_bufferUlWVS=2*=1EPWOt51h jbE=s1PK`1uGhy"j(1S1PWah}h6j)ƅũ5151EPdhÃ}51h  1e[^_Uuu uHLPRXfgorstuwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %sfts_readUB9u6zu0K4'h#VEPA,44)E}E}t1}th#jYtE}teM<wip#jEPSƒ} p#"=p#tSh#jE8tSh#jxYUE+SEuSh#jIYEjEPV/@ǃujj61EEC4H $'P'''h''('''''((}uZjSWGIsUPsh$ߏ %s1Psh$軏 U}uC<@PEP%EPsgt}us|WBÃ=p#th$jVgusage: chmod [-R [-H | -L | -P]] mode file ... Uh\(h|*xjfUuu u$Id: chown.c,v 1.12 2000/01/14 03:08:03 ericj Exp $HLPRfhthe -R and -h options may not be specified together.%s: %s%sfts_readUWVS}] h)jM8xoƒ1E)$)*********\****l****x*************************ECE16E1*11Eh)SWP'4)ǃ=1t+}th )j Ut}t11=1tBj:38uj.38t@P3> 3 jWS;ǃujj 1 C4H $++f,f,,f,f,<,f,f,<,f,`,`,=1jSW_BsPshA)/ +sPshA)  l}te}t 5151s bu ?5151sct!=1ushH)赊W=Ã=p#thK)j/ VGb%s: invalid group nameUS];tgS/t @1Mj EPSƒuShH)j E8tSh-jR1]%s: invalid user nameUS];tgSt @1Mj EPS]ƒuShH)j# E8tSh-jQ1][owner][:group]groupusage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... U;.=1t+.P58hL.h|*ij`Uuu uHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%sUWVS]xh.j 1Dž4Dž8Dž<0)E0@,*x$0111011111011111111111111111111<111T1111111x111Dž<Dž4Dž8Dž8Dž4Dž<Dž4Dž8Dž<e1Y11CFP>11 11Oh.E PSe Y4)ËU U =1tJ=1th.jN<u8u 4th/t {/t/C-=~Vhh4WVSI-EPhnuEH<UB<9Uu]A9EuUEphh4EUB<@%f=@ jREP6A%f=@t5E%f=@u'Urhh5E1A%%=@tI=H= %\=`=FSEP*>=1u?=1u6Urh\5jEPUR6E t8A %Ph}Ahh/j}E%f=@tp#hh/jP=1tjEp)FPVЅ}Wa)) tuȃytYtMQP1jhUBPhhƃu!hh :{MQ1hh1EPOÃ~5Sh1VO9uuƃhh :t{}Urh :U{u MQPVO=1tVEPttUB tk19B uaEPV05u3EM9AuBA1!%PVRthh :zEPLOVCO thh :bzx[^_readlink: %sunlink: %ssymlink: %sUVSuhSv/Nuvh(=P} t&hthh5=!hSNtSh@=y=1tv<1[^mkfifo: %sUS]} t$hgthh5='CPhOthh>y=1u1jS]mknod: %sUS]} t$hӈthh5=*sCPhKOthh>nx=1u1jS)]utimes: %schown: %schflags: %sU WVS]} Efc1C1MbCC)‰QC 1C$C$)‰1QhLthh4?wEtss WEOuEss hOt+=p#thh???wEfctCPWNu5CPhBOthh??vEp#tsDWNu?sDhOt(=p#-u{DthhI?vEEe[^_lchown: %sUEpp h\Mt%=p#thhA&v1Ð cp [-R [-H | -L | -P]] [-fip] src1 ... srcN directoryusage: cp [-R [-H | -L | -P]] [-fip] src target%s %s UhlAhAhAh|*j?MUuu u- CxGCGC0JBGBG@@BGBHB(HBLH B\H@@B|Hskipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qdU VS32u51:1uh Cj#;j=PaÃu51hCj:C;u51h-Cj:1Eh\Gjj h,BEP~ƒ uuhCj: l3#B tuhLCju: J l3SBЃ1l3t. t$l3l3tth|Cmql3tFuhCj9=2uhCj9PtNt3lt\!t0t l3t3P& l3t3NhCj}9=2uhCjd9t3M=2t =3uhCj9921ҋD5DRPVST щ¸,2@97u9,2w-31RPVS' щ¸3@9 u"93vDDRPhlDj8e[^ÐUUE 02TIÐUu32ÐUug2UuOD2u jÐUu#`Ul3uu2ÐUE$2ÐUl3uu3ÐUE3ÐUu33ÐUu,202ÐI TUII TVI TWIIII TRI TSI TTIIIIIunblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combinationU}hIEPEhJjjhHEPj ƒ0uuhIj5 l3#Btuh Jja5 J l3B vp3lÐUUE 02E%s%s: illegal numeric value%s: %sUVS]jEPSƃu51hJjU9u51hJj423UVSp3t 522KtNs5 2292P9r9x u J9r-: t9r$)ZSV53A3333 3393r j2Ƌ2)‰29s2tP2)‰P5 2 A2 22e[^%s: short input recordUS=2tw5$2hQue 22B9r8z u ʐH9r*8 t9r!)ȍXSQ53u@3333 3]    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxUS] S0hcjp2hcja2h0b w `=`uOj6stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput bufferUVS$2u$2X(21jjP'(2}5$2hXjh 2=`v 2uhXj_&3u33Yhm3HuPR芌3}6hm3HuP53W3 3=3}53hXjh|3l3u823HP( 2uhYj|3]229s2Pd( 2t 23PD(|3uhYj! 22|33,2 02t3 3t l3%h=`uD 31ۡ3E53U3EEURP53N@l3!t_t.1һl25p3 2DABv}1һl25p3 l2DABvQt'1Ҿl2 ŠDA2Bv&1Ҿl2 lŠDA2Bvp3l2hh2e[^ÐUVS]hPs,tshXjwp%f= u+sEPhm8@s/tS&jjjs~/uu =p#uKX[^ÐUD2tL2H29l3t0t52j 52j52Z152525(2.u2Wm3u5$2hXjN5$2hXY< 2u7j21RP5(2f.щƒ t5$2hXDYn32 29u22H2,n3t22 22L2l3t&23j2dt#2t\2HP2PP9 22t3#ÐUt3=Mu =Nu =Pu l3tF3tO39s3t )Pj )Pj53M/33=3t j%s: end of device%s: short write on character device%s: short write on tape deviceU WVS|3E}t =3 =3bT293t)=2u 253h_V3t53h`jN)ރVEP53*ÃE%f= tf=`u EP3 oEPR!uu]=StD>u3h"h:LKD7DP7uEDP3hPh LǨE3hhL;E3EuE9E}*‰߰эA;E~EèJuރ} E }tEPEPV EPEPVjE#U WVSjEP19}51ۃEPEP$u ]CTèF9|1e[^_ÐUVSuu@=3.Ã;tj3VG#t؃;u=3%e[^empty type listU WVS]tuhljpB>Cp=CWVS5t*WVS_tWVSt 1e[^_ df: %qd: %s U WVS]u}jE URPSRWVS 9t<p#t,QmPE URPhvh|*詔1e[^_Ðusage: df [-hiklnP] [-t type] [file | file_system ...] Uhwh|*<jbffsU WVS} uh h3jh u t =$9Tt 3F3F3F 444^Ed4)E 3EEQE)))ʉV34F4FF F$W0uwjZPFTPjZWPjhwFDPFS1e[^_lfsU WVS} ]h h3jh u t3=3bt 3C3C)3C )3Cd+ 4 3QS39v‰S)C}C3C3,4CC C$Wu(yjZPCTPFjZWP4jh)yCDP-CS1e[^_ext2fsUWVSuhh3jhuD tf=4Su =4v 3lj~ 3F31E33)ڋ 3T1E}D1MDEá3)؉F 3F+3F3F3FF F$U RbuzjZPFTPjZM QPjhzFDPFS1e[^_Uuu uRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenrs:tvw%srioctl DIOCWLABELUWVS Dž`1t}hl\,8$X~(~~~d~~ DxLt~T\b*#b# =tzGDžh=tRG=t2GDžhb=tFg=tFK5#A91=tFĢ bFh|U RMQj 4)EU U =bt=u =u }~%=tb t=tEM bhj=%PRۧ d}5h}j赶dP H)$Tl}tAEdR Ãu j_dQS|&}tDdPÃu jV5dRS file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: lseekreadioctl DIOCSDINFOwriting label to block %qd (0x%qx) writeioctl DIOCWDINFOUWVS]=tHh05bhTx05bhe0hԅX0S:WEVǃWEVfǃS?f =V tGQB[<vu8QIB B B c(`dh'h$* )BHJȅ}RF))ƃ tGtB)GPWЅ}h))) tuăytYt jDž`Džd=buj`dRPUR}hCleE PUR;thI`ߍle=Ģu7ShfdEP}p#tthN=bt8`dd} RPRPhtj =Ģj`dQRMQ}hCDžhhPhmdEP}h}yU RMQi;u0=ĢuAt85PEP9;thyDžh=ĢuihPhmdURa}Jh}=y;=Ģu/ShgdMQ-}he1H[^_Ð%s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskUUp#t5tLt7t@Rh*>RhT*.Rh*Rh*Rh}*can't read master boot record# using MBR partition %d: type %02X off %d (0x%x) size %d (0x%x) warning, DOS partition table with no valid OpenBSD partitionU WVS]jjjS|hhSS=whjifUfEfUf Ej@hShUAST9~1S 1A A A t y{F~1S 1A A A t y{F~1S 1A A A t yH{F~f}U#SA A A RA A A RSA A A RA A A Rh#SA A A RA A A RSA A A RA A A RhSA A A RA A A RSA A A RA A A RhVhԌh|*k{SUh4&S=1S 1A A A uF~1e[^_Ðreading label from block %qd, offset %qd disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%xioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFOU WVS=11tbK S A A A t>SB[<vu/K[A A A ùƉ׃=bt;} RPRPh4A jWVUR| h hEP=5h}j1=WEVu/WEVu#fw)S 4fu,hs$wC;WEVu0WEVu$fwS3f^vP#1=bt'hsd UR"}hjD=t/ȢShrdAEP}VhjȢShedAUR}'hёjߢ-Ph"؍e[^_%s%sboot%sboot%sNONEbootstraps: xxboot = %s, bootxx = %sBootstrap doesn't leave room for disk labelUWVSE x(u@(ǀ UUM I(M}1e=b=btEE=T5j/5bu bAU”Ut(Atӡp,Dtݡ=buiVhhk5@mj5 }>ruFbVhhkPm=b =uiVhht5lj5螧 }>ruFVhhtPl= =bt%u}P5bht j5bOÃ}5bh}j U r(MQS}5bh}jٟSj5Oà }5h}j衟U B()REPS}5h}jhSwME9s9thԔj A;MrEe[^_\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%d:ns#%d:nt#%d:sc#%d:nc#%d:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%d:%sts#%d:d%d#%dp%c#%d:o%c#%d:t%c=%s:t%c=unknown%d:b%c#%d:f%c#%d:U WVSE xtPjhURsE xtPjhURrEPhUoU fzwB4h:U BPh>EPr U r(hIEPrU r,hPEPqrU r0hWEPZrU r8h^EPCrU r4heEP,rU fzHtBHPShlEP r|U fzJtBJPShuEPq|U fzLtBLPSh~EPq|U fzNtBNPShEPq|U BPtPShEPvq|U BTtPShEPTq1] \u ƔtPhUR'qG~1E f>aUhEPp6]ShURp vShEPpF t5<wF 4 ShURF PShEPpF t6u1F FP]ShИURTpvShؘEPBp GU 9!EPj URe[^_ÐUU lf|PKt %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %dUWVSu} MEEEuElDBE  $DΝ؋1҉EUG(mEUCmEUG(mʉEUm؋1҉EUmG8EUmCEUmG8EUme؋1҉EU$؋1҉EU؋1҉EU@m1w(1҉EUmCEUm ɋaEu%؃sQRQEaPh;Vm 2ɃURA$PR$PEaPhKVm0{ wC 4 hc C PhiVamC t t!Ch|C SPRhmCPC SPRhVm h|hVl}t(UM)PhVlW8C1PhVlC1w8t&FPVЅ};F| *7Vj*&FHNȅ};F|  Vj qbCW8D1HPhV lC1w8t-FPVЅ};F| *Vj*bFHNȅ};F| )Vj)aFPVЅ|  Vj a؍e[^_# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: offsetsize# %*.*s %*.*s fstype [fsize bsize cpg] U WVS}5hWtiE fxwB4hU BPhW:iE PjhW#iE PjhWih͠WiE @XthԠWhU BXthߠWhE @XthWhGPWЅ|  Wj ^E p(hWvhU r,hWbhE p0hWNhU r8h*W:hE p4hAW&hU r)CPSЅ}W)) tuȃntBNt=t4h}hÃhh} hX[^_sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/shUWVSEȩE˩EEhΩÃuթ߰ҿэPƃuh 1hShVXujj<jj0jj$ =p##u7jEDž|uAEPhj>hW VE FVo]쐃jSWHHUЃuR0Ӑũjjhjj\jjP}%e[^_ US]hS À;t1]ÐUS]hSpÃ;tChSĒ À;t1]# line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sU,WVSDžDžE ǀ ǀ h+Q:tP j:RuQh/v @PEE1t u Džb|%hJRXu DžG|s.tQP" rԃP荖vRQhTU fB |Dž9P- 1t u du Du $RQht 8CU BXn uu1ۃF 97 P‹E \CR  8 ~ PhQ-uIHv%PhƬU fǂ M fw u Dž|ujPE P* ujRE Pɰ uQQ螓ƒ~tPRQhU B(uIQ6!PRQh0U B,1uIQ֒!PRQhU B8.uIQv!PRQhpU B0q> uIQ!PRQhU B4HuIQ趑!PRQhU B<VuQQV!PRQhPU fBHJZ uQQ!PRQhU fBJe uQQ膐}!PRQhU fBLzo uQQ}!PRQhU fBN| uIQ趏}!PRQhU BPuIQV}!PRQhPU BTQ<yPM 9r-vPRh@M fM u PvRQr })PRhu%QhԭfP+R })QPhjFu F R Xs)tQP‰t;Xr؋p,Dt+R ^ FDžv(QPhTDžF F tRQmF uPhԭhR_Q 1vF :uPhԭ RQ躋F uPhԭRQb 1vF uPhԭ]RSQfF ;E fX&RQhEPhRM Q%[^_sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %dUWVS}E(ujh,',ujh;0ujhLK4ujh_+EfHujht 8u G,G0G8<u G8G4G<ujhE1w(thujhE1w(thzfvjPhTV1faE;uCtPEPhG<9CvEPhԽEC;G This option is not valid when run without the -F flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.yWrite the modified label to disk?Write new label?unable to write labelRecalculated free space.Name of the file to save label into.Filenamecannot open %sNothing to undo!Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) UWVSDueDž4}t[jj#@4t2jj @0tjj?,uhLjEPhdDQ4@P uGƅ) t7 ,*x$* $*h$*j ߰эytA< u?uURwe ?'<*uuuM$ODPσ wy$hE@8/UJ(ى%@M1q(ڊ<+t<-u p#PRZ=p#"uؾ8tp#~ ۅ؉ۅٽff f٭߽٭ƀ+uu-uE)ƋU$1҉M߭A8߭ٽff f٭߽٭t:EP8t0+;EvI+9tƃVhET[^_Ð Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] U,WVSPEP fw2R V19_9B ;A|}tl+}l+]CaPwaVhRha jjWjURh$*>jjSjEPh$*& }99PRhDQƅh)hV觢 u0 ,*x$* $*h$*j  cuƄ00U V*EPU RuV2C;W9/P1[^_ÐChanging device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).disk typeIDE"%s" is not a valid disk type. Valid types are: "%s", 15 char string that describes this label, usually the disk name.label nameThe Numer of sectors per track.sectors/trackThe number of tracks per cylinder.tracks/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).sectors/cylinderThe total number of cylinders on the disk.number of cylindersThe total number of sectors on the disk.total sectorsYou may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.rpmThe physical sector interleave, set when formatting. Almost always 1.interleaveUWVSlue5hLUB4Dh$hyPƃhVHt&Cw 4DVHuVhXLh$*h  4Dh(L wh$*h Cv ,*x$* $*h$*j 5MfY˃Shh%IƃuP&h|*h> )Ћ} =h|*h }lejVSh}G'jjUB,PPhDhdjR0à tuh|*h 뼐MY,jj}G0PPhhjWà Luh|*ha 븋EX0jjUB8PPhhjRà uh|*h 븋MY8jj}G4PPh$hOjWFà uh|*h 븋EX4599)ڋM 9[PRhh|* jj}W4RGruFh8Ve31tPV蠏u\]UBfHfou T hCT hX~ED4h`E wh$*hCvMfAEfXh$*j iURhdhƃthVAt4V@tCvVhDh$*h; 4hxD wh$*hCv ,*-$* $*.e[^_ÐThe start of the OpenBSD portion of the disk.Starting sectorThe size of the OpenBSD portion of the disk ('*' for the entire disk).Size ('*' for entire disk)UVSujjv<5pZhhjVa t>V<9sЉːjj)RpZtZ)‰PhhKjV# uh|*h&V<)9wى tZpZu Ve[^UWVSEPupƃu3YpZYtZYYYExtpZY@YE1E9}|EYtZUUfUM{9})PD;Ps:ED@YP;UsEUYEE9|EǀYǀYVq~Ye[^_Ð Treating sectors %u-%u as the OpenBSD portion of the disk. You can use the 'b' command to change this. U WVSpZEx<=tZ5VB[<v VNB B B pZ^ V C C C  tZ} tU ;BruqFPEPh5$hS苢r ш h2jjQO]hu!ǃ u ~1ۃth1.uPM45BaPPh:$W; C 5uWuh2jhj]ÃuhLjmLShrdAVAX}&ShedAV+X}h2jME EEEEDžljjlVhPj]S[ uh 3>ih hEEEEDžl jjVEPjS5[ uh"3̂Vhj%ƃuhLj5KF(]܉^,M؉N0UԉV4F8ӉV<7H[^_dEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometryBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. U WVS]}uEu7h5h$5h5uh|*h3$67878888888888888888,88888888888887878888888888888888,8tdG(C(G,C,G0C0G4C4G8C8G9uLBUE9uUM 4S ff@\fPhT9ƿv9u`ƿy9udƿ|9ud8-ujzh9jT%ÃuEU 4h9h911jEU 4C P `CL"`EM9Mf=@\u4h9h9Khu f@\D @f@\}j@\fHffdhezedfeee`j-j 57&`u&jh9jm+jw2jRÐ="t{Lu;jh9S5+CP@tPh9Se-S!2u="Pi`tCP@Suf=o1e[^_ÐUsage: dhclient [-1] [-c] [-p ] [interface]Uh4=ÐU5"ÐU WVS]SPt@0t SpcBCP0SSPB@B,{P"SPeB0SPB4CP@8Sse[^_ÐU WVS]CP0SfSPB@B,{P"CP@SPeB0SPB4Sbe[^_ARPCHECKcheck_U WVS]Sh>2qShM$qECPp tl>}uRv,h>S(Vh>S*S/u u#VSSU V"uCP@}uCP@SEu\CPUPCP@ e.PCPPB@ȉBCPPB 'ȉB CP@Sh{P"CP@SPeB0SPB4EPSSPB@B,UR!SKe[^_DHCPACK in wrong transaction.DHCPACK in wrong state.DHCPACK from %spacket_to_lease failed.U WVSEX(SP@9B,thQ@wdBt!tttho@M:uPh@$EPƒuh@tCPPShSnCP@0‹CP@PCPP t‹CP@PBBBCPH tɾ‹CP@P !Q4Ѕ}Ɖq CP@ePCP@PCP@P SZe[^_REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.U WVS]CPP@8B,CPpS"SPBp,BttQBuJB XB^BRS$CP txtRhdBS&CPphiBS&CP@tPh9S&Sp+CPt PSPBCP@ShCCPpxkKPeR)‰P 1l PhtBCP@ h7,e[^_ÐU WVS]CP0SSPB@B,SPuBCP@z"SPeB0SPB4CP@S e[^_U1ÐU1ÐUBOOTREPLY from %s rejected.U WVSU8B(@P,tasuuٺ0t&uPhD{uEPe[^_DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.UWVSUBtd ttEFEfEJELEpE:u<PEPhEsE@EyEUB(@P,t=suu蕹0vuăEPUҍe[^_BOOTREPLY%s in wrong transaction.%s from %s%s isn't satisfactory.%s already seen.ARPSENDUWVSE@(EEFUtEfEMQPzu u@9B,tEPhF8uٸPuVhFV1ۃ0EpPt' E4<C< uًUBP@/Myuȃu>`EEũUR<Euh@cMuuN0UBP@8MA,PhFRsuVh>EP!URf&EMQPZ0N;u*uBUMAPPGztEe9~EuEPPBu r8uUe);E}M7uVLEPhF8URhF$MQh>SeuVhM}fe[^_Ðdhcpoffer: no memory to record lease. dhcpoffer: no memory for option %d dhcpoffer: no memory for filename. UWVSh48ƃuhI11 E]}4;tE@P8V8U#4;Mt 8PC;T34M E}~FVMjPRRCEt uaUx,tV1ېC?|,uCP7‰V$uhJM,SPRBF$Et uzUxlto1ېC?|luCPw7‰V(u+hJ MQhIWV"1MlSPRMBF(e[^_DHCPNAK in wrong transaction.DHCPNAK in wrong state.DHCPNAK from %sDHCPNAK with no active lease. U WVSMY(SP@9B,thLBt!ttth2Livq4PhJLCP0uhtL5PCPShSbCP@Se[^_No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %ldsend_packet: %mU WVSuVPB0=e)Nj;~V!zVPB8tB81ۋFPx8u11tF PhgMFPP8SFP@8PhMFPp8hMVV uVPz4uB4%~ËNPQ4Ue1uA4ЉA4FP9P4~S}ËNPE1q4UQ4VPz4uB4NPeQ4A09~)@A4 FPfxD FPf@DFPp4efP5eTPF PhMjhe5`FP,CPp,hPS CP0hiBSYCP @tPh9S=SuzSP e;H}:BCP@)PhPShCCPp\ BhPS YSPz tcCPP :t:utSPB SPB B CP;Et}uE=dtj<B CPۃhPjh QSCP @tPh9SSCP@Sh,>CP eP[ e[^_EXPIREDHCPREQUEST on %s to %s port %dUWVSuVPB0=e)NjBtu.;~ FP@VhS\zu9z8u3@,t*PhMVV uFPR,P8VPztp@9e~cjhWSVoFP0hdBVFP @tPh9VVHFP@Vz4uB4&OxËNPA4Ee1uA4ЉA4FP9P4~6xËNPE1q4UQ4NPyt0eA4R9~)BQ4VPzt @ 9e~ E BEdfEEEVPzt X1ہfzDfBDEfPuNPF PhtS}t(jEPSFPCP@?r‹CPP@CPf@DCPf@FCP@HCP@LCP@PCP@TS KPXC RPQ3[^_ÐUWVS]ƅ1{PCP@?SPB,B@CPf@DCPf@FSPBwHE M qPRm0BHCP@LCP@PCP@TS KPXC RPQ+0[^_UlWVSu] ƅ1~PFP@?VPB,B@FPf@DFPf@FFP@HFP@LFP@PFP@TV NPXF RPQ-[^_U\WVSuƅ1~PFP@?yk‹FPP@FPf@DFPf@FVPHE M qPR,FP@LFP@PFP@TV NPXF RPQQ,[^_ÐUVSuF$t P!F(t Pv!1ې|04tt08X!C~܃VC!e[^wcan't create /var/db/dhclient.leases: %mUVS4\t Pb;htb5"4\uhb[5`t=FPX tSVuFPt PV6uŋ5`t>FPX tSVjuFPt PVN6uŃ54\ e[^lease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } U WVS] C0+=4\u/htb5"4\uhb9hc54\ۦC0thc54\迦E Phc54\袦s覚Phc54\y@C(tPhc54\[{$ts(hc54\<C,tPhd54\11D4t-jjPt8W֑P4u-h"d54\0G~CP诇ƒ2rrr B@PBlPrh4d54\薥4C Prƒ2rrr B@PBlPrhtd54\Y4CP5ƒ2rrr B@PBlPrhd54\8hd54\ 54\e[^_/tmp/dcsXXXXXXcan't write script file: %m#!/bin/sh interface="%s" export interface medium="%s" export medium reason="%s" export reason U WVS]EǾ)gfP``ƃuh8gehtbV$3Duh8g;hTg5Dݣt-C Ph`g5D迣hpg5D謣 }t0EPhg5D艣hg5Dv u hg5D]hg5DJe[^_%sip_address="%s" export %sip_address %snetwork_number="%s"; export %snetwork_number broadcast_address%s%s="%s"; export %s%s %sfilename="%s"; export %sfilename %sserver_name="%s"; export %sserver_name prepend optionno space to %s %sappend option%s%s="%s" %sexpiry="%d" export %sexpiry U<WVS uP] Shh5Dա,Shh5DEPt-=ujS ԃhs诺S]not allowed here.hardware address parameter %snested interface declaration.expecting a statement.semicolon expected.UWVSu} ]VEEP&>I)$LuDwlxlxlxlxlxlxlxlxlxlxlxlxlxHxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxlxtvlx|wwwwwx(xlxlxlxlxlxlxlxlxv,wlxPxwlxwwlxlxlxvvwlxlx`x PV4$SV"P SVP SVP SVP jPVjtGPVsShtht"V1PVP1@PV$: ." PVV# thtWSVejjVPSVAhtVVEP:;thtVe[^_Ðexpecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataU WVS]S}W_:ww1S}W9jjuE P% F;ESW:ƒ:uSWt9ƒ:tE E~u@SWN9Uװэq;M~ hy0QRE P4h0yhx hx+S1e[^_expected option name.%s: expected option name.%s: too many options.expecting semicolon.UWVS1EPEEP]8=~=t =tuh~z1۾-Cu6ut4E Gt1EPEP7,a;u 7hzuhz hz׵EPo1e[^_Ðexpecting interface name (in quotes).expecting left brace.unterminated interface declaration.UWVS}WlV7=t h{ilÃ{Pu SCPuu ScL"WV6{t(h{軴WVJh|裴;WV6tރ}tCPSWѐWV.6X[^_ÐInsufficient memory to record interface %sU WVSu`tVC P%up`tVC PuLjTVÃuVhP}s1jVC PU``؍e[^_no memory for state on %s UW}h GPuG Ph&~P1}no memory for config for %s UWVuh0p‹FPFPuF Ph~yFP1FPu e^_no memory for lease. unterminated lease declaration.UWVSEPuV3{th{URh4Ãuh豮1 U C0$ЈC0EEPV3#}tEPSURẽMQV;3EuSxPu P} uE@PXUBP@ EE}tHMA;Cu΃{u1t U RPMB EPM} tUBP@ BPX mUUBPtUe9B|J;Ku+r{uR+h0k!MAP@ EPPB E@Pe[^_expecting lease declaration.U WVSu] V}W1:$܂hxxxxxxxxxxxxxxxxxxxxxxxx$xxxxxxxxxxxxxxxxxxx8HXxxxxxxK0VW0=th{u‹ECPVGjC,PV) V' C(V C$VCvV C fVCVC4PVCEhP V VEP/;thzݭVx e[^_Ðexpecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.overflowoption data buffer %sexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.U<WVSDžDžEPVm-Ã~t tu+hЃv;(UR QǃuhWuURVH-à .MQV,EPV,à ~t tu*hP豪;cUR=RjWh,eu(WhooMQ`jpҡu-9u Wh WPhWp 2$@0@+P*PMQ}WP*Ãװы\C=/QRP.DžXPEP Ӂ/RQPEPP)Ãt,hϧ;UR[pj jSMQPE)ÃujjSB}WP)ÃPjjSbكEPP(Ã~t tu+h¦;tURNch*!th/u ƅSh2th8Ƿu ƅh<PPhP蛣MQFtAu ,;trht蝥EPMhф臥UR7hhjMQhhN}W1S‹A } TA |uhɡP SPM tG M [^_Expecting media options.no memory for string list entry.U WVSU t6Ã;t<;u0h'EP1 ,URuV%=u}эAPrǃuh萠uGPnt;U :EPVL%}g;thzeURe[^_expecting IP address.no memory for reject list!U,WVSuVEPuh?UR{jvÃuhU蔟{U ,,MQEPY$,q;thzsEP e[^_U WVS}1W]S$}utLWS#Nt<%{uF;ut uWS#WEP#ue[^_semicolon expected.US]SEPy#;u h蓡S.1]filename must be a stringno memory for string %s.UWS]SEP#=th !SV}Qǃuuh'距uWkSt1e[_Ðexpecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.UWVSEEEP]S!=~=t =t,u'=t h蟟EP71"}Qƃuh42uV'jEPVrEMEPSa!.uEPS . EPƃuht貛E\0}t_E@EEװэA)ÃPRS\E0EPEE9tK.}ue[^_ÐUE jj j.PPuu1Ðexpecting a network hardware typehardware address too longexpecting semicolon.UWVS}u WEEPq=t =$t 'htwWEjjj:EPjWà tj}vSTh'!EFVPSRS$WEP;thW}e[^_Expecting numeric lease timeUVSu] VEPa=th肜V+j j uSffVe[^Ðcan't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.UWVSE EEEuWMtNE…}PEu/hThdƐ}tvEP}WÃ;]tLU:1}t{tMQWyÃh蟚;tlEP/^URWCMQEP0ÃJt.}ut h7EP17t(URMQuV[E}ƃS}QÃuh螖uSdURSbmE EEM;}EE}PEuh0UUE})ƋMU EXURMQ0VnE})ƃE0&UR]uEe[^_Bogus number: %s.Bogus number: %s: digit %d not in base %d -value %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %d U WVS]}M E19-uEAud90uWAW0uHEWVà /t)h̒;W[WVnÃt)hԜ茒;Wu腧EWV à t'h>;dWVu9E܃WVà :t*h;W WVÃt)h@贑;WCu警E؃WVHà :t*hi;WWV Ãt!h@(;tRWGu)EEEWVà ;t hאWr1]SҍC} 1U~ ]u܋}؉}ȋ}ԉ}̅t, d$ȍD@Ɖ)‹Eȍ)Ѝ&ȍD@Ɖ)‹}ȍ)ЋU̍e[^_attempted to reinitialize icmp protocolicmpunable to create icmp socket: %mUnable to disable SO_DONTROUTE on ICMP socket: %mU$S=hthphhd9 tXSjj]l}hԋEjEPjh5l3 }h蛋u h5lh ]Ðattempt to use ICMP protocol before initialization.icmp_echorequest %s: %mU4S]=huhEEfECEEEfEfEf]؃jj]S *PG*fEփjEPjjS5l>à }uPh$[u 1]icmp_echoreply: %mU WVS}DžPEPjhVw }hߊL/vFP쉕(u4_ t-EDžRV獵Ӎ[^_Can't create addrlist socketrealloc: %mioctl: SIOCGIFCONF: %mCan't get interface flags for %s: %mdiscover_interfacesrecord interfaceInsufficient memory to %s %sno space to remember ifp.same subnetinterfaces match theMultiple %s %s: %s %smultiple shared networksInterface %s matches %ssame shared network%s: not foundNo subnet declaration for %s (%s).fallbackfallback-netU|WVSjjjmE}h1ۉuVSsÃuhѤ蹇EEXPh$iUR'uhݤ膇U)Ѓw뗐=`t}t }t}u EE}uEE9U]MYCt<v}|8}E SuVTVhi EPm }Vh̆EWu }I`U M M}tSE PuYhjT=EuSh-h>PSE PAT`}EGL=`C<u5SBMA ABJ] DQPS<yCEЋSUԋCE؋CE܁U}HuICEPlƃuh[芅EPSVeUrHEԉBEUEԃjPR= uu1Ã0C uEC Cu0;Et(E PC Phuhh貅 [UBt"9thЃ Phť膅MYC u }{ 0;Et(E PC Phݥhh> E;E3}1`U"M M}GLt }u$GLEPHt@LuSUBL;EtЃ Phu``M`}=`uBEЋJMԋBE؋BE܉xu-}uQPE Phx Uzt MAX1{u CEԉC[u}WW EE`Ut)MQhԭq0ȃ P }?}uڃEPd\77d\CBCBH\pt@hD\! hD\hL5x\Sx[^_ÐUS`tSS uhD\]select: %mUWVSEEENjEEENjE󫐐dtFSe9&ds CСƐ)‰UE@EEu1dt&Sу C;E~EuڃEPMQEPuVE@PÃhe}h; dt/Ct{t SCЃ=treceive_packet failed on %s: %mULWVSE@ EăuVEPhhEPà }Eă PhQtL=ftCEU̍EjPRVuEPShEPfЍe[^_UWVS]xt8E@E u,t@C0 C(@C0{0u1e[^_ÐCan't allocate timeout structure!U WVSu }dt,9su9{ tًt9su9{ uu"duEtË+ߐjÃu h~s{ ECdtU9P~d*#9tC9Bу9ue[^_ÐUS]E 1ɋdыt,9Zu9B utdt [Ðcan't allocate protocol struct for %sUSjÃuuhT}E CECEC dd]ÐU WVS}1dt-9u t dP؅uԍe[^_UE`PL`e`DÐUUBHJȅ}R =` uO`=u`e`ePL`W`uhk|t1ă\u뾃"uuh6|hde[^_Ðnumeric token larger than internal bufferU WVSEEhE P|}uxu Eq|O؋ p,TDu-t _tt D|#TuDt +|DDuU RPԟ`hFYuhzhde[^_Ðtoken larger than internal bufferU WVSMu  hѡp,DDu hCwBV$|-tƃ_tѡp,DuVQȞ`uhضyhdWPne[^_ppendllowliasbandonedackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringidser-classse-host-decl-namesnknown-clientsendor-classU WVSu} > DB $dȺLлTT`ľ,Xhh·^SGu F0 hȷS&u 6 hͷSu =hҷS?h۷^SÇu @hS袇u 7hS肇u 9khSbu "Kh ^S?u (hSu hSu *h%SކIh4^S軆u Ch:S蚆u 8jh>Su5~u :[hEFPO?7j hQSt~ u  h^^ Su hlSޅ!hz^S軅u hS蚅u hSzj4bh^SWu @hS6&h^Su hSu %hS҄'h^S评u hS莄u whŸSn^HVh͸^SKu A4hݸS*1hFPh^Su jhSh^S褃u ;hS肃r<jh^S_u BHh S>u 'hS#h^Su h$Sڂ&h8^S跂u Gh?S薂~hE^Ssu \hJSRu +;hQS2u ,hXSu .h]Su 2hbSҁu 3hhS貁u >hnS蒁Jzht^Sou DXhzSNu 7hS.u hSu hSu hS΀u hS讀u hS莀u /whSnu )Wh¹SNu 07hȹS.Ehѹ^S u hڹSu -hS$h^Su hSurhSju(Vh SNuB5=hFP/u#hFPue[^_UÐU/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mUt 6>u>G HP8tv Tu UT@G HrH0QWÃtu6ރ>t 6>u>!WG HrH05TUe[^_Uuu 5PWUu u5TnWU,WVSECP7ttECU;P}bECMEuuEP t} uUECM;H|g1e[^_ÐNo shared network for network %s (%s)multiple subnetsAddress range %s to %s, netmask %s spans %s!Address range %s to %s not on net %s/%s!new_address_rangeNo memory for address range %s-%s.No hostname for %sno memory for hostname %s.UWVSE0@EuOu0$l,P]S(, u08G,PShgZ0=Xu RX=\u R\=`u tR`uuu08uuV)$}}u08lupuV)uu'+\uD+Pu܉`Vd'( p+PẺ\P7'( ⋅l׉*P]S'$hS\P`RhX u0$huL*0ui*Pu܉`V&( p<*PẺ\P\&( ⋅l׉ *P]S3&$S ⋅h׉) P\P`RhW 狵l狵p)E(狵lu(E0u9~4E狵l狵p(E0h-uu})}E@|PTEugu(Pu܉\V%( 狅p(P]S$,S\WhDV|҃PjMQu~u}~E|9E]DždEEPu08u0$uV&dU|uC0C(C,u0sl}{p,}4t ǃ ǃCEU0BLxLjjEP ƃuuPhgqV W>QMdMD`u6hz^U6d}t7`H#UBCZtXSdutCP5\MÐdEE@9EvEd&}tu08s󥋵tV$$u08s%x(u0$狵t%0tzu9x|o}9xd}t UdM)xxS`}T`SdTdjSPCh-SR ]H[^_U,WVSHtcs$EEs8uPP#u$0tu1e[^_U,WVSEXtds$EEs8u P"uO$0t [u1e[^_Ðsubnet %s/%d conflicts with subnet %s/%dU%02xU WVS}t} u'ppBfABAHp1;u }5UPhS"߰э\ :CF;u |Cpe[^_ Lease %s%D %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s U,WVSuhPhJuF$E(PPhUj ]SUShaGFE,P PhUj S'ShlFE0PPhUj SShuE EvPUBuPBtP>PhE(MAhtPRhEe[^_packet length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02.2x:%02.2x:%02.2x:%02.2x:%02.2x:%02.2xfilename = %sserver_name = %s %s = %sU WVS}whbDCPCPCPPhBD0C PCPsh(Ds }Ph0D(sdPh<CsKPhHCs2PhTCC!PC PCPCPCPCPhpCClPhC,ShzC  t@11ېD;8t'jjt;4PV P4]-h@C0F~Ńh$Ce[^_%03x: %02xU\WVS} 1E19}ku0tEPTBVh4EPuD+ CUPh:D+PF9|EPAe[^_hash bucket %d:U WVS}te1Zu<3tGWhA3t/CtPssyAuGE;8|e[^_cScU WVS]{41dtC eCPPS { tBt8thlPStj@,PSe[^_ÐOption %s length %d overflows input buffer.Can't allocate storage for option %s.Can't expand storage for option %s.UWVSE EUUE8M9vEu @EPURUMD ;Ev&R-h$?E@ 0U8U<u\E@P˒ƃu-hd=EMQPV赝E0UD4M4E4EEU@P`ƃu-hu=M4E4VIMEMQPR-EU0M4oE4MULME8t U9MA e[^_ULWVS]t=t3P>)*v*}t@ƅ5ƅ6ƅ3ƅ8t6t,C=,v(SRPC 5>h=P>u]tRVPPu~tFyUt@PQdU  9RQRPd9}M Ƅ)E ƀ4ƀFz9~ U Ƃ M ƁE WRPDžtk):u lSPV襚؃80@.0@~!} l 󥃭tP9}B)ËU ,SPR'؃?U l@?~[^_ÐU,WVS1lj󫉵;uEM<RwM@}$t" -8tuDž DžDžUL2tA;u9MOE\QPSĘ>UD)UULWRQ莘)t0tq=~;u};E~M(!;u };E ~ U (ʈD>;E E9%[^_Ðpretty_print_option: bad code %d %s: Excess information in format string: %s %s: garbage in format string: %s %s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array %ld%d%xtruefalseUnexpected format code %cULWVS1EuEШ] }vEPh36E }tE,EE؍UUMˋEԈ MĊ¿ƒ3=$PhM؋EUEnMExDFEE:OUMtD E4/'F!E -P-hg5Eԋ} -EċUԊU˄t$}SEP-h$5;u~ MQV-hD5l[}u!;u}E)P-ht4}u EE܃}~(E;E})EUR-h4}}EEM9M1;uU6@$        X                            @      |   }t E"@EЃSUR߰ыUЍL MЃ}t"AMЋM!SffP|PEP*0SPhURSOPhMQ SoPhEPSCPhUR ~PChMQnbPChEPVJPChUR>2CtRMQJPh2}аыUЍL MЍF;E} }:t AMЉ;u^E@;E} MϋUЈ BUЉEԋM9/e[^_ÐU WVS]EPu V芐1 󫉵EuEM,SO tt t SJG SkF[^_UWVS]EE ;E uE19}D*"D*$D*B;U|ߍu[^_U,WVSE4ffE]߉]]u UJD*$tL}8>vE}uDN|<9tE}u$IyD.D*D.D*JNy}E[^_UWVS]E ;E t E$19}ƊD*$ D*D*B9|E Eߍu[^_U(EE19}D* "D* D*B;U|ED(ffUWVM;Muu } 1^_.%s%dU WVS<}u߾f1;u}>D. P/t-Ph0S߰э\ F;u|Ÿ<e[^_UEffÐUEffÐUEfÐUEfUUE ffUUE ffUUE ffÐUUE ffattempted to reinitialize sysconf protocolunable to create sysconf socket: %m/var/run/sysconfcan't connect to sysconf socket: %msysconfU|WVS]=`th\:,`jjjq e}h,E}󥤍u}эQURV5 ed;}U=<uhw,<5 ed`Sh$eC؋]enter_dns_hostCan't allocate space for new host.U WVSuhXj#Ãt%hXQh#uhh'V3xCCC C؍e[^_tree_constNo memory for constant data tree node.UVSu h#ÃthV"Cuh(&Vus袆s؍e[^tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.U WVSu} u u>?hGFP!Ãuh%vvS覅FwwP蒅hv!hw!^GFhW?%4h!Ãu hE%s{؍e[^_tree_limitUVS]u ;u 9s~s#h5 !tXp1e[^tree_evaluateUWVS]ECEECPEEP}WuVC E;ECbh P: Eu1HEEEsEPWVQth Pf EECECe[^_Bad node id in tree: %d.U WVS}tM ttStjwEPE PEPwEPE PEP9rnwEPE PEPZwwEPE PEPj5_EwEPE PEPPƋEhX #e[^_%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookupUWVS}G9e wN7蒪 Euxt#t*tXt/t>K7hL ":7hh "&7h "7h "e<1UB8t F<uEX 9w }Mh Sqƃu_ u/e Tj`UWuh@E Ph@hh<}h<\ P,="t3<װэAPRj[jhL.j[1}ÐUWuh@E Ph@hh<h<\ P蠉="t3<װэAPRjB[jhL.j1[1}ÐUWuh@E Ph@hh<eh<\ P="t3<װэAPRjZjhL.jZ1}U WVSu ]1Ҁ>tjtRVV&ǃt< t [ t+QFPFPFPPh8 /sVF9`G=}S5FDu{jQH>>HBABAB fA `G=`GlGt jdglGj>hFF `Gu,lGt jglGt jg5TgVj5F|9t&jxH>fSfgFFe[^_line too longcannot write temp fileU WVSjMBǃujH>>+u> tF> u+]~1H@@HBABAB fA 1]=fthjj5Tg}'j]H>f15TgU fgf5TgSjMQT |9t7fgjH@f16_fgGW W#E fgFe[^_ÐUS]5g‹XS gg]invalid addressUMi19tiit@9t iut3iu+HBBHBABAB A UVSu`G F9~o g 9(9FFB F9| iF F9F@F F95 Fe9|$9~VF@F F95 F9Fi F~i1Ґ B@9| F F `Gu)lGt j+clGt j dFe[^/tmp/ed.XXXXXXXXXXw+cannot open temp fileU WVSffjh;DhF hF袃à t+hNDSvVTgu:t ShGhFHQDf1e[^_cannot close temp fileUWVTgtRPX}+hF芾HEf9TghF ffg1e^_ÐUTgtPpXhF迁 ueIUS1ۃjhfh)/ ^} jii igC~]ÐUWVSu M]g$F$F: $F9UN~BNE[^_UVStFpFhijP 1ۃ ,g 3C~e[^UpF9tF|tFuhhpF=pF~tFhtFÐUS]=tFu!u jhhpFtF=pF|tFhڈtF]ÐUS]=tFu"SjhhpFtF=pF|S5tFhhr} 1]Enter key: UWShH/ ǃ?u14W]S1 SECe[_ÐUEu5p#"PhH贳ÐUU EЃ6/$HIIIII J$J0|FtKj3P9uhKC<3t~C~1ۉA$‹u3C~(gtJj3PuhK<C<3t~?C?~1ۉs}; ;Iy~(gjVEP[^_des_setkeyU WVS=(guF11۸M~ѐhFtC@~t E ʀM~EP t hL$e[^_des_cipherU WVSu] uX1ۿh03C~1҅tPjVV thlMhFGe)؍3Ph,gRS@^1ۃh03C~1҅tPjVV. thlMBEPjjVMH e[^_Ðdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileUWVSuE PjjV*ǃE]FCjjVV3 thlMG1ۺhА 0 3C~EhEBE P Ãu~vhtN9M QS-~hN} hNe[^_invalid pattern delimiterU WVSHPfސHQEPn@Pg|}U RPP_Q|)f wÉ]څ~ h| uQVu5hPu15h Qu}( FM<jEP EUBF9`G=}V5F01u}jH$Q$QHBABAB fA `G=`GRlGt j TlG/jT 5FF `Gu,lGt jSlGt jTE@PEP5F:FUM !uhVFPN hVVNPÅu)VجHVfE PSǃ} y>!uS |5SF}$VgHV,WV=hGuVPh|*fg+E e[^_newline inserted newline appended UWVS] S1ufEfU; gЉU5f5f=XGtOg`G5PgluA `GlGt jNlGjO?t~UgPPj[dƃu: `GlGt jSNlGtaj1OU `Gu,lGt jNlGt jN]EPÃ} }t&}t }t}th|*hW0=ft'}t=fu!}uh|*hWЮ=ft=ft }uE}u f}u UfE f=XGtUE)‰UEe[^_out of memorycannot read input fileU WVSE$ sfuF9`G}S5PgZ)u{j!,Z,ZHBHBIB fI `G=`G&lGt j3LlGj MfPg `Gu,lGt jKlGt jLPgMuu f=XGtEPVUBHJȅ}Ry@ U8MA `Uf9`G=}S5Pg'u{j譧H,Z,ZHBABAB fA `G=`GlGt jJlGjKfPg `Gu,lGt jzJlGt jXK uPgU BURMA @t'jѦH:ZfL}tPgU BUfPgM=ft=ft tHEe[^_wcannot open output filecannot close output fileU WVSuE8!uh]@PQ u MQGPÅu(EPԥH]VEPSǃ} M9!uS |:S?}(EP\H]󥤸4WV=hGuVPh|*Z}t+uF1e[^_ÐU WVSu VE=XGtta;u\Wt:_;5 gu=ft =fu CSPEP]} 4]?Fu=XGtEP/UE)‰UEe[^_cannot write fileU WVS]u }Ota=XGtSPFm|=iu=H`GttK&$Džu@ `GslGt j!lGPj"AH9t.tP 5H =HH `Gu,lGt jR!lGt j0"uhHhH?'=ft H %H}t5HtH4$H `G^lGt j lG;jm ,t5g.GZgPPj'"ǃu> `GlGt j lGj 94@g `GlGt j lGcj Qe[^_ UWVSEE @1; gRCEEP4ƃ ;u?VˢǃHEFf9`G=}S5Hu~jgQHUHYI]fI `G=`GlGt j lGj~ fH `Gu,lGt j^ lGt j< EHvWP;NM6;uUf9`G=}S5HuvjlfHQQHBABAB fA `G=`GlGt j lGtyj] mfH `Gu,lGt j> lGt j HMfE PMQ} EHg`G5H_tgPPju4 `GulGt jlGtjw 뇐@g `Gu)lGt j[lGt j9 1e[^_ÐUWVS4gB1; gƋgK19]t9Uu`Gt(V軣ǃS谣ơ4gg VSjt)1UBU; gPEPj{u< `Gu)lGt jylGt jWVEU;g}SÃEPURƃSբà >pUB8BGZg9E}4g)‰EEg=ftW6蘴@g `Gu)lGt jlGt jf1e[^_UWVS]5gE 4gg)ЍpEg9 9)Ѝp)ىM`GWÃt7S}t EXVgPPjEu9 `Gu)lGt jlGt jtp@g `Gu,lGt jSlGt j1?N-uEg@Pǃ1e[^_ÐU WVS} `GWEPju< `Gu)lGt jlGt jG1; gRPƃEHEP>à =ftV3A3^ gH+}) gEg@g `Gu)lGt jlGt j1e[^_U WVSuu0HEpEpHBABAB A gE @1; gRgǃV\à 9t5StUR5gVFsP|9u1e[^_invalid mark characterUWVM ѡp,DuHf!|\g< uHgE 1^_UWVMѡp,Dt4eHfe^_ÐUVSu1ۋ Hgt-19\gu ǂ\gACt~ܣHg[^ÐUS]jtCS AQ CA5j^HQQHBABAB fA 1]ÐUUE 9t x\uHPR%1U WVS]1H=`GW5H'utj]HQQHBABAB fA `G=`Gu)lGt jlGt j1v=HH `Gu.lGt jlGtjC HF<\uC t~ޡHƀHe[^_ÐUE=`GtH lG P?ÐUE=`GtH lG Ped.hupHOMEU WVS=pGu jTMI!lG gPjhZuh7!h>ƃtqэyA=VA PUÃtAVSzT|;/t /D;h7S詘5 gjhZuS蒵 j腝e[^_ÐU=pGu jcMI!lGjhh較 UVS5p#MI!lG]Shht@jJ|)f}v EHCfv CH5p#e[^..UWVE=dGt@8!t"ƿtj/P=tH1e^_invalid pattern delimiterno previous patternout of memoryUWV FF9t< u+lGt j5fgge[^_no matchUWVSgEgPgE4g)‰9EgPgPsURU RPEPƃ 31gPPqeLg`GSێÃu> `G9lGt j'lGjt5gGZgPPj ǃu> `GlGt jlGj94 `Gu,lGt jqlGt jOEgEg4g)‰9Etg}u0E u)H88HBABA!E tU RgPP|1e[^_infinite substitution loop UWVS] DžDžDž1Sƃ=ftj jsVY[j SjVEP DtE ,j RjVMQ }t9Ew f9`G=}S5Lg?jOaHeHiImfI `G=`GWlGt jlG4j%fLg `Gu,lGt jlGt j=ftjj (V蘐LgWVPUrW QV  E(f9`G=}S5LgujMaHeHiImfI `G=`GlGt jlGjfLg `Gu,lGt j^lGt j<=ftjj WV1LgWVP#(ƀ>)Tf9`G=}S5Lg{utjBLHaaHBABAB fA `G=`GlGt jUlGt{j3ofLg `Gu,lGt jlGt j~5( ,u'UtHsfa=ftjj WV谍LgWVPLgftD1[^_ÐUWVS}gE=fU<&M 1Y];)f9`G=}S5Lgu=joJaHeHiImfIfLg `Gu,lGt jzlGt jXMA;uLg]FG;u|<\EU<0<9;EM 4DE)f9`G=}S5Lgu;jMIaHeHiImfIfLg `Gu,lGt jZlGt j8MA;uLg]FG;u|fw9`G}S5Lgu=jkHaHeHiImfIfLg `Gu,lGt jvlGt jTLgMAM+g;fWf9`G=}S5LguwjGHaaHBABAB fA `G=`Gu)lGt jlGt j~JfLg `Gu)lGt jZlGt j8Lge[^_out of memoryU JJ9J|!dJ@PQtb JJ@Uu蓅JJ@Lu tJJ@LJ^jFHHBABAB fA q5JJJ1nothing to undoU,WVSgE gE=Jt =Ju1HHBABAB A =Jt @gjg`G=JO  Jt1t ~x5APAAA@BXQBQPCQAAABAPAQA@BQAQABO1Ob=J}WO9U~l5JECECEGU)RDCDCEEDEDUBO9=ftJgEJJ gE죰J `Gu)lGt jlGt j1e[^_ÐU WVSJJ J@<u.D8t9t VV 9u J=JuJgJ gJe[^_Uuu u-+lost+foundU WVSkk<9s0Ct {tP,$‰S BCZ9rЃj $Åt4lCKtlA<uՐCuˋ[ ȍe[^_wrong type to dirscan %d UWVSEx0t@0PhmUz$uIZr؉% t1؉y ؉  MAQlUBS4PMqt ÉU)Zr MA QxWPS=lu SCCSEX(P@ЉtY=lu=tku SCCSRMqƋUB F)WSPFl u1EPQBUBuzt[^_DIRECTORY CORRUPTEDUWVSulVP4URvNjV F~;UWRVum>)hV.EEPvhNj^ _fCCCC}tGF FVF~V UE9]_CMN C)F^W;MF~RVu~N ʅ})E)EMN Uщ)N^>u1>hVEEPv8Nj]_UfS}tG؍e[^_ÐU WVS}] W Ѕ}%)¹)ы;kCf9t|luCC$uSUSUSUSU9|DO9i[^UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUSTU WVS}u wÃf9su/jwjhW3G9lt%f=@u JRhkhwC)PCPhH~=kt;f}h*~hg h ~=kuh謋u f)s7e[^_ÐUWVSu^(~,Ɉ$P;tC$x1C)9} C)ff{F fC=ltdkV CCCC@SPv,R~t=lu=tku SCCS [^_UWVSUZ(Csz,Ht*B =ltdkR CC [^_UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u U<WVSu}1 V%f=@tPhZdV =ktC C u1Wht7u㐐hdgzljáJEEE|EEPS t Eأlh~c=kuh袇5Jjjultl5JPjt=ktBh0j5ll=kthaylu h7P%f=@hbhƆ pl5JjjluhP5Jju hbEEl]ԃkX@PURkfX5l ll<thP'bVSSV5lT u!hahwgkf p5lhVu} th5lV5lAfClkfPVhua } t M Qh_wkU fP=ku h:w[^_ÐUE#8t3@DNL!!ڊNT tu F F8U BM y0tAPP|S7ShWh{u] snG؍u)lB0AA h,mk 0M Ay0u QA ] SPu;\l@8u FlH0I]u)։lpdh\Džx|`t.U BlpSQxSR)t^u ~0uOl ptAFPP`Pɇ`Rh]Vh(zDl@tÉd㉅Td‰XhXTXdh)lpxx8[^_ÐPARTIALLY TRUNCATED INODE I=%uU<WVSEx0uPP҃uADžMqqt lp0]s{M lB0} ~YBtÉ} ㉅‰OulKtƉ׋ϋlj9}wub9uv]UrM])HX h,jk [ cEUEUEUSQRP^ UzQt9}|C49sK>t8Mqh,W%WEP҆ tB9rQ5kzC9tBMA} uQEURPU RMQtUcuEx0u@E Et8UBPPW躃WhTRhv)EU9Rb[^_blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d U WVS}`k9U U95lÉӋF!FЉV9}UF9E=ltRWh!glB!Z BPURh1C];},=0ivEPWFGl;|֋]ȡl;X,|Oe[^_ÐPARTIALLY ALLOCATED INODE I=%uCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %qd bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%uU,WVSEPfEfef}s((l0u!sXXl u fuC C tHURh@4h_X u"MQWÉ߾l l}Ekl@0s{ K 9wu"9Cv=lWVhe=kuIf}uAhsWu,URál@4CC fI=lO0ACS ΉWVRP> EUu䡠lESK UM}#=lQEURPhf}`tf} uFf}?=tkS CKu ;{hH txhvvVkf PThvv1hCG t.FkfBFf BFFPhvD@9D O([^_.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%dU, WVSE@(Dž=tkt)t#;ksdkBDžMy$tރ MA9t8h P赶]ChCD u=lyh3 ]s[@hCLD hJ Ur)MA=lt ƅƅƅ f=luƅ$;t,ރ1t t ShX P;}h 9}@BfQPR|hC#C +fRPQ|]C$kf PWjQ|f{hCBuEx$pO@=lt ƅ ƅƅfC=luƅ$Uz$A$xQ99P)ffxMA$kf PPjP{fB΃߹1t ukS=lmx]h UrAhC@ '޿ t)hEprŲSh 8C;}:hEpr芲h8uAiCtZChEpsFBfQPRyhC?u]C$t kf P :u A]S$<y.<uBhdsNhC=?uy .uDht]shC>u3BMQ$1;kvh3q=ltouxu\zuPh1]s蕰@hCH>{o l Ӊ΃-$PEx$hSph=Uz$<3u =kPSMq誯hm=ǃ 37ƃl%f=@u kFfJSxMy$APPVOJ33S6J ShVh=kth .hw<ǃEx$~ @B=ltUKdk9t;h3EpLdkChC<ukf PRPh%u  [^_UEU @$I$)phase 3, directory %d/%dU5k5Hih0u uGÐUWVSOLkkL9HiCQUslt <M<EDžtE<u?E;k4sqÃE{Stl<u U;k~̓sW衱lCCkf Bl趦M; k,Oe[^_phase 4, inode %d/%dU5k5Pihu uUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%dUʅ}J(xU t (@`х}J)ʸLF8;s8uL8;F8,(BF|Í(yU tDT (@T8F|֋ы8șPщЙ(~U t (@XٍXf8$8y8Éم}K(Rl)øLL(s$}G(xU t  (@`}G$)8+K8!jVRS:8B8,Nj09,`8$([h(RlBDž11(;Np}ltAt8$9~1ɉtBDžG(;~p|t8$9~(B$EBEB EBE8KpP[l#Pعt?hTP7t$(BBCB CB$C l=pkt#8(S4V4U t  4\(xU t Ɓ (v\@tzhEP6tb4zU t  4R\(yU t  (@\@SPRb`4k(4HuQ4~U tT 4T(xU tƃT (vTDhEP6tvHR(Q4S_{U t ڃT 4RT(~U tT (@TDWPRj_4kP8;B,O8Lu 7PhP7; =kuh7lB$`kB,kB0É@04Bt(,(㉅,‰(04Oylv8h7@h7  ulǀll@ =l5lFh$09s09tPR+lPhJ 9rӃh0KEP61ke[^_%s: BAD SUPER BLOCK: %s U}t/=ktgPh$P u h)PQÐ%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) U,WVSjEPEZt B<vRp,DuURhPpu MQp,Dt }EUB <t2<wB 4N4PMQhP1\]1҉߉YEXUZ4H MJ8GB$N0F,F81v(}G|D1}D1Nj}GGȃ~EPUH#tJɉJ}HW|Uؙ}8Lșϋ}OEȉș}O$ș}DG,GdE~1ҐBMQdF(ke[^_ioctl (GCINFO): %s %s: can't read disk label US]hihedAu y8}2u1/5p#2 Ph'SGSh;S-i]bad file type 0%o UU%%=`t>!= t5 =t,3=@t '=t =t =u =ltPhS 1ÐINTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] U WVS=kth\T u{T ؃hT u*=lu =k}EPhT =ku t'=ltURhT )EPhT h$*2 GPWЅ}WF )))G ul t0FPVЅ}WiF)) uŀytYtnt NYhT y.Y%1e[^_cannot allocate buffer pool U WVSkllp0,uh(VS0k4k k,kkkk lЙy0ǃ1=h(VCCkkXkCCCF9},j ,Ãlp0+ tu~5ke[^_deadlocked buffer pool USUkktlHd9CtHkuk[ktCukuhWW u RS?kSCBCkkkXkK؋]ÐU WVSu}lHd] 9^t.V5kpkWSv5lF^~ e[^_PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UVS] {Kt,sC =kxX9uwXRhXCCs ssu$luc11l;}Q)ًB09~PB8JdP45klX0F;|e[^CANNOT %s: BLK %dProgram terminated U=kuhT u uhYh{T uhYUPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) U WVS1k}5l1hlP=klÉkRPjh B 9u9tV=kuMhZt9kRPjh  llhl5k`hk5kJ50k,(5k tCkt;GV5k^v'V'ޅtkuȡk9t)Ph1Zkl}ttluf=kthIZhdZcuE}t)lƀlhl5kE=lt05k =kșQWVh|Z8 5l{/5km/e[^_SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,UWVSEEEkƉEӋEËEÉM]jȉRPUR.|$EPU REP .;Eu1OURh\EPh\jEURPUR. }EPh\EURjE P0h\ } 1 U9U5=̚t5ԪԪhohothԪjju ÃQ;uv==hPE 40^5=tE 4d0E =tRL21ɋE ;u =ԪuQRE 4+n=t&nPo=h=̚ԪԪhohothԪi1 󫍝Sjh E 4 u u'E 4hoC S =h7E 0=t7/=tR019u =ԪuPR7+n=t&nPm=hu>=̚t5ԪԪhohoSthԪt ?P F;uPj'h[^_r+wUhtju u|wU,d 0dtttRju uKÐusage: %s remote-file [ local-file ] local: %sRETRUWVSDžDž}uEU BBDž}hmE PEPQt(}hmE PUR/t}~E 0h@u5(E HPPuГ1M A=ttrQ:t'p,DuB:tDt:uCQt&5p,DtDCBAuE xtD=tE p+‹E P=tE p-‹E P}PE po}u;}E phfu@ 04,d0d3u,jE p$tl9 | DžXR1ҋE 9Hu 9HtRuE pphpux,d0d 9t Pu [^_UVSjBHJȅ|  Rj 轉 5 =htl=̚tcԪ5Ԫ54hotԪ5jh * Ԫ5hjh  remote-filesusage: %s remote-files mgetUWVS}Fh-yE PEPu*E 0h:y5~ГE 4hhLxjh " K>uh5=h(VE 0=tteFtL p,=CʋDt TO@u=t PH(=t P;*j19u =ԪuRhtVPhpuv =hu>=̚t5ԪԪhRyhothԪj5Tu ƃWjh[^_onoffU市{}t{and logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Macros: %s UVSt+5Llu{Rh{5蝍5h{ =TuQjϒ=t5h{5J5h|證 j苒5,p|8tR5lkPh@|55FPhc|5Ɍh4hh,h<h|5袌5P5ԪP5P5Ph|5J$5LP5Ph}55TtPh@}55ܪUP5tFPhb}5Ƌ =thhh}5蠋5h} =thdhLh}5c5h}Ň 5XP505Ph}5,5|nPh~5 =~H5h7~J 1;5}(\Sh@~5謊F;5|Гe[^usage: %s [ on | off ] %s %s. U WVSE] u}>ƒcu?h{s/ uPWh5e[^_Bell modeUhfhu u%ГPacket tracingUhhPu uГÐusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). USE] u=ƒt3hrh{s耿 twh{si u^j EPs B=wE8t$sh5Гv05RPh5Շ =t50h45谇5hJ Г]Verbose modeUhhu uГUse of PORT/LPRT cmdsUh„h|u uГProgress barUhhXu uГInteractive modeUh*hԪu uYГÐusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. UVS]u ~%6h`5Г8=lƒluGh{vۼ u loh{v踼 u lLuv|v ,hvhl mpll=lt0pt8u"h5+l@5,p|8tR5l_Ph@|5߄lГe[^GlobbingUhNhu u=ГPreserve modification timesUhzhTu uГÐusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). USE] ~3hh{s˺ u }h{s診 u Zj EPsW ƒ|E8t1sh5XГg=ƒ=t %PPzPh5=ƒГ]remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %sU}h<E PEPOt}~&E 0hM5"ГjE phiOu>=Гu2=t5hI~ E phOu usage: %s local-directory Local directory now %s getcwd: %sU WVSUu  BQFt'6hr52Г~FPuГv }"vhfu2, ГThS tSh5蕀vh+ ГF9t P[^_usage: %s remote-file DELE %sU}hmE PEPt}~&E 0hċ5ГE phۋMmdeleteUS}Ch-yE PEP誶u'E 0h:y5ГE 4hhLxj%Eh - ;uhy=htmSE 0轻tXShۋL=hu>=̚t5ԪԪhMhoqthԪjju 臷ÃZEPjXh]from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %sU}hE PEPt(}hE PEPt}~$E 0h5}Г.E ph֍KuE phލfK-usage: %s remote-directory local-file dirLISTNLSToutput to local-file:UWVSE] @C@C~&3h5|Г3ǎ1t EЎuEˎCEƿt"CPbuГCEƿt;8|t6CP"tshՎu Г,jjhtssEP`5C;Et P{E9Et EPde[^_Ðusage: %s remote-files local-file mlsU WV}h-yE PEPyt"}DhmE PURWu(E 0h`50{ГMU DEEDu쿌t2E8|t*EP贸tuhՎytE ƿ1tҀU4hhLxjXEh `  uEwEajjEPE 4uЎ}tˎP^ =hu>=̚t55ԪԪE 0ho裶th5ԪG=ht EH9fEPjhE;Et P2e^_SHELL/bin/shsh-c%sTry again laterUWVSjj,ǃjjƃ $ ÅzSKC~jjjjh1u Džj/P9 Ãuƅ-hCSP- E޺1t tƅ+=t65Pt 5j  5}~)j5hWP讝 jWP萝 Wh-# Гj~PA_ 9uWjkVj` uh" Г Г[^_usernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. U`WS1}hŔE PEP跭Ev)E 0h5vГE ph 9D}h ‹E PEE phCuu}T5h$|r 5h)jO]S{ ډװшD E X EE p h.Ct5h6r )u}uE p h.CCe[_PWDPWD command not recognized, trying XPWD. XPWDUShBu,=Гu 5h9q h B]Local directory %s getcwdUShS覄 tShs5Sth Гdirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sU}hE PEP诪t}~&E 0h5sГ[E ph5Au>=Гu2=t5h o E phJ@RMD %sRMD command not recognized, trying XRMD. XRMD %sU}hE PEP诩t}~&E 0h5rГ[E ph5@u>=Гu2=t5h n E phJ?command line to sendusage: %s line-to-send U}@hE PEPӨu$E 0h5qГu uhLlarguments to SITE commandSITEU}@hE PEPSu$E 0h5,qГu uhÐU WVSu huWv E~oэQ7)PE4:P4 EэQC9}w~ Ƅ* BvEPh#> j2@t[^_modefile-nameusage: %s mode file-name SITE CHMOD %s %sU}hE PEPۦt(}hE PEP蹦t}~$E 0h5oГE pph>=SITE UMASKSITE UMASK %sUSE p}uP<]SITE IDLESITE IDLE %sUSE p}uP<]HELPHELP %sUSE pn}uiPB<]ÐU=tjj9js=tjjjCQUITU=tSh ;t P  d=Tu usage: %s [password] Account:UUE ~#0ht5bmГ,u@h苹 Ph.:Ujl=Tu jbr=t j4rjhٌ commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. U WVS}EhWE PEPHu)E 0h_5!lГE pvEu/5hr\h 5bUГ}u5hEx u35h h 5Г2hS tГ hjÃjp Uz tQ=uH5h{g 5jUpSjГhhd ƃ~)dװ)QePRE PEHPUB Ѓ=t  joSje[^_Case mappingUhߡhtu uГCarriage Return strippingUhhܪu umГNtrans off. UVS]u u)5hJ f ГYPУГjvh u jvh e[^UWVSm1=tGt~M9tc11ҊEtBE:Eu9}/$Bt8Eu9} CuCA9um[^_Nmap off. mapoutusage: %s [mapin mapout] USEu-5hd ГhE PEP t}~)E 0h5gГГj 5 Ã=TtC; tj S轾 Ãh5hL C; thShd׾ ]nmap: unbalanced brackets. U|WVS]LE1M@~E8tt>to<$t<\uBF8tA]~0~2FF8t&ωE\(ܐCt8Vu\(F:t1t;tC>tF;t>uu;t EUqqd=d%1[t3$\~FF$ulVp,Dt\F>0uU:&BC:u <|)T)܍};9BC;9u,]\uFn$u_Vp,DtOF>0uU:tIBC:u; <|)t'T)܍};9tBC;9u t FCt<,t<]v>u5hޤBa Nt" >\u~tFFt<]u>u뽐F<,<]tlNVp,DtPF>0uU:tEBC:u6 <|)t"T)܍};9tBC;9u CF>=qtqEx[^_Passive modeU1=t*Phu uQГStore uniqueUhfhu u!ГReceive uniqueUhhLu uГCDUPCDUP command not recognized, trying XCUP. XCUPUhʨ0u8=Гu,=t5hA_ h 0u Ðrestart: offset not specified. restart: invalid offset. Restarting at %qd. Execute get, put orappend to initiate transfer UVS}t5ho^ kj EPE p8U ,d0dutE8t5h"^ VSh5a,d50de[^SYSTUh=/ÐLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. U WVS=u5h }hE PEPt}~ E 0h5_=Ԫt5h <\ jE p\P5 ƂduHhԚN5h`[ ГNNlГ0Dl@hh4Ԫtr)BHJȅ}R ))]؈< u!;48b~WFԪu)FPVЅ}V )) tuăt6FHNȅ}Vg  t띐)) u5hZ Гe[^_filenameusage: %s filename %s %qd UVS}hE PEPŔt}~$E 0h5]ГBjE p؛ÉփutVSE ph15P]Гe[^%s %sU}hE PEP#t}~&E 0h5\ГNjE p萜Et)EP= PK PE phٮ5\EГSTAT %sSTATUE p}~P;*ÐLocal file "%s" is newer than remote file "%s". US] htjSujtssh5[]PAGERmoreCan't allocate memory for $PAGER|%sUWVS}hE PEP蘒t}~'E 0h5k[Г'E PUPuГh0[Ãt;u6߰эAP ƃuh@j ShaVQ ,dU=,d0djjhtE pVhpuG?$V,d0dU=E @9Et Pe[^_?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitdisconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. UWVSDž0Dž,}.hȳE PEP豎uE 0hӳbDž4\ 44;}j SE p( uы4; u+E ph5&WГhd8(PFG 4$$$h;lsp,Dt CDud;$t\CC p,DtC1 |BCDuKE9|kE tVF E |:{iuFDž,C0;U}3E 4VIF E 0<эtF;t C;2t0%tǃu5h R =Гu$5hQ Г t.=u%5h(Q Г=t&5hdQ 5j ܞ 05LG Ѓ=t:t4BHJȅ};B| RjJ (PhdD sLEE $4l9t C9,t00;U?[^_unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %sTrying %s... socketconnectRequesting %s Requesting %s (via %s) :/GET %s%s HTTP/1.0 Host: [%s]%s%s GET %s%s HTTP/1.0 Host: %s%s%s Writing HTTP request200Error retrieving file: %sContent-Length: Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sUWVSuDžEDž11EP>A uhj& jh7 Rj u jh? P6 u MjhF Q u  RhLjr t$vj/P藦 $t8u URht $$t $8u| URh t $QI  t 8u( URhb } M Qz? uh4jb jh7P覅 u 9jh?Q~ tE PhY t 9uE PhY $B/j/Q $t8t $Lj$R'E܋E܃u$Qhq ( XPEPuܓܓ tBhh PQ'}) Rh(  2*Džhl t%N PjN5 hj9TX0Ɖj% ,TX ),Ã,t',RSQH\ uȃ=tk=Xub<BHJȅ};B| #Rj#A 0סX9 u;5Tv5hSEP,==X X=T09 u:;Tv2BHJȅ};B| #Rj#@ BHJȅ|  Rj @ 5,th * jN28[u-j]P要 tPt:u@ j:Ps ÃtC=t, R$QSPhԹ5I }1EE߅u= 4VEPWR6' u2;= u*jPhj 8SVMQSP& t$RPqF PhE4jjjhSvv Sh5Hv vv臰 E܋E܃ u DžnvvEPz |+jj Sjjvv6 1u95=p#tEPEDžv(4.F E܃}Qq =t2uEPh# U RMQh25Gj:P tEuJPJtKPR$QMtJPhTCuJPJtKPP$RMtJPhhP ߰I,QSEPU;,sh= 1CE9s%jSEPGO< t< uEj VƝ Ã)CjhͺS@ tShѺƅ+ +CE9s.jSEP< t< uŀ+ uEC;f|PcujhS} uπ;trj S 0Gj 0PS^} ܓ=ܓ08ܓ tAhh Qh}( Ph? 2*Džhd t%fPjfMhHjQTX0Ɖj= , TX ),Ã,t',PSR`uȃ=tk=Xub<BHJȅ};B| #Rj#9 0סX9 u;5Tv5hSEP,==X X=T09 u:;Tv2BHJȅ};B| #Rj# 9 BHJȅ|  Rj 8 5,,th Bjfܓu =t<9Tu 9Xt'=5h> =t5h> PjEP 2* 9tPtR@ Q.1h4A Ph . Rh Qht E܃tEPMtP袸 R萸[^_ http fetch aborted. Uj5h0)= 5/jh` file fetch aborted. Uj5h< 5סjhP` ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.:@/Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd*?[]{}Retrieving %s/%s %s/%sgetmgetULWVSEh _ t!=t jjE@[h&j赽h&j 覽hhDž DžDž1EU 4W/ uhj? jh7Pu tjhFReu u.EPRPljh?Ru 1t,EPRPj/S贔 ƃh:Sq tu@j@P}t uh:Rq t/uDž`t:t@tzdÃj:St ǃtGj:P軓 ƃd;[t1Ft+>t&j/Vs t @1=t+RVWSPRhT5< huS Shu%, =tjj8E]Et?t}E=t EPR9k=t#u>PRSou Shj E@jj@EEMEEPjz=Dž1=tUt>thVn t*8thPn t Džt8>t3u/EuEEPjԷ=t :uDž=t&PuJPh59t*RVhhSP EEEu t.ԪԪEEPj虦Ԫ&}tUUEEPR ГQ)ƒt E@R艰E@Eu&E;E}j:EU 4 $=tt jj[^_:/US]jh?So t@jh7So t)jhFSo thS' t1]unknownftp%dftpgatehttpTrying %s... socketconnect to address %sconnectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockoptUlWVSDž1}EEEE썅PMQE PMQ Ãƅu uj/u uju ujPhj P? t PMQPEP$ ÃtS3 P Г:xthphMQhv趍 wvxt7jjjhSww Sh 55w ww\ ƃ}Dž.zwwVig Ã} =p#t߅t]t1jjjhSww Sh5 DžKVA}.􋅬PS Г2 wwhG2 DžPhV远 } hS ГE=u7DžjPjjV }h_ hxV2 hzV  =tuh|) 7=t5h53j~9t P t P ГODžjPhhV }=t h  V?1[^_ÐUjPBHJȅ|  Rj ( 5H$d=(dtjhܘR ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUITU WVS}$d=5hn. u jWh践 u5hA. ?jWh舵 u5h. VW53BHJȅ|  Rj ' 5Ԓ=u hs Г1hjÍu VW5t25h]- 5c8Pƃ=$dtt jӃSjYe[^_%c%c%c421 Service not available, remote server has closed connection. %s:U,WVSDžDžDžDžLhj荮DžГDž15y Ãp5y ÃSh'?5jy ÃShhh5.$5tFuN}`I=t!5h'+ 5-Г: ~~5uu~p=Dug=t*t u u5h5..BHJȅ} ;B| t RS&$  ӡp,DtГDCУГu/Гw Džu Džd~"uӡp,Dt Džu1 t)t@Dždu(u Džu-ut ГuE9sG5+w à I~Q5uH=Du?BHJȅ|  RS" 5u6)ÁvSQh<Ƀ ƃ<t&Г;t1t 8Pj詪=Гt uuF=$dt"tt jы,Pj3Г1[^_UE EE@Pjjuj  Ð send aborted waiting for remote to finish abort. Uj(yh$d5h%' 5+jhdJ sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetoutUWVS0EUتDžTXܓX=tK}tE} tU :-tRh5)}tMQh5x)=Tt]SE PUR2 d9tjP蠈DžDžDž|DžDžxzhdH =8tj=8u d|Pܨ dtQje|t|Sj HtPj+XГ h8jh,ju 1t  u'Dž)=XXM 9|jj 舦|hx] CSS u3Sh SjD|Pj 3h=Xu XDž9hxM Qb uF] She Pj̥ Rj踥Г+ Dž<EPAP[|E%f=tZ] Sh5&PjJRj9􋍐Qv Г EЋUԣܓt^SjPjܤ |t|Rj 迤Г XThdE  ,d 0d1utuuj5,dQ! 0|,'|"j,d0dRPBP~}SM Qhb ,d0dX,􋅐Pe5,dht,d0d,d0dDžx}MQ]Sh'Pj Rj X |t|Sj ТB􋅐P~MQhtsSj芢PjyX |t|Qj P􋝐SxQ'jfjj | r1=p#TX)~VSBP ǃڃ==Xt =EX9fE9uE;TwTEBHJȅ};B| #Rj#] 0EUډEU덃5莃hSBPxƃ==Xt = X=T09 u9;Tv1BHJȅ};B| #Rj#} BXZ؅|  Rj Q 5蠂}E PhX W xE9uE;TEBHJȅ};B| #Rj# 50EUډEU=t#=Xt =}EX9]C @CPSЅ};C| Sj # TXBHJȅ};C|< t RV TX􋝐Si ƃ==Xt =EX9E9uCE;TwE3BHJȅ};B| #Rj#- BXZ؅|  Rj  5P@ @tU Rh A @t-=p# th TXjNaXt􋅐P҃􋍌QB jSjۜPjʜ |t|Rj 譜X=TjgQjkSjZX |t|Rj 2=8uГ d|PR dt􋍌Q) jГtt􋝐S҃X u=Tt j fX[^_Ð receive aborted waiting for remote to finish abort. Ujjh$d5h 5}jh< < receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUWVSE tDžpDžlDžd0EUتTXEܓX| TxuEEtf=t]}tWtt.}u t>-ttPh57}tURh5=Tt#EtMQtVEPI#tDžhDž`Dž\1=ܪu EEh<9 =8tjv=8u d|P茙 d`t`RjdtdQj|5XxTГhj`h,j謗d }u*tt:|jtQJ j/tVO áp#t/ t*Vh `Pj tj;tttt PJ ǃt/}5tQh9 `Vj蠖dP|=Luh=p# uRhtR2 }7tQh `Vj>dP=L=p# tR%tuf`QjdV=Lt;tP%tu`Rj螕dQ}Eu=tGjjv6d9tjPujuVTܓt4`PjdRjГ h<6 \ Et,,d 0dt5,dhi }t?MQuVht?`Pj}dRW MQh[ hxl }tuDžp$*Tt:|umjj ݓ\hztCS@ p u ShW=Xu XTDžh9EMQtVO puVhֿ Džh<EPpBPy|}uEw9EvUwt P賋u%wu!h"T w2ẸwE%f=t=Xu XTjVof],d 0dt*j,d0dRPpBP貓1=p#1VwPpBPsu =p# t)9|ʅؙTX==Xt =EX9gE9uE;TwUE쐐BHJȅ};B| #Rj# 0EUډEU댃5s5w5wlFP踑Ã==Xt = X=T09 u9;Tv1BHJȅ};B| #Rj# Bpr|  Rj  5r}-=p# th)蓼 TX9}tPtRh/4 ,d 0dRjjpQ |S5,d~&pPZ t+ uCC9|܃jjpR tQh費 |5XxThpRh 0E@E$E9uE;TEBpr};B| #Rj# 54q0EUډEU=t#=Xt =}EX9]TXlPY à uEtPpB @BHJȅ};B|p pPj  tQtZ MpBHJȅ}p;F| tpRS TXlQX ÃPEt-EPhD5J5h ==Xt =EX9E9uCE;TwE3Bpr};B| #Rj# BHJȅ|  Rj  5 olF @t-=p# th)跸 TXp@ @ttRh耸 jP| Xx5ThtpPh҃`Qj衋dVj萋 \t\Pj slR譞 jsX E u=Tt jU=Th<jMQKEjO= EUEBRtV, kEP P PVh5 B|XxT\t\Qj WjjH=8u4Г`Vj!dPjlRYГ d|P* dhtptpQhփltlPڜ X u=Tt jS`RjYdQjHH[^_Ðuse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)bindlistenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dUWVSDžlEDžh=u& f=tf=uhe =\`djjPn ‰ d}Fh. 5 dΆ dԓft-jEPjhR1n }h譱 t t}DžhhP=Гgfff)ƒu#t5h$Y DžhKrDžhhP{=Гgfff)ƒu#t5h$ txDžhPhQtN=ԓt15 d? dԓ5hUhK =t5h Гgfff)ƒut5h}]EPSUEPEPEPRhhLy t5h81dUE E E fffEfS ff hP Гgfff)ƒut5hDvt]EPSEPUEPEPEPR|PxPhkhLD 0 t5hxu|u}t5h1`UE E E fffEfS ff]EPSEPUEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPR|PxPhhL$ `t5hxu|u}t5h1\UE E E ffUE E E ffQUE E E ffQUE E E ffQ fEfS ffhE Гgfff)ƒut5h$ftwP]EPvPuPVhhLW utF8uF8uF8t5hi Cff&=p#t=ԓhKgPh5 dq1 |4=|t f dt PejjPf ‰ d}h.j =|u+jEPjhRf }hPh5 df } hnt2jEPjh5 dPf }h̩ DžppPh5 dyf }hS葩 )j5 dd }hd =|tug=ujjjj.uVPhk t*fPVSh#]t tIPPBPBPBPPh3 PPjBPBPB PB PB PB PB PBPBPBPBPBPBPBPBPPjjhdq`u"=|u|Džllt |=u3EjEPjj5 dc } h_e 115 d| dlt |H[^_acceptU0VSuE=EPEP5 d` Ã}+hSΦ 5 d{ d1_5 dj{ d}u1EjEPjjSb }h_e V5 d e[^USp#X u=Tt j%Dp#]ÐUjH$dUWVS]$dhdjOyEt%=TxEwT#=TwExTUthPCPQ ƃCM  󥿬u 󥍻u󥡘<U<@@dDDdHH8LL8PPLTTLtXXt\\jh`PCP ƃpE`Ph jhqPP ƃEqPh MhhLPO ƃEPhL\ hhdPO ƃ EPhd& EPjv=$dt$djUҍe[^_UjEBHJȅ|  Rj 5Xh$djhܘ? STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortU U'sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. UW}BHJȅ| }Rj hA< ui=ua5h' )BHJȅ}RWs )) kua=L0aǃu5h (4u5h ( t"=u5h3( l05LG Ѓ=t7t1BHJȅ};B| Rja  h-uw=̚t%5P 5C h)hhd|m ujjqsdװу"h&jw`h&j h`}ÐUWVS}u1uE1u8^8^tDB8u9t?AB8t9u);E~ E];EuFu E [^_ÐUSdȚ|@L L!ÃS5 u݋]!$UVS1ۋ 5Ț!t$uOt t0>A+9!+  t  uAt t  tI tC t>"uA\uAt(@A͐t"uA뾐@A吅t@Ț t3tt 1[^Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s U WVSub Ã,=Tt,Ph,5q 8^hc9s9t=Tt t PSe hc8^9rʃS*jS jE E Snǃu Sh'-uShC-5  w7j h]-5 Ne[^_Ðusage: %s [-adegimnptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file U8PPPPh.h|* j_macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %sU|WVSDžh/SÃu/߰эA=vj? PSh/衅 1Sh/S_ h/S u=p#tSh/j 믃hSx }ƅj.S1 Dž/t tDžR _hURz (h5\  j.5y0 ÃtIPS( u2)RhPQ u+j.UR0 ÃPS +]ShUR m`@ t bU u&߰Q2OU hP\ E 0t/ t-P@Pi=| ? ]U:Q߰QNUhP@P<| ?+E8߰Q"NUSPK =T5*! t t tރt u5h0\]1 CF+5 ѡp,Dt̃g t$5~ @ u߃2u)hԚ3SlhDl@hhԪtA5  < u {tCԪuʁԪu+5h(1hhC1芀 t: t5*_h/O hX0R5g 5h05h0A h/ h0 5f x[^_ÐUS@ `5 ƒBv܃ t׃,t҃"u?\u5m ƒC5W ƒt`"uY \u5! ƒC5  ƒt t t t,u=u 1uۋ ГQ)ƒt}t U<} t=TP"hDS eS =eu0}u5hD NUD>5ehhpO u5eCV ej hpA …tp[^_%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! UVS]u =Ԫ=VSh0H5 5$h)hPN u 1DPfnt fat5Sfpt fyt`BԪ5h8H =Sh\H5j hH5U ([^%s: not foundU@WS]=t`}1 }Wjh 3I u}u3hI!m Wl 1E0诲 WP e[_SIZE %sU WVS==u uhpJ<uPj h< ƒtjBj EPR萴 É֋E8tNp,Du?3} t,=u#5h<f 5j =؉e[^_MDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. ULWVS5Г=u=uhPK<<p,Du GDtp,GDujhXKWC u!h\K5蟿  G2G0EPEPEPEPEPEPhKh<I }1 EЉEԋẺE؋EȉE܋EĉEEHEMMEEP׫ ǃu)} u =th<hK5 :}5} t,=u#5h<: 5j  u5Гe[^_ÐUS=eu ?A e1ۃEPhwt@j9>te9E؉؋]ÐUSp#u =Xu jp#] KMGTP %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETA.AULWVS}u>jh菗 x|,d0djPI =Xyj=ܓ]T X,d 0dЉȉ ܓSQRP; Å}1ۃd~dShNhVw ~_Q)ƒhN)QhNRhNѸ)PэDPw Dž   uv v܃NB<: u P:PSQhNѸ)PэDPyv x)‰|S)‰ЉA}A@B9u`;vRx|~ADž)‰Y)É؉B}B@BB5OۅX u1=Tt(t9u;ܓv؃hN~C؃hNѸ)PэDPt rܓ+,d0d-T߭ٽff f٭۝٭ų )tPhN hNѸ)PэDPs ų )ʉ))É<ؙSы )PhNװѸ)PװэD Pds װэAPR@P6}u!hMjV6j E}uP?UWVS=u }j]S U)‰||[)É؉B}|B@B|EB5dUETXEUmE@t}fMf fMm}EUm1ۅ u =v UtUQEUmt lU tU$$5ت U=Tu=XuNPTXRPhUjdUxR۽`p 0ۭ`}^XO=TBE0 "TXpt,d50dpt9u ;ܓ߭pܓ)EUm}fUf fUm]]mų  )щ))ƻ<WӍ)PQhHUxѸe)PxыxD Pvo ؃UװэAPR}u @P2H[^_ÐU,WVSEEEP9Us,MM<эY;]~]E9UrփEe}ƅuUBH1EE9EE9uMMMEE萋UM UE;Pr0BHJȅ|  wRj 蹨 eэY;]}<BHJȅ};B|  ҐRj i 뿋EEEE9u?EU9Ue[^_UVS5p#]Shht@@P1tCPftЉ P5p#e[^ÐUEEEEUEUjEPj2 Uuu u-usage: %s [-ie] [-f mbrboot] [-c cyl -h head -s sect] disk -i: initialize disk with virgin MBR -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. U58hZh|*B jh3/usr/mdec/mbrief:c:h:s:Cylinder argument out of range.Head argument out of range.Sector argument out of range.Please specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.open mbr fileUWVSu} % DžDž1ۉ|Džx[Eplt$h]]h^]]h^ ^]h^h^h^h^h^h^h^h^h^<^DžDž#x5# ÍC=vph\j" 5# H=vBh \j! 5#f |H>vh<\j! Oh[WV 4)ƍ<t E |t[jq$tLt6t-|t$P|PډX h`\j 1EPpPth\j upRP/jxP Ã}h\j lRjjSS,tPjjjjlRpP tttRpPtjjjjtRpP1X[^_Abort program without saving current changesabortQuit edit of current MBR, saving current changesquitExit edit of current MBR, without saving changesexitWrite loaded MBR to diskwritePrint loaded MBR partition tableprintSelect extended partition table entry MBRselectUpdate machine code in loaded MBRupdateFlag given table entry as bootableflagEdit given table entryeditEdit current drive statsdiskRe-initialize loaded MBR (to defaults)reinitShow entire OpenBSD man page for fdiskmanualCommand help listhelp ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR?MBR is unchanged U WVS]} WS hb hcRt7j3ƃSW SjjVSVF hc 1[^_Enter 'help' for information fdisk:%c%d> ?Invalid command '%s'. Try 'help'. Writing current MBR to disk. Aborting changes to current MBR. UWVS]uDž(ejE0 WEURP R  PRVSEURPWUR $hvd" (,5 =t*Phd h$*P,tDž$=et3e1ېR4j ;t $<u׋du Dž$$ReuPhd PR脕 EPU RPURPeЃ t,t'u =txufhd jU2 PR PEURP R  P$he/ 1[^_Offset: %d UWVSjE0!DžDžUR_ RÉVSR WRPVSREP(RhgI WH Dž 1uu$Iyԃ;􋅘Ph[^_eof UlWVSuh)jd]Sy. uhij ߰шD hiSh <hiW' 8Cj WFP hiS3 <jdWFP 1e[^_%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) '%s' is not a valid number. '%d' is out of range. U|WVSu]EE}} uWEPVEPhiWEPVEPhim }thiW h)jdS - uhijN ߰шD }t}?u E`] } uPEPS NjE9u}8tShi ~9|;}~Whj 9;}x[^_%s [n] U WVSuhhkc h$* )BHJȉׅ}W0 ))à tCtH)FPVЅ}W@0 )) tuȃtuhij 1ytYue[^_ÐUEff@ ÐUUE fBUU B B B UUE BBB%s%s is not a character device or a regular fileUpVSujju V Ã}Vhlj EPSk}Vhlj E%f= tf=tVhlj ؍e[^ÐUuDIOCGDINFOUVS1ۃju>ƃ|qjCÃlPhedAV }hm`I S1ۃ #CCC VL؍X[^sysctl(machdep.chr2blk)sysctlUVSjuÃEPSSDžpDžtExDžljjlVhPjpS  }h`nih hDžpDžtDžx|Džl jjVEPjSM  |*j ËEMKUS‰C hxnG 1X[^ÐUVS]u 3C3Cts 1(tC 򐐐{ uCtC { uٸe[^Disk: %s geometry: %d/%d/%d [%d sectors] geometry: US]3h.pW C tp pp0hHp5 hip# 1]UME ƀƀƀ8ƀ\fǀ`Uƀ]ǀ@ǀ<ǀDQ JLQ RJHQ RP<PQU WVS] {u nEUCS UMKE PE PfE Pf`u ƾSEURPUMQRVMQ* $Oy֍e[^_ÐU WVS} unEE PTUPE PM`PE P]u ƾVURRPUBR RPS $OyՍe[^_Signatures: 0x%X,0x%X UVS]`Phr jj: 1 SV" $F~e[^ÐU WVS}] u jVSW9u9uhuW!=u1e[^_U WVS}] u jVSW9u19u-huW=ujhsd W1e[^_BBT (Bad Blocks Table)BBT DOS 3.3+ SecondaryDOS 3.3+ SecBeOS for IntelBeOS/i386 Concurrent CPM or C.DOS or CTOSCPM/C.DOS/C*BSDI BSD/386 swapBSDI swap BSDI BSD/386 filesystemBSDI filesy*NetBSDNetBSD NEXTSTEPNEXTSTEP OpenBSDOpenBSD FreeBSDFreeBSD Phoenix NoteBIOS save-to-diskNotebookSaveAmoeba bad block tableAmoeba BBT Amoeba filesystemAmoeba file*Linux filesystemLinux files*Linux swapLinux swap Minix 1.4b ... 1.5.10Minix (new) Minix 1.1 ... 1.4aMinix (old) PCIXPCIX Novell Netware 3.xxNetware 3.xxNovell Netware 2.xxNetware 2.xxISC, System V/386, GNU HURD or MachISC, HURD, *SpeedSpeed GBGB OntrackOntrack CP/M or Microport SysV/ATCP/M or SysVDMDM VENIX 286VENIX 286 Compaq DiagnosticsCompaq Diag.OPUSOPUS Extended DOS LBA-mappedExtended LBAPrimary DOS w/ 16-bit FAT, CHS-mappedPrimary Win95 w/ 32-bit FAT LBA-mappedWin95 FAT32LPrimary Win95 w/ 32-bit FATWin95 FAT-32OS/2 Boot Manager or OPUSOS/2 BootmgrAIX boot partition or CoherentAIX/CoherentAIX filesystemAIX fs OS/2 HPFS, QNX or Advanced UNIXHPFS/QNX/AUXPrimary 'big' DOS (> 32MB)DOS > 32MB Extended DOSPrimary DOS with 16 bit FATDOS FAT-16 XENIX /usr filesystemXENIX /usr XENIX / filesystemXENIX / Primary DOS with 12 bit FATDOS FAT-12 unusedunused Choose from the following Partition id values: %02X %s %02X %s %02X %s %02X %s U WVShy E8\fXf\fXfeehzG E' 1w\fXfh4z h@z  E} |e[^_ÐUVSu1ɻXf\f1Ґ94u A1v踰h[^ÐU WVS] U B CC$??J%S Ћu F N!CF C$?ƒ?V%S ЉFtuuuSM ACPu FVue[^_ÐUE8'x?!xx x? x~1ÐCylinder values are modified to fit in CHS. Warning CHS values out of bounds only saving LBA values U@VSu]E܋NMF=‰UF EMF=‰UVuFEPt3E܉EFEFEF EFEFhH| F!<t<u EUE UEԉU؃VctTF CCV?F%ˆCFCF!CF CV?F%ˆCFC7F CCCCF!CCCCh| F+EPS|vCPme[^Ð Starting Ending #: id cyl hd sec - cyl hd sec [ start - size] ------------------------------------------------------------------------- %c%1d: %.2X %4d %3d %3d - %5d %3d %3d [%10d - %10d] %s US] u*hH~q h~d h~W IC!PSPssss ss3sC!Pu { u*Ph( ]Start of partition after end!U WVSE} @ HP_\_WO tw9~ h'7 _)Fwe[^_ÐOnly LBA values are valid in starting cylinder. Only LBA values are valid in ending cylinder. UWVSE@ PUXE @EU BpE)EE}EE)EE@E~hh U zEEB)މ}ËU)Fu~hY E xX UPe[^_In memory copy is initialized to: Offset: %d Use 'write' to update disk. U WVS} uSuVjjjjSW-(VWh EPhρ Vhہ [^_Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsUS] Sh} t}jhjC 0jh0‹C jhjC pjh ‹C Pjj?jC pjh‹C PS BBB ]ÐInvalid argument: %s Invalid partition number. Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeUWVSMQp,DuAPhlAP Ãvh NۋEjjWShDzhjG!Pjh̃G! 9tW!u 1 ShP h 4U B KHIM@EjSjwjh-Gƒ ;WtWjEPj7jhDƒ ;tjURjwjhWƒ ;WtWjSjwjhlƒ ;WtWjMQjw jhƒ ;W tW jEPjwjhqƒ ;WtWWU R&WM QjU B p jwjh!ƒ ;WtWM A @ )ЋW9}9vƒjRjwjhƒ ;WtWWE Pge[^_ÐPartition %d is not an extended partition. Loop to offset 0! Not selected. Selected extended partition %d New MBR at offset %d. UVSMuQp,DuAPhlAP0 00<t<t RhT=huht9Rh  Sh, hRPؙRPuu B ḣ e[^ÐUVSu]u OShρ豽 Ve[^Writing MBR at offset %d. U WVS] uVhP` j3ǃSEPsSRPWW~[^_ÐUÐUj\U1 %s %s UVSE;t"1t343hļ  <3ue[^Machine code updated. UWV}unh@k e^_Partition %d marked active. UVSMuQp,DuAPhlAP̻ Ãvh A1ɍ9u Ƅ0$A~Sh讻 e[^/usr/bin/lessPAGERwU WVSJjj v ƃhX t8tÃh^S胬 Ãt,SjhװэAPR S Vj e[^_Uuu uݐТؐТϐŐТТТТȡȡȡ`Ĥ,y|siaXNC<5/d)D 7x܏,ҏ̏Ə0HТТ ТТ@ТТ@~upinstinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0clearsasrcsadstsagiftunnel-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangevltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastnwidmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupػi i@4$i ix|i i@i i@<i i@ܑi0itDisoipxnsatalkinet6inet-a-A-ma-am-mA-Am-mextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRUlWVS膢 EE}FME E лƉuE лƉuEEлƉtƉuEлƉt ƉuEEUлƉu)ME }EjE 0jRh ME U܉Uuu}~aE}=E$Ut'u 6P uދ}=Mu EB-t}t%}~6EuVjj jhh }ujhj~ hjF tP} 7 u;u*t!~{ uhj HK C=u.U Bu3h,j PME L=u9u VtFu3hCjC PRуEE P} 7у[ ME }3=tu=xujh]^(tt% t*1@=EܡEE E$E(E,E0Ej"EPjj5x h` =tEEE Eġ$Eȡ(E̡,EС0Eԃj"URjj5x } h` h_<=tRjhuv vv5xF }"=p#1u =<}hv =lt@jh}w w w5x }h_ j& US]9t?t5x jjSv x} ]socketSIOCGIFFLAGSSIOCGIFMETRICUS]5tlx}hjQ Shi P }h} xCShi 5x }hC CSh~i 5x } C1]getifaddrs%s: no such interface UWVSEEEP thjK Eu}tjvEP Yjvh F xu1H1jvSA V KPRQ F xu9FESjuEEvMQ F xu } u}txt#F PC}G9uHjCЃ9}G=t&F PC9u jCЃ$;u܉}F xuE6{u }u#hhh|*xp j e[^_Ul<u Ru@ Ðerror in parsing address string: %ssource and destination address families do not matchSIOCSIFPHYADDRaddress family not supportedUSDPjjuL tPol Phj @Pjju L tP=l Phj DP@@@8BthPj Bt j@]S jhS. DBPEPr蒡 @BPEPrv ShFi@5x" hjxHSg jhS DBPXPr @BPtPr ShFix5x }hh Dk @k (invalid SAmissing SPIinvalid security protocolbad SPIbad security protocolSIOCSENCDSTSASIOCSENCSRCSASIOCSENCCLEARSAULWVSj4]S- jhS! j/E P ƃuhj F>/uhj j/V ǃuhje G?uhjL EPjjE PI tPoi Phj UȋBPEPr' uj j]SV% ffE܋Eĉڅt t`:4adhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexU希xtU;u@xuϰUVSEyt6Áƃt %9u9uAyu׸[^unknown %s media subtype: %sUVSu] SVhuSVPhzj5 e[^strdup,unknown %s media option: %sU WVS1u J ƃuh߱j %s U<WVSDž ƅƅh V贌 jhV VhGi 5x jjjhPFPW. ~u DžAVhHi 5x |jjjhSFPW. SPPhP{ [^_  `@no networkinsertedno ringactiveno carrier%s: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTflags metric %d mtu %d%s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: U %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sU VSj>=x}=p#+hj{ jhh舧 ,,ECECEC Es^ Ph|菊 ,jhh? hh%i 5xg ޅ}:=p#1th ,CCC CE,EFEFEF hh"i 5x }:=p#1u!,FFF h' jhhH v= Phn 0ffPhM E,EFEFEF hh#i 5x }<=p#1u#,FFF hW jhhx FtPe Phɻ薈 ,*x$* $*h$*j C e[^ÐUxt ju@xÐUUBf=uB f%BB B inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime 0%sinfty vltime U<WVS}jg=x}=p#+Ohj?w _SCj!jjhVGPS# 0t  Sh袆 1HjhP Ph"i 5x. }7=p#1th 1ƅƅPj!jjhSPQ" 0t  Sh虅 1HjhS4 Sh%i 5xL }=p#1t3h  !jPPh 1HjhS裡 ShIi 5x }=p#1tsh*& ath;肄 thDi thOP th[7 tPhe =|71HjhS襠 󥍵ShQi 5x } =p#1hs ~u jy Ãh` Ft*9|)P,Ph h h t)9|)PPh hӂ h% [^_UhaSIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%dU WSjb=x}=p#+$hj:r 1jhS蟞 Sh!i 5x }Pp#1t/u1},,@@@ hI jhh ,EEEE44PBf%PBf%PGPGf%Php hh"i 5x }==p#1u$,CCC h jhh4 ߃u}GPGf%PhD t't#CPCf%Ph  ,*x$* $*h$*j E; e[_ ns %s UWSj=x}=p#+hjo 1jhS? Sh!i 5xk }Pp#1t/u1}6,,@@@ hI jhh , s ssV Ph ~ 0hh"i 5x }:=p#1u!,CCC h jhh s ss Ph>~ 0 ,*x$* $*h$*j m9 e[_ÐUE h ipx %s SNAP 7frame %s UuSRh8 SRh>jx F? ,*,*};<*|$*<$*h$*j<3 F,*Ht< ,*,*};<*|$*,$*h$*j,)3 ,*< ~W ,*,*} ;<*| t$*$*h$*R2 F< ,*F> FBJ,*Ѕ};<*|$*>$*h$*j>}2 e[^_ÐUS]E tBBPSj tShj ]ÐU WVS}u j jWs =vWhj諯 tCt=ujhCPJ @CC CCS~ B)e[^_UWVSu 119}E8uA9} }<9t9uG1D}9tCJt!rtrJu E<uA9|[^_ÐAppleTalk does not use netmasks%u.%u%s: illegal addressUVSuC} uhpj0 EPEPhV] uEt=wEt=vVhj EffCECe[^%hu-%hu%s: illegal net range: %u-%uUS]fE{fE{EPEPh<S uEftUftf9vEPEPShDjG ffff]12%s: illegal phaseUWVEƿu -ƿu Phj e^_Ð atalk %d.%d range %d-%d phase %d AppleTalk address is not in rangeUS]=uf=uCffPf%Pf%PCPCf%Phpr fKff9wfff9shjz CfC ]ÐAttempt to set XNS netmask will be ineffectual U VSu CEuP ECECEC u hq e[^ÐAttempt to set IPX netmask will be ineffectual U VSu CEuP ECECEC hfC u hPq e[^ÐU WVS] ČEu ƋE󥤃uUBB M Ae[^_ÐUu[p Ðnegative NSEL length is absurdsetting NSEL length valid only for isoUuo p}hpj( tfxthj ÐUUzt pBÐU5Č5Ȍ5ЌÐusage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [media media_type] [mediaopt media_option] [ metric n ] [ mtu n ] [ nwid netword_id ] [ dstsa address/spi/protocol ] [ srcsa address/spi/protocol ] [ clearsa address/spi/protocol ] [ giftunnel srcaddress dstaddress ] [ vlan n vlandev interface ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] Uhph|*P2 jv vlan: %d parent interface: %s U$Sj]S;g ,hh:i 5x譱 t,Ef}uttREPhul ]SIOCGETVLANSIOCSETVLANU VSu l ƣԌ،j]Sf ,hh:i 5x uh|j*\ fuhh9i 5x԰ uhj[ e[^Ðmust specify both vlan tag and deviceU$S=،uhPju j]Se ,hh:i 5x, uh|jM[ juSƇ ԌfEhh9i 5x uhj[ ]ÐU$Sj]Se ,hh:i 5x葯 uh|jZ jSd fEhh9i 5xO uhjpZ ]%dd%dh%dm%ds%luUSuh)PS ؋]Uuu uinit: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsUWVS}cW Y t&jc Phh|*8. j^ 7 th&h|*. j6 j jh=s ή }hBjh^n} }hcFEEu5ftsuhSh|hyE PWQs Ãu9=4thjj hjjjj j jjjh 8jjjjjhjjh\]jjjjjjjjj j j jjjEPLjEPj训 EEEjVj jVj j虬 j菬 j腬 5e[^_ÐUSEEEE]U t>Eu E EjEPR^ Suŋ]UVS]UE t,Hv p#!Bu[^ÐUE Puj} H jM UE PujU ÐUE Puj5 ÐU~ ufatal signal: %sUS]S^ PhjL S cannot get kernel security level: %sU$SEE@ EjjURURjP à tE5p#_ Ph\؋]Ðcannot change kernel security level from %d to %d: %skernel security level changed from %d to %dUS9]t^EE@ jURjjjP+ u5p#_ PuShuSh<]ÐUEUSEXSG thhSF ]can't open %s: %mcan't get %s for controlling terminal: %mUS]S jJ jS uSh,j耭 PG uSh\jW ]ÐEnter root password, or ^D to go multi-user /bin/sh-sh/dev/consoleconsolePassword:single-user login failed Enter pathname of shell or RETURN for sh: /usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/binPATHcan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingUWVSIMQ~ jP\ ƅ:hUhbl ǃh^ lhG llB8t~j,hj6 ht[hjq ǃt?u jک lqW @ 1 lpR utp # j*hj讣 CjSj֣ t t ; t9rtHShRS j/Sd[ u@ƅ-PP$ Dž|j|Pj踤 ttFjhh藫 VSkJ Sh<DžtQFVhI>J hIh<jBE j\ u3h|jjj hpjWjB ÃtS u=p#tD jX h<h@H[^_sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modereboot~U,WVSW ƅEEEj]Sj jSj hUE&E)1=u1EEjEPjJ EPhI)G h)hIh:jL u?h)hIhSjjjj jA $}jWjC ÃtS u(=p#tXh)hIh|9uEu*h)hIhjS 9oEƒt2tNu)=<uE]ܐS' 򐐨th)hIhu3u+hh6h=R< Phe[^_session database close: %ssession database open: %sUDt,P@Ѓt5p#S Phy jjjjj D t1!5p#S Phinsert %d: %sUEEMAEEE@DjPQRBЃt5p#:S PEph0-delete %d: %sUS]CEUBDjRP@Ѓt5p#R Psh]ÐUEEUB DjEPRQA ЅuE1 U WVSuPē Ãh<Vأ  u1h<j赣 Gu؍e[^_US]s CtPԓ sɓ CtP趓 s 諓 S蟓 ]/dev/%s%sU WVSuF t{>tv~tpj, É1 C E >эAP豒 C 6hhP VS uS1*C(}u@C$ MY(K$؍e[^_%s %scan't parse getty for port %scan't parse window for port %sU WVS]u CtPU sJ ~ҋ>э P螑 C6vhP sCu&shsۑ C1e~tZCt P躑 v CP0C u&shs{ C1e[^_ÐU WVS15@t*~t V}^(V.ޅu@t!h-PGWVlÃta uWe e[^_Ðcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mUS]eO ushfu`EjEPjM ( }h(C P0? sC 0h\vj8 ]Ðcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mUWVS}jjH EG ؅tEPҘ M ƃuwh<tdtXu jEPuD tu轖 [u襖 }1uO O 5uy hjw ƃ uAp#t tu-jh`]sl s) j/ jhb]s? s V j7 G9E~&)E}wh|1j7 tWj7 EjEPja GP0C< wG0hjh e[^_USE=@PÃSjjCPs) SnCC t2S$t C(B( C(@S(tC$B$S29SWuCjE CS]ÐUEt!t<t+t0."< USNu j$@ CjE CS [(tG{uSbu$jjj t P9tՋ]Ðport %s changed utmp index from %d to %dU WVS1@c [(uG1@؋[(CP6j uۀK 9;tW3sh/;F t~uK js= Jc VSu5shK js VWP9Y ƅ7&^ @t#C u C js跑 [(uݸ e[^_U@t H @(u ÐUHÐ shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advisedUWVS@lt$C $ C js蹐 [(u߃hhxh=p. jh)B G ƒEEEj]Sj jSj hUjEPjV jhxh)h&hI5 hxh)hIhjF jEPR Euu1ې4j藏 u =p#tjHj ڍ jjj t Pap#=Hu u˃ tC~hV he[^_Ð UVS@t H @(uhhxh=, 1ۃ4j諎 u =p#tgHj jjj2 t Pup#=Hu u˃ tC~hhe[^Uuu umore-E-m-GMORELESS--help-?--version-V--VISUALEDITORviLESSEDIT%E ?lm+%lm. %fNo filenames allowed with -t optionU WVS] 6 d58u :K豪(#=tNhhhhj Pؐ0%MhC P豐 }ud3uh舐3 u.hƿtPGM}~<-t<+uzuut6jh脅 |t8u(h f |t8u |h> t8u  1MxP3&jMyjo PuKiuVu,W%cUuWjUtj謆jNj =X6i~jh4j 5X=u jn5QPt jL<=uxu j&huUKTt j<je[^_ÐUVSu]Su Va De[^ÐUWS]j߰Q,ǃSWD e[_Cannot allocate memoryUu u ujh-肢jÐUE@ t tÐUS]} PPTjN=Pt=tRjSO /dev/ttyUVh>e[^_TERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbcho|^home cursorll move cursor to lower left of screenalsrscroll backwardsU WVSh7 w u< PP "D D BBhM ! ٙhP ! `hS ! xhV ! hY v! h\ 4!  } l $~ DžSh_ "! tH#Phb  u e Phf  u e =Lu>=u5Phi  Phl {  =u e =u e Pho 9 u t8uhr e Ph  =t'u t8uh Oe Ph  u t8uh   Ph g u t8ue ( (Ph  uu e Ph  uu e Ph  uu Ph  uu Ph f uu*Ph , u e Ph  uu*Ph  u e Ph  uu e h O u%Ph \ t8u  Ph - Ãuue 8u e : jjPK P װщ h h RSgPh  à uue :u e ? XHPjR P6 װщ h h RSPh$  à uue Ph'  ƒuue =the h* RSg8u 8[^_ÐUEÐUh5Xu ÐU WVSu] >u;u0uE);tVǃS9|e[^_ÐU=pu;Zw7/ y ؉}  )ÉY$1e[^_ÐU@tp Bщ¡P(H,ut RP uu1ÐUVSjjxt99u'9tދA9B}ы9uAC C$1e[^ÐU=HuP,@( UP P$ЙÐU A9B uB$;A s Dt$J$ AJ$ B B$UB$~ HB$:B ~BuHP9u 8H @$ A9B uB$;A s DCannot allocate %d buffersUS]9X}=t+X]EPh xu jM@]seek error to 0UBuB(B,|9t@9up @щ¡P(H,@@@ @$jjjp j uujhT!Uhj t%@APQP H1ÐU" BAJR=a 9uա@ÐUjjjui 1ɃutÐUS]58Hj0j ‰RBBBBB B$B B(B,E BSE t H55Gx uX ]ÐUS1ۡ@tBu"ur wh @ u(5_ j5 G]ÐU@8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256U WVS}1E?G<9 <0}-<.t7E6E.GtP벐jh$jG rjh$j# ECN1]ECre[^_invalid charset nameUVSut>u1WsE؍=؍t3Vj tʃ;ujh%~jqe[^USh*&j 1ҋp,ŠDt   t  BvӋ]*s<%X>UUt:u&:*uXBPWz I  1}ÐU=v,x u&=v"x to=vx u1ÐU< u'?8 t+< tu1UWSBP@P&É߰эA)Cu=w1e[_ÐU=t!?=Pt1ÐUW8t6PWx I 1}ÐUWS=vDP@P2ÉډװэA)'Cu1e[_ÐUEPUWS=Pu >} uPPR PPPP@X u+;tPPa‰װ I ROw C;u1e[_ÐUWSPtm;Pths c u;Pu3jj3ÃhC PPSPXPBe[_ÐUP=uRua!P$-..--P.../../(/L/L/d/p/d/d/t&PtÃt F>u1e[^ÐU t&t" t*t&< tu=vx t =u1!H=vx tH=vx uUVStPQ \ƅtg5t PQ j)@P8‰)PVR1 V*e[^?UEU tt RhRhL2ÐUS]=tuPu SPh$jSe $5SI{9wu5Ptm1]ÐUS]=tS-tS|~Su1]ÐUh ÐUW}Wo I }ÐUUY oÐUVSE] uSVke[^U1t %@*!/?U t  !th4= }h4 @th4 t h4 h45$!done|doneUSá*$t5 6`7`7`7646`7`7`7`7 6`7`7`7`7`7`7`7`7`7`7`76`7`7`7`7`7`7`766@7`7`7`7`7`7`7`7`7`765$S,C<+t< tt RXM ;uS{5,S(P\(5$jCP5$jPCPS};!t&Xt PL SQ$XXu h95PKjh:5m"S0P[Mjh@5m]ÐUS]/4$789999h9H899999999h999999989999999999999999999999998CЃ `jSydIX$(1v;; (t <+t<-+t -t,L,@(=,uSH]t!5,h95S Z(<+t<-u (~S+]uE-]EEjPj/ C1*t$ !t @t @ t1 J t6 t1Su +݃w~ T][Press 'h' for instructions.] [Press space to continue, 'q' to quit.]USTt =mt@=uxu jjj5RP-7$=t@@B5@=Lu+=t"5.u jo3=t&ih:hwJvÅu j:h0+SVh=th@:=h!]less version %sUEEPh;iUTta=vPT@PTet5hlt,ttt g [ungetcc overflowU=Tu T=TrjhS<XhjTETÐU WVSuэ\9rP|K9se[^_Pattern not foundU WVS] 1= tXt %!/ tj ju,SEP5 K~Ãt?|= |~jh<4gtW$t je[^_:%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: UWVS XB]$(=t&=Tt j{+F=uƃ=u=tPV{~t˃=t+VVIEfEfEEESPN ǃEt PtpGc $?8BA@CDAGIEHpC BACDCCHEFCIGDCHH0H`DdBBD FAAhIhIHlGEIIIDD(EHEGIIB(DIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII>jh=j$~,=$ M$^jj5$\$~,=$ M$&jj5$T=$ $jj5$=$ $jj5$=$ $jj5$=$ $xjj5$_ ,Hujjj"tH$~jj5{"$~jj5O#kt 9,F=$ $t5$a=$} $=$d~ $d=5$,$ *Pw+=$} $5$RP -zmEEPh=$2Ij =$ $k =$ $D =$ $5$j5 t $ *$  5 t $ $  =$ $ 5$jr5 0n&=\t h=]Aj! 58h=j j5~$ƿ=1t ujh=[=tjh >Bj5jPi<5g Dj2=$ $5$W=Lt=t j褻95=$~I>EEPhQ>=$ $5$395=$~I>EEPh`>6=$ $5$3@jhs>I])jh=j/s,jh>jSƃ;5;5 jh95V Kjh>j F5Lh4j.jh>j~ƃ;5i;5 ] T KV@:jh>j&ƃ;5;5   V@jh>j%+ƃ;5;5  t u.V?05Lh4j% jh>W_ƃ=jh>jV s=UhLh\jCh 蝽xÐU WVS}u ]u1+j j …trމr1e[^_ÐWarning: some commands disabledUu uh_}jhxJ)ZÐWarning: some edit commands disabledUu uh}jhJYÐUWVSu}U ]9st 8u,u`B %gt.} BȃMCu8uzgu f&MIBu:}B:uBC9rd[^_U WVS} ud]tVssW=dte[^_ÐUu u5Uu u5UUÐUUE |t|t PR 1ÐU WVS}E |Eu|nux|duqGEuE@Eet-ct DxtU=VSÃSuV7ÃSu] W6 1t1e[^_UWVSju* E} EP@EU}uF}v@jEPG ǃt)jjjEP> Éփu#uW5 EPe> tEPWEP= ÃEP=> ؙ ;Eu;UtW5 3?uMu +uGtEPW PW>e[^_.lessCannot use lesskey file "%s"USh^N@ Ãt0S}]EPhdN+VS4 ]ÐU585IP5J5D2 ]ÐUEt5PPj>-%s"%s" may be a binary file. See it anyway? U,WVSE;Et}EPdEEEPEPEP^ E Åu]E}tEV޿QuEE-SCEtiEPhQ(Ru0 }t"uEPEP EP0 EPVEPjSU E}3EPMEEPhQQuP0 n=4u_EPuLu- t:EEEPhQcRytYtu{8  }tE䣬EEE8EPh5EPut=Pt P t PW=N=Pt3R'`t =D~EEEPhQ4P1e[^_ÐU,WVSEEu]SEjEP4 ǃW]S1 ,Vcu}u5XEVSƃuÃWN. EPEPEx}u S5EP;u1/EP0t jìEPe[^_UjUjRU WVS}u&SaƃOySu1e[^_ÐU WVS}u&S-ƃOySDu1e[^_ÐUVSu1ېSÃtS9uރSe[^ÐMissing filename ("less -\?" for help)U5 tjh$WzMj hQÐU PKWuKÐWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"U WVS}jW ÃS3 Ӄ } =tO}EPhW\MX05$YYY1ZYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY1ZYYYYYYYYYYYYYhW2 ljW͌ jjjP2 Éփ uDu?5]2 &j蚨jhXL=}}EPhBXJe[^_%s/%sU WVS]u t8;t3j߰҉э P^ ǃu18VSht\<#t<%uJtuEP[Pǰэ\ CF>ujCPoEËu>tP<#t<%u:5 5PSS ߰э\ CF>uEe[^_%s*UWS]j߰эAPեǃShC\W輦 WÃWS34 uS ' 1ۃW& ؍e[_ULWVSuVtYjjjV/ uu >8j@]SV. 19}PkuF9|1e[^_ÐUjjju,/ uu ÐU WVSEdjjdÉ߃T)ڋEH9|@EEjP蒤ǃSW語 S% э| GMAPQЅ}Q<>  M0 t t؍e[^_SHELL%s -c "%s"rU WVSu}эQ} t} эT tэ BjP讣VM QEPS蕤 h)^& ƃtM>tHj҉эD PWSVh/^W@ S$ h:^S ƃS$ e[^_echo %sU WVSu ǃjWh-_à t2SƃSe >t W$$ V$ e[^_LESSOPEN-UWVS]Ejh_z% ޿_8|u@EjSP'ƃtv}tP~jEPW}+ t V JEPE0E 8h_脡$VǃVX ?t1e[^_LESSCLOSEUEt P" h`$ tuu PXP ÐUlWVSuEPVc }V?=4uIE%f=@u5jэAPÃVS h?f=u1:jэAP谠ÃVSȚ h S ؍e[^_UtS]EPS | EЋU SS]U=<u ̳ÐUVS=Hu7u.jHDÉփut z9u 9ue[^ÐU=t ...skipping... UWVSu }]EEEt XH9Eh|9E~XH9EtE}=@t>XH9E|3趼9u9t&=@t =$tEj1C9u 9u )EtNCWV^CE@tu葲谱=$uhb.@M}~MuH11BWVRƉ׃u)u$E}uj~BunuiWVBE}uJ@=$t-u(u#u=Xu=\u uڱ=MD=Ht }tu g}u < }tm $jme[^_ÐUWVS}] uEbE9}tXH9~E(VSAE}u <Ox!VS6Éփuƒu}u}uc }t je[^_ÐU WVS} =Lt/=t&jHj觜j~@ÉփtXHPjtBte=HtLCBt11Mjjj@RPjwj @ÉփutcjuWVSue[^_ÐU WVS} j?Éփu&u!tS?щƒ u uWVSue[^_ÐU8}=@u'XCannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of helpUWSCÅujh@g<|j߰ҋ=dэ PS5dh`gW Se W }ujhg<W8 e[_UEU =(t P=(uÐUMU u(QH RBQj1LÐUU BAJj2| LU WVS]u j$jǃS˜GGGGVWLe[^_ÐUS]t6;uSiSPs S  ]ÐUEu(=(u1UEu(@=(u1ÐUS]SuSu1]ÐULÐUVSu((t%sV|& u (u1e[^ÐUS]Su u Sz]ÐUEt@1UE@ÐUMU ABABA UUM BBAB AUE@ÐUE@ÐUE@ ÐUUE B U WVS]u ut[=uP@RPVSTRVS臲u(VSVSg oÃu1 t u_X RPS t3=tà t:u3Éփ1-t tu赳ÉָP#=t8t43薳à t ttسcÉ։؉e[^_ÐUWVS} }=u>EU RPP@;U u;EwM] )Ӊȉ11RPPEU EU RPEU ΰ=tfŲ t uF à t tucƉ׃2g課à t˃u)Ɖ׃WV#uqEu}6WVpUMQR +jV A빐9} ui9uvd˱Ãt t P t*}RPS3 t={EMQ EUe[^_Cannot seek to end of fileU!tjhn6IRPщƒuuXHPjjXHPQRÐCannot seek to beginning of fileCannot seek to line number %dU WVS}WGÉփut&VS0u5VSK/~u&5RPjhTo4}EPhuo4e[^_UEP87uEURPDetermining length of fileDon't know length of fileU VS#EU}u}ujh\p45EU}u}ujhwp4dEÉEEE‰UEEjjdEURP9Uu9Ew EU5RP e[^ÐUVS]u VS|u#׮ t u ukNÉփuVSIe[^ÐCannot seek to that file positionUWVS]u u7EVS6ǃ |P+}~%jjjj:4RPWCjjj4RPWnVSrtjhqX2xj3EUj3EU }u}t9uu 9]1;}}[}u}t,;u'u;]w jjjEURPX+ED[VSnÉփutG;}|)}URjjVSXHP },9u#u9]wjjEURPGP([GXH9}VSWÉփuuy0VS3jjVSXHPe[^_U@DLPHT%6dU WVS=EU RPB Ph^t@4P虎 @4эQD~@؃@Ju@=tu t4@=t@0 @DPDЉEuӋEHe[^_ÐUEtt,tt l$ 1UEtt,tt   1UVSEu u cP賱t1M@~?9tPjXt@t ?9t VÉ؍e[^U @@@R4PS)DÐU WVSu] EUjRPRP? tSVE=~!S‹EDЃ; @=v @~rt3P4< u&:uS ~@H88@~2P:t(<t$ uuP ~  D@48ED1e[^_ÐU WVS}] u=Tt4X\RPTPPt 9T u =uT X5\1 VSW e[^_ÐU WVS]=LL4@08u$U MQRj0P_uU MQRjՐ_uE URPjSŐSU MQRjS뢐u_t t+l\E URPjjb=@9"L% uK=tu tU MQRjj @D=tuS =uE URPjSSË5 VjEV‰߰ D}DЃ;D;tME URPVPZu#@C;u#U MQRjS4t @1e[^_USTt'< u}uX\RPTP9D|%=`t=xu4@=u#4@ @ B@Éʡ@]~ UUM =Pt"{=t {@4ÐUPÐUVSEU uutRPgu kuF4 CH tu !3rt4e[^ÐUVSEU uuvRPѡtE11733K t tց4w}te[^U庀`sBr| d `pthlxÐUVSM`t`tAZr +Xp Yq[^ÐU WVSMu }` 9K`tC 9u;swߋCE|t ‹|EBrz JSRES<EP0=uQ`PHÁ;`t(1C9u9SwދVN;`u5PQPe[^_Calculating line numbersUjh>~S'TÐU|-uF+ch V h‚ Ej讑jj]=j3 Ej jhĂc }MQ 1h͂ ÃtZ;tU>uS:~ǃ@j߰҉эD PU~VShӂW> u>u hނV}ǃW襾W| j EPF MQ jP<j~)EPk t j}j;e[^_ÐUWVS} EPEU}u }uEyj!Éփu u11js!}.u69uu9]wVSEURPu u EURPVSW=e[^_Cannot seek to start positionwCannot create pipeUVSuE URPEtjh_#h}VV ÃujheghVh‚ǎj|jv:jj  }u}tE UE U;UQu;EwJ艙ƃt>CPSЅ} ;C| tSV{ u tMtH5ƃt{ uSŲ jj  j9j{ Uj)91e[^U3L@Iy\`Invalid mark letterUUBw %Bvjh 1 Cannot seek to end of fileMark not setUSE' $t&.tO^uvCCE蛖tjhsnCSXHC RCSC =X5PÃt"{u{ujh1؋]ÐUu%ÐUSuÃt%EPECECEC ]ÐUEPbEu}t \\EBEBXÐUugƒtsXu,zu&zu XBBB BEBEB E;tPuuEURPMark not in current fileUuƒt!9u BRjh3iInput is not a pipeLog file is already in useNo log fileLog file "%s"USE]  tttjh=|jhcSwÃSP赑8=}jhÊXEEPhϊ;]ÐUu uÐLine number is required after -lUS] }uG]EPjlEP+ }ujh\SI]Cannot use lesskey file "%s"US] }u$St]EPht(]ÐUSEU tt tXlRuP5 tQPnu;f7u!uStjJu5RP]Tags file "%s"UUE t+ t<u4PtPEEPha+/U}u"\u ˮhǍ辮%sUVSE] tUtouiÐUE|~ u)ÐUS]|Ĭu js]Use "h" for helpUE=\uUt|OJjh 9js} 63j_jsÐU,XThere is no %s flag ("less -\?" for help)UWVSEpt&PjBpjp_18SE0V@E0>$8^llllllllllllllllllllll^lll^lllllllllddddddddddU:+NBUE\E8+u@EPp PkVuEMzVÃu*VEEPhUjpCt1 ttktF}uS { ft S CW9%Ps0E8EVPEjVUR)‹C CtMQjЃE8e[^_There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flagUWVS}uW Ãu#WEEPhr|Cu(@t$WEEPhcMu(t#WrEEPh6 Ctuu E 8u1m{} j9Cto t C) ttS : S {  tt9%PC 09%Ps‹C w|rjht7 t Nt3EEPjE PFƒ}u'C  S CjhCtu uRЃt {}#Ct%:5|0jC t?C EEPs%tC t e[^_ÐUE} t%%-%sUu蛑Phhhm hUu t@S%ÐUu t@ u1@ÐU=p%String is required after %sUuCEEPhÐUpPÐUS];uu jhk؀8t8$u@@8u]Number is required after %sU WVSuE0j1;-uGC< v:t Zu eEEPhK) jj1TBC< vEttډЍe[^_Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenU`=`tQ tA 9uÐUSM`=`t/l9tBtDC9u :u1[UhxE tj 9EPE PEP }Ujhx UEP肜 E%s: %sU WVSu5p#辠 Ãjʉ)Qaǃ SVhWa e[^_ÐUPTUVS]u  ĔujjdRP豔ĔĔ9 u$;vjjdEURPRPVS1؉M]SQRP@e[^UWVSt1ۉ]}9]twtt*ttttuGtEt t+ttCt{tts]tu uVEWEP$ƃGtt*tts#t[tse[^_ÐUSȔt:=tShP 9t Ȕ]US]=Ȕr=trȔȔ[ÐUS];tPC;u]ÐUWVSEu t؍]ߐ0Cut-C)9vKP?9we[^_ÐU WVSu} E>te>%tPFEIFFE8EPjEP}tgE8EE8^u@EM 9t.9t)E8\u@EEEAU9t:uڀy$uIS AShhm S jhe[^_Tag not foundUWVSt.PIjh|511jjEuΉ]uEP؉RPcÉփ}tEut=tVSUR װэAPuR uEUe[^_/dev/ttyUjht } ÐUSjEP5Ãt$} j<}uEuE]Uuu uFfs.%sUlWVSu] n}Dft Ft .st%shSV|u4)Ƹx=ttt =t5jh3P` js3PK tWVZ tVhjo E%f=@t193tjV3/ ǃ93uW %s: is a directory%s/%sUpVSu] =uNEPV t V=u'E%f=@uVhj }u"EPSm uEE%f=@u7j/Ve{ u@PSh}hSp =tS; } =p#uSVЃtSh 1[^Ðusage: ln [-fs] file1 file2 ln [-fs] file ... directory Uhh|*C j6 Uuu uUUE @PE@Px ÐUE@PE @PX ÐU WVS}u N<_ UVSUfz2uB@Ph\hS &B@PBph_hS ރhSV距 u#5p#S PVheh|*  hrX S [^UVS]1;tjp,Du =u? ,*,*} ;<*| t$*$*h$*R FC;ue[^Ðusage: ls [-1ACFLRSTWacdfiklmnopqrstux] [file ...] Uhh|* j Uuu u%m:pinvalid file mode: %s%sUWVSu EhLj8 j ׁf}ME emtpuVER5#? Ãu5#hQj hSZ> ǃS裓 hMVEPau4ƃ>uEUU߃>j6S HVUH;v8/t}t!EPS6z}PEGS6 |fv,S6 u6hg Eu>cUR? /%s: %sU|WVS}E fEEfEEEh SMÃh S à ;EPW tE=p#u&EtEPW tK=p#tBWhg :E%f=@tjO PWhx /A1x[^_Ðusage: mkdir [-p] [-m mode] dirname ... Uh h|* j Uuu u%mkfifom:invalid file mode.UWVS] {BEEhxj 58y1t uwEn?tWmuR5#< Euhj hEP#; fEEPg EPhhSEP^w4)E;uEP+}u;}u C8puEEC}tEP}tj諘 fE}tEPSEPP4 EPSEPP node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%sUWVSu ]Fut4SCtRE}uPh? u0]U$ut RE}uPhz? CtPt0 { uPE}uPh)? Ct h=t&hE}uPh> C@t&hE}uPh> {}&hE}uPh> C =u= t$Ph%E}uPh+Y> C$=u= t$Ph3E}uPh+"> C(=u= t$Ph9E}uPh+= C,=u t$PhBE}uPh+= C0=u t$PhHE}uPh+= C4=ut$PhPE}uPh+L= C8=ut$Ph]E}uPh+= CC<=ut$PhgE}uPh+< C@=u @PhqE}uPh+u|uPEPEP[ PUx1uPhE}uPhB< 0u]=uEtu xt4sphslhE}uPh; =u f{t0CtPhE}uPhu<]=uUtu xt4sphslhE}uPh; =uf{tt+CtPhE}uPh: Cxt)hE}uPh: Cxt)hE}uPh~: Cxt)hE}uPhO: Cxhu]Ett)hE}uPh9 Clt)hE}uPh9 Clt)hE}uPh9 E}tPg9 e[^_ÐU WVSjEPL 19}Q1ۃEPEP tEPETP u ]èF9|1e[^_ÐUVSu<u@=.Ã;tj3V裁 t؃;u=%e[^empty type listU WVS]tuhrjcq nu~ou EEj=VO t]  t3PV/ u;tE;Cu [ C!VhjDl 1hV| ƃ[EPo e[^_Uuu uU  updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rcd9660%s: Filesystem not supported by kernel%s on %sUWVS}u 1ۉ]EEEE0$px<4,EPh5#U hVWL;4)Ǎ4tvEEE Et EE]EPuVhw })=p#-uVh8jh Vuh_j jw usage: mount_cd9660 [-egjrt] [-o options] special node Uhxh|*T jzw ,-o %s: option not supportedUWVS}u Eujj u>nu~ou EEj=VK t]  t3PV* u;tE;Cu [ C!VhjXg 1hVz ƃ[EPj e[^_Uuu u+   @reloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %sU|WVSu] <E #4}EE+?touWh5#fh5SV6u4)ƍtE[EEt E EEPuSh8r }\p#tt!-t<"d5p#% PSuhjd jBs usage: mount_ffs [-o options] special node Uh$h|* jr ,-o %s: option not supportedUWVS}u] Eujjg u>nu~ou EEj=VbF t]  t3PV& u;tE;Cu [ C!Vhvjb 1htVu ƃ[EP3f e[^_Uuu utnje`YS LupdateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaGsl9u:g:m:o:"%s" is a relative path.getcwd/using "%s" instead.stat %smsdosfilesystem not supported by kernelmount table fullnot an MSDOS filesystem%s on %s: %sU WVSu DžDžDžDž} $ǃ<$!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!,!!!!! L!!p!!!! ! !MMMM5#.EDže5#EDžE5#rfEDž$Sh5#PhVMQi0)4;Et4 t>/Vhv hQV uhj эQ)PhRA эA)SVRA Vhݔ  MEt EEtt udPV uVhj6 u 0Eu 4Eu ,fUMQVhj }Zp#t t-u!'85p#> PVuhPjk\ jk unknown group id: %sUS]S9 t@Iـ9t&p,DtC;tDu;u Q" Qh#j[ ]unknown user id: %sUS]S9 t@Iـ9t&p,DtC;tDu;u Q" Qh1$j\[ ]invalid file mode: %sUVSu1ۊ<wCjEP5# ƒt |E8tVh$jZ e[^Ðusage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir UhD%h|*t ji ,-o %s: option not supportedUWVS}u Eujj' u>nu~ou EEj=V"= t]  t3PV u;tE;Cu [ C!Vh%jxY 1h%Vl ƃ[EP\ e[^_Uuu u))))(((((( ((((((( (@(((((( (@nfsv2porttcpsoftnqnfsresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsnqnfs only available with v3port=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernelnqnfs 1/mount_nfs:nfssvc err %mUWVS# 'Dž|E}]uEx|Ut΃F$d+,, 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 10- 1 1 1 1- 1 1- 1 1 11 1/ 101 1 1 1 1 1 1 1 1 1 1 1,-$-t- 1 1 1 1- 1 1. 1 1 . 1\//040 1 1x00=thd)jtS j=thd)jLS c>j V5# ‹E8u}5#h)jS S8K  Kj V5# ‹E8u5#h)jR S@K@Kj V5#c ‹E8u5#h)jUR S(KMK@Dj V5# ‹E8u5#h)jR S: or @ speccan't resolve hostname for address %scan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPC%sbad MNT RPCnqnfs 2can't access %s: %sU,WVSEjZEPhh/ j@UR/ tX-j:MQr/ uh2]PUh S t3M Atbjjh  ƒuHSh2fSG ƒuSh$3DBr 0h Y =t3EE1EEEU bEE M = f ofEfuPU z uPMQhhm/ fEfuhF3f  1=t+E x u"jjEPURhh EPWVMQhh3 à u#hR3 k"E EE @t   UCUMQRhh 8MQh8jSЃ t] u4}u =1 ha3S+ Phi3h|* uBhl3S Phi3誀 $P PBЃCS@ =tk$ t!uhx3j j"X U jU jT jT h*X  j<=tt7t jW p#P PEPh3 1>Uff M AAA($AADhe[^_ÐUhE Pu^I UWVS}u EVWC >t Ft t#F j FPWF F PWB V B?RFPWF tlEPWB tX1ۋE9E})EPWB t8F9EuECE9|ك}7 ~)P1e[^_ rhost:path node [-r readsize] [-t timeout] [-w writesize] [-x retrans] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt][-23bcdiKklMPqsT] [-a maxreadahead] [-D deadthresh]usage: mount_nfs %s %s %s %s Uh>9hd9h9h:h8:h|* jT ,-o %s: option not supportedU WVSuD EujjN u>nu~ou 1j=VO( t] t;PV u;t%U{ tU;{u[ )C!=HuVh:jD 1h:VW ƃOEPH e[^_Uuu u)<<<<<<<{<v<q<j<d< unionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:kernfsFilesystem not supported by kernelUVS]u %E-?t#ouEPh;5#h<VSu4)Í4tjuvh<P t'=p#-uh<j{B jj 1e[^Ðusage: mount_kernfs [-o options] /kern mount_point Uh=h|* j.Q ,-o %s: option not supportedUWVS}u豾 Eujj u>nu~ou EEj=V$ t]  t3PVY u;tE;Cu [ C!Vh">j A 1h >VDT ƃ[EPD e[^_Uuu uA@6@3@0@+@ @@@@ @@? ?updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ext2fsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %sU|WVSu] 0E #4}EE+?touWhP?5#jhK@SVu4)ƍtE[EEt E EEPuShN@L }\p#tt!-tU@"p@@5p# PSuh@j> j6M usage: mount_ext2fs [-o options] special node Uh0Bh|* jL ,-o %s: option not supportedUWVS}uM EujjW u>nu~ou EEj=VR t]  t3PV u;tE;Cu [ C!VhBj< 1hBVO ƃ[EP#@ e[^_Uuu uIif%s: destination pathname too longUWVSu]@ftiu. hCU RV u4)Ƌ} <} k ju+ SE t輡 uE%f=@t#~- U r2ePgJ } TװэA=vU 2hCj: RW< эQ׉/t/GDžN2E j/S uNu mNu zuL9rH)FPVЅ}W|S )) tuȃytYuM QEPD u1T=p#usSURuSMQhF8PSC uI tE Ph@G'EPy u1EPhcJi e[^_-PRpmv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmU9B …u?jE PEPhMhMhMF hMh@Gh jB jEPR uhMhMEthMhMtPhMA …u9jEPh=NhMhAN hANh@GFh jB jEPRQ uhANhM4EthANhMu1PhANhNg Ðusage: mv [-fi] source target mv [-fi] source ... directory UhOh|* hOh|* j? Uuu uU1ɋU9s f3 9r,-o %s: option not supportedUWVS}uU Eujj_ u>nu~ou EEj=VZ t]  t3PV u;tE;Cu [ C!Vh~Pj. 1h|PVA ƃ[EP+2 e[^_updateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:Ua:b:c:d:e:f:i:m:o:s:NOS:UT:a:b:c:d:e:f:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s/sbin%s/newfs_%s/usr/sbin%s not foundswap/dev/%sr%s%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% disagrees with disk labelWarning: calculated sectors per cylinder%s (%d) %s (%lu) mfs:%dU\WVSDžE DžhQ58蛣 t,Ã~ShQDž0R=t Dž Rl`\PU RMQ;$8Y^^^^^^^^^^^^^^^(Z8Z^^^HZ|ZZ^^^^^^^^^^^ZZ[@[t[[^^[^\D\x\\\]]]]`^^^^^^,^5#Z 5#h_Rg#fV5# 75#hR5# =5#hR5# 5#hR 5#b 5#hRo5#. _5#hS;5# +5#h=S5# 5#hSS5# 5#hlS5#^ 5#hSk5#* | cV5#hS25# #5#hS=t#h(h<5##ƿSu ƿSu hSc5#" S5#h0T/,.5# 5#hPT5# 5#hlT5#v 5#hT#ƿTtsDžt5# K5#hT*5# }5#hT/ w4)EU U t )M}t<E =ujPHTRhThQh QhThUhPg (RQ" PhUhUhRg (QP RhUj =%U1t DžeDžDž@DžDžDžDž@fDžfDžfDžDž@Džƅ fDžlj/P_ u_Rh*Uh0Uh Qh uPh*Uh6Uh踡 Dž=tDžRjRÄ }#5p# PQh;U* jPÃu#5p# PRhBU jPh*U- uKjWh*Ul- u ƆrWQ . tGPP. u!TPRhUU-Km=t<t3Pb Ãu5hiUjQ/ }#5p#\ PPh;U RQ- }#5p# PPh;UV %f= t&=uR58hU jM 1Q Bt"z`~ B;~%Rp,DuU 2hUQPËp,Dt>uPE 0hVX~ uPM 1hPV3=u9v&=uPPM 1hV=uCH =u!C0E 0hV=u!C,U 2hV=u!C(M 1hVU=u CL=uCJ =u FC(=s=u*F F= ~ =u=H}=u =E= t<=u3h0Wh|*d jhpWh|*P   =u C@=u CB+S89t!RhWPhWhWh|*Ӥ =u\F`FdF h  e ș ș ș ș1b~Wȅ} RQPV Й~} 1=uGtSRQ=uP6# R$# =" PhWQ Dž(t Dž DžhlR5(M qhQp$ }"5p# PE ph;U6 ja% ioctl (GDINFO)USh hedAu ! }Vt0PA Ãu5hiU#hiM uhD ]ioctl (WDINFO)%s: can't rewrite disk labelUS]=uNfǃS{fShgdu ! }hj{L uhj]ÐUVSu] jj~\ }+jj58US SVjN S SV j# usage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -U enable soft updates -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -r revolutions/minute -s file system size (sectors) -t file system type -u sectors/track -x spare sectors per cylinder -z tracks/cylinder U=t58hk58hkh|*| hkh|*j hlh|*X hPlh|*F hwlh|*4 hlh|*" hlh|* hlh|* hlh|* hlh|*ڛ hmh|*ț hPmh|*趛 hmh|*褛 hmh|*蒛 hmh|*耛 hmh|*n hmh|*\ hnh|*J hPnh|*8 hnh|*& hnh|* hnh|* hnh|* hoh|*ޚ h0oh|*̚ hPoh|*躚 j buffer malloc failed mfspreposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk minimum bytes per inode isWith a block size of %d %s %d Minimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, This requires the block size%s to be changed from %d to %d and the fragment size %s to be changed from %d to %d CylinderWarning: cylinder%s groups must have a multiple of %d cylinders panic (fs_cpg * fs_spc) % NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder File system performance may be impaired. and ntrakrotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sinode blocks/cyl group (%d) >= data blocks (%d) must be increasednumber of cylinders per cylinder group (%d) %s. Filesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed cylinders%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d, %s/>U,WVSDžhh j-tKhf,t2hM,th4,uhlq7 j EP =K Thj  |tXuhqƈ j ( jEP|Pcx tEu P j  jf+ 9v1S++u j  EE=tǀ,ǀ(ǀ,ǀ(<=t Phq j  55HP- Phqd j QhqF j J0B4ytQhq jl ptPh r jM 9}Sr4hLr j'  hr0hr j 9}Pr0hr j ӉZHЉBL8<@DBP|~1@ѽ||BP@TP4|~1@ѽ||BTHTX0ىH8@`|~1@ѽ||B`{8~)C0}Ps0s4h s j PC0{tCxC4=C|Cd|~1@ѽ||Bd=$ O4DW8t8w8wDO8DG ȉGI_|ىșËO8DGG|~ѽ||BH#tZۉZJ0I04ΉBtLPDž|LӋPËLÉΉߋ04|yJ`B|X|~)u$XXѽ|~ |t܋Xx`{xD1ljpS0VUUUꋅ)D9p~pC`pSC|dCCdDHxDljtp~~$Dž\<9DDž\5F0=sF0|u |DXۉXxxH|xxtP8҉P8@`~DP4;P0u$hMs his j x8H`҉P4H|ɉH|PE4B}B@C|A}A@DK0<$4K`ӥP}P2D;<mDžXddt`)ؙ=sxLșƉp[0VUUUщ)D9pXx{8s0t`+d)‹{x\ؙș@PhsVhs Y08Y0y8y`O4y`ѽxHxDxPE4B}B0A|ÍC}C0Ã$~B4ӥP}P;8w ;8vX0ۉX0vt`+dЙ=sxLșƉp[0VUUUщ)D9pX Y0VUUU)‹YxLș9p~-t`+d@Phs 6\u35hs tQh t \t/hLt tSh tp Xu \tW@09tPRhktht8 @49tPRhtht je Йxt`xWt= ttPh u辿 Hxxx= u5`+dșNjNxT9Й,w0VUUU)T(Й9,~[DžX+x`+dt(9= ]9$Dž\+x`+dș_xL ș󉷸PEB}B؉ O|A}A $O0$&O`ӥP}P$;C|Ë Q`ӥthLu/ j ;t} tRhu j^ ;5= uhuڼ \uXu j \t'Xt hu\t hu h v{ h"vc = t j =PEB}B؉_|P}P$~.O`P}P ˋ@DKL!Cd؋G$Njz|Ë9~CDžhhLv jU ǁL@d#ALAhuǁXPX҉W`G|‰؉љ ÁduLJT\LJX`*ǀT``X J`B|9~Lhvhvhvh wh Ey8ÃSxU t@`P59$~,5؅}Cvl)ø2 AUS|ЙÍyU tDTIT=MO|șƉЙىșPщЙÍxU t0 @Xpf@8EU9UMH( 5F+EA(Y8]؋Eׅt{)}؋]D4EEI8M)}U9}[E}xU t @`‹E}$M)@$EM9M|]] A8;EHEy8ÃSxU t @`P5-$~,5؅}Cvl)ø2 AUS|ЙÍyU tDTIT=MO|șƉЙىșPщЙÍxU t0 @XpfB8EE;EU9U}j+U4E}xU t @`‹E}$M)@$EM9M|$vh[l MCE11;Hp}XUE䐐EEtAtU$9~1ɉt EEUCEGE;xp|t$9~ BB$BB B]BCB CB$C Rq0EQ!UUQA IdP e[^_ÐU WVSE08@=t f C f Af"=t jhħ jh(, Pp4lj=H (,@DYL!! 5q4IdW jh e[^_ÐUWVSE=EE H9E}Tu1ېUfD$fDDPVW~ MD)EEE H9E|UUMEfLD$ʃPRW# e[^_cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 UWVS5Hd@ PYxU t h:rxu hl`1;x}Q y8QxU t@`P5u&x8;x|hW 19H`SxU t @`P5y$~,5؅}Cvl)ø 2K JE @t C Q|ЙxU tDT@TJ|ȉәƉыEș}ӡىș}PщЙҡxU t0 @Xpf U;Q0q4TЙËA8)B Q8)P$Q8)D4;q8}V7>}xU t @`‰؅}C$)CF;p8|5Hd@ Pe[^_Ðfsinit: inode value out of range (%d). UWVSu hE' UBl5Hd@ P {U th:p j K [\5Hd@ P MHA,9rVh j F 1E׉ËMA!EEAY1qxQ`ËUBdEPr0S 1qxM<1u EPp0SURe[^_ÐUj getrlimitsetrlimitUWVS]=j H0!ƒ)R ƃ}Wj }h\ EUEUWj}hƦ|\ E)!á9v)أtS! 1e[^_ÐU WVSu} W Ãu1tWVSm VD؍e[^_ÐUVSuu VÃt VjS ؍e[^ÐUseek error: %ld rdfsread error: %ld UWVS}=t#==E PWUR }E MMEeÉ֋MM΋EEjVS5 }(Wh5 hFZ j!G U REP5 ;E t&WhK踝 hFZ j" e[^_wtfswrite error: %ld UWVS}=t#==E PURW =}E MMEeÉ֋MM΋EEjVS5 }'Wh5 hTY j#* U REP5> ;E t&WhY蜜 hTY j$ e[^_isblock bad fs_frag %d UVSUu ]B8t? tPjtu^<3%g؃ '؃ ك"38%r8hph|*` 1e[^clrblock bad fs_frag %d USM] UA8t8 tM_t uRaЃ  EЃ  ,у q8h2h|*;` ]setblock bad fs_frag %d USM] UA8t8 tIWt uJYЃ ?Ѓ &уq8hh|*_ ]COLUMNSUVS1]Shht@j7 tsu(h~ t Pʙ ƅuPe[^Uuu uMFailed open to read on %sFailed open to write on %scan not gzip while appendingFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sULWVS]t P ($Z$uhjS7 }fSh 5p#j1Nu:4hhS=7 } ShC뫐$=5[ z=th^j茇 u:FhjS6 }(Sh5p#jY=} t+Pt5h5p#jh5m }5hҭ5p#j'%f=@uB5hj5 $)f= u2EPhm8@5 tTf=`u@jjj5S uu=p#u  t $uOO$$/utB=wu  ==눐u?t5ؙRPRPvщ u5= ~ؙRPWVщ u (=1e[^_Ð%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. UWVS=}&=tk=ub=t/ЯBHJȅ|  Rj M 5h5ЯW 5Я' =$tTh5$ u:%f=u( u5 $=w4=t+(~"jP jEP5(> 5 =t7=u.5ЯhH@S 5Я< =u ==t=S=t8ЯBHJȅ|  Rj UL u.RP5hX5ЯU U׹uX tjhRPjh QRRPh5ЯuU X}tDRP QR5HP3MQh5ЯU 05Я薶 e[^_US=u1=~(hS5X ÐUnable to truncate archive fileU =uKjjj5 |RP5 }hx5p#jK1ÐCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specU=u h=(t55hXj1ÐFailed read on archive volume %dEnd of archive volume %d reachedUSMU =uERQ5% Ã~T;t{tm(aRQ5 Ã~>}5h5p#j25h8j؋]ÐWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUVS] Su5 ƃ9u }5 }~KtCjjj5v Ӄ)ӃSQ5 |x}sp#BvEu\1`}Kp# u"h8j'1t tu 1|~  = uHhxjnu5h8?}5h5p#j(9Pt әuhjbh8jQe[^ÐCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.UVS=f=Yw hx8t tbtfEE@Phm5 ~ =tjjj5Q |HVSRPy)։؉jRP5" | =~hj1hje[^ÐFoward positioning operation on archive failedU WVS}G} }=u|jjj5> Ӄ|gȉEU 59 u);v!)ډW M] _jRP5 |1'h5p#j{e[^_ÐReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.U VS]u ~-u(^Vhj06.jjj5 }h8)y"=~hxj11jRP5Y hEEEURPVSHuщ thjNfEEURPVSr]CShm5* }'sh85p#j^ 1e[^ÐUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksUWVSDž=u9hS5N } htfDžCShm5J ߅} h84fDžGWhm5 } hxhS5 ƃ hhS5| }hfDžGWhm5| } h8ktHthjDfDžGWhm5 |wh5p#jC[^_Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again U WVSShj }h 5p#jFjSj} }h'5p#j== ǹPhXֿ: 1t ֿu 5Rhh5RhhX{ wh,1h?5h!hhXhh S|޿u65htVuM~5ЯPW,d5ЯGPj2 t5@t.P菹tphw5p#j wWK WOÃx|RP/} W=i=\ЯBHJȅ|  Rj !+ !WHƃ}6x|RPW_ RVW@<ЉÃVWrI =tB=t9ЯBHJȅ|  Rj a* u% x|RPt3xt-5Ath5p#jWi uW͔Ã@(Ѓjhj聴 8貒[^_Unable to open %s to readU,WVS}E@Eu Xz@,Ѕh@0E=t GE Ejd EUUWY}tW轮t t u9jj E}h5p#je`W迕ƃ}MQW%UWЯ 6=t3uWU} EPWTW蒯 t:~5ЯURW_5ЯGP. WMщƃ}EPWlTE~a=t@=t7ЯBHJȅ|  Rj A' EPWT]SuW@@ЉƃURWS =t@=t7ЯBHJȅ|  Rj & Cu}tEURP||| u&xtx|QR|JW[Zu:W3uE==t]5h5ЯP. 5=tW|e9t5W$|O#Wu:Wtx|RPu@(ЉÉVS|==t)=t 5Яh ) jWX[^_ÐU=t 赬|( |@DЅ|jpPÐCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sU %WVSDžh 5 S\</t /GDž )]S5/ } 5h5p#jE%f=@t5h\jK Qݷ=t c uDžVaV=u =~/Ћ);~FPhjsQDPW_ ƅ EP Q=  uL=t=t+E98/ =tE9@E98VQVo |V迍ƒfP QV艒}V蹧!=u =tUEPFP^ u>=t&=t E98!E9@E98=t5ЯFP% =tV? Vc@ƒ:=U=HЯBHJȅ t9 t4w V> VBƒ}Vy낃jj  }h5p#j%V{<Ã}PVbKV xSVXSV.=PV*K=tB=t9ЯBHJȅ|  Rj  VRxjhj诨 f1pO[^_ÐPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.UWVS1uEX߸0SU_}t/Et }hu$=hj\0SP 9uh0UR@$Ѓtzu"EPVh0B8Ѓtu =t|hjEPh1h0跫 E0UxtAUR@8Ѓu. hh\jY萐1e[^_ÐCannot identify format. Searching...Sorry, unable to determine archive format.UWVSEE=|$;E}E:}}7UEPh0v1_E0S,KE0}u&= h|jEVSl Ã~]U9U|1E=|;<URh0ЃC>}˃}u"=twh|jIEM}~.EPh1h0 +u]050E hje[^_Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableU00=u @=~hPhj/thPhj=~~h~PhPj^5} }/0‰481ÐWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleU00=u?t6=~hPhthPhjSS5}} .0481ÐU00ÐCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.U VS=thj=u 84)‰ЙEU EEEURPEU RPTHEUEeÉ֋EEƋEE9u u 9]v]uVS++]u 0849s555888;4r΃08)‰ЙRP|}0É840‰48EU )g|1h0jQe[^ÐUnable to append when there are archive read errors.Archive read error limit (%d) reachedUS1ۃ==uhpj}e2}.08У4Й11ۃ550ƒ~C9~Phj kt}]UE 8)‰8PuRT ÐU,WVSu} EE U84)‰u};M u;UwUME8+u} EEEURPWV:GEUEURPWVDEUEeƉ׋EENjEEǃEPWV}M])EU \84)‰ЉƉuw Ɖx tEU;} u;uwƉ58)u}}u}w1e[^_ÐU8;0v+4)PjR) 485] ÐU WVS}u ~\84)Å5% Ã}.9~؉ÃSW58& 8)ރ1e[^_ÐU WVS}u ~X84)ÅÅE )519~؉ÃS58W讚 8)߃E e[^_ÐUWVSu} 84)‰U 5.E}YEEE9} u9uwMMQj58蟚 E8)߃uv1e[^_Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUlWVS1ɋEHLb84)‰Ѕ59u9wQ58E PN ~) 8uw}UhhE tEhjgEPU R{ }-Eh5p#jV3U2z.EU98thj腾E0x1e[^_ÐUnable to obtain block size for file %sActual crc does not match expected crc %sUWVSEHLEEE1EPU Rz uEt.E)MqEPhP5p#j UUMAș]u9 u9wEUEPUREPEPMQ58E P%6ƒ p=tJ|88Iy 8Й)օu(v$8 4)`OQEt,ML uHtPEPU R6uvM Au 2=t$ uE9tPhj#1h[^_ÐFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUWVS}EE1GEuEEPT L9u9HwE]SEPx u EtEEPhP5p#jjEEX}tS50EP{ ƃ(EPEPEPEPS50EP3ƃ 9u*EU550E Pc Ã}*GPh5p#jú E;Hu E;LtGPhOEPE Pw }h5p#ja$E98tGPhj蟹}u-Et&L uHtPEPEPy3h[^_ÐU=t611r|550軽}#08ȣ4șÐUser specified archive volume byte limit reached.U WVS}1u…=99hj"}5+1$k0‰49})ƃ550RÃ;uQ]~1V5450 089|l뚐08\H]ؙ08)߉SPR衐 0ډ8Pt ؉֙uEe[^_Unable to allocate memory for user id cache tableU=u$=u5jh= t1hj/ÐUnable to allocate memory for group id cache tableU=u$=u5jh t1hj菵ÐUnable to allocate memory for user name cache tableU=u$=u5jh=U t1h4jÐUnable to allocate memory for group name cache tableU= u$=u5jh= t1hjK%luU WVSu} =u />3)Ѝ)¡t~9s$uuukC=uj uj(6 ÃVD u-t s$Vhaj S ؅u0`)us$j0sVYb C#e[^_ÐU WVSu} =u ;%l)ʍ)ȉ)¡t~9s$uuumC=ujA\uj(& ÃV`[u-t s$Vhaj S{ ؅u0`)us$j0sVIa C#e[^_ÐU WVS]߰эq ;=u h=VSA¡<t,?~'GPS֍ u?G$=uj u@h=VS՘ǃj( ¡׃ uS1tC@,jSGP5` G#S t@G$U 1e[^_ÐU WVS]߰эq ;= u hVS¡ <t,?~'GPS蚌 u?G$=ujYu@hVS虗ǃj(~ ¡ ׃ uSIXtC@,jSGP^ G#S$Xt@G$U 1e[^_U݂TRAILER!!!UWVEp uH LЅu1^_ÐUMǁǁǁA %%=`tT= tW =t*p=@t-g=t]~[=t<=tAKǁrǁfǁZǁNǁBǁ6 ̀f ǁHLQ|1ÐUWp1$Džp EfEtBxBf|B ~pPB0ЋXÐCpio file name length %d is out of rangeCpio file name in header is corruptedU WVSu ~ v Vh0V]S9u<u Exuh4j1e[^_ÐCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptUVS]L HtHu= vHLRPhIP V;Ht h# 0 t1hje[^070707U} Kvjhu t 1UVS]u jLVlǃxǃ|jjFP3jjF Pr3jjFP\3f jjFPE3$jjFP/3(jjF$P3f"jjF*P3,jj F0P280@jj FAP3HLjjF;P2 ~fPPS|P %f=uH Luǃ ƃ S| Se[^UW1U%ÐFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sU\WVSuhhVŇ} džxdž|>G]v dž,tO tV O |Jjj CAPHLRP\2 t?h jj EP jj CAPj0jjShq0jjCP0jjC P{0hjjCP P[0HjjCP$=0*jjCP(0 jjC$P"P/jjC*P,/jj C0P8/jjC;PW/jLUR|WFP}h M t t u1]uP P}4hT jFh j'e[^_070701U} mvjhu> t 1070702U} mvjhu t 1UxÐU WVSu} =tjnWjnWMBdžxdž|jjGPb-jjGPL-f jjGP5-$jjGP-(jjG.P -80@jjG6P-HLjjG&P,f"jjG>P,ÃjjGFP, ÉjjGNP,ÃjjGVPu, É,jjGfPZ,jjG^PD,ÃCSVCn)ƒ1RP& %f=uH LuGdž Ɔ HL1)Ӊȉڃx|QV|8HL1)ӉȉڃRPs} Ve[^_ÐU|1UÐFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sU|WVS}jjWˀ} @Euv LJ,=t.jjURhqD*qjjEP(jjMQhq*CjjEPj)) t  HL1)Ӊȉڃx|jjF6PHLRP* thhLJxLJ|jjF6P LJxLJ|jjF6Pj ):jjFP(jjFP P(jjFP$(jjFP((jjF.P8u(jjF&P"PU(jjF>PP5(bjjFFPP(BjjFNP-P'"jjFVP,P'jjF^PUR'jnMQ|@]SGP|)؃n)ƒ1RP}hp t t u1~ut Pn|$ )ƒЙRP>}4hTjhjx[^_ÐUSE} vGffffHȴ fqu1+ fqu=@u@א[U WVS}u jV3LJxLJ|=@ FV ЉFV ЉfFfV f F V Љ$F V Љ(fF fV f"FV Љ,VF ‰8FN ‰8FV Љ1ۉHLFV 1 ӉHL^FFV ЉFV ЉfFfV f FV Љ$F V Љ(fF fV f"FV Љ,VF ‰8FN ‰8FV Љ1ۉHLFV 1 ӉHL^F Ë80@CSWC1RP7 %f=uH LuHLJ Ƈ HL1)Ӊȉڃx|RW|8HL1)ӉȉڃRP} We[^_ÐU&1ÐFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sU9s?u C9s;t9u*jRPURJ^ } E Ph-/yUVWEP] 9tU Rh-5p#j5+} e[^_Failed seek on file %sUVS]u }tRjjjS] }Vh.5p#jR*jhSx\ }Vh-5p#j&e[^ÐUVS]u |4P\ =tj08e[^File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sU|(WVSDžDžDž} }Eǀ1<UX(v()ș19}B9|WVE P/[ ‹U;Hu;LtUhs/WPE P@ }Uh/5p#jKpU98th/j膃GjjjE PM[ |U1#Uh/5p#jكx[^_Unable to allocate memory for file name bufferUH=tH H=t H=t H@=u1h Q Puhx1jyw|=t }c|1Invalid file name arguementUnable to allocate memory for filenameUWS]t;u hS2jfP ƒuhx2jY߰эA~ </uBE BB =t P 1e[_ÐUt@=t X=t&EutjP5:ÐWARNING! These file names were not selected:%s UVS1=t btG{8{u2uh3ju3h3h|* [ ue[^ÐCan't fchdir to starting directoryCan't chdir to %sUtP5uFh)h 5Pbj 5PC. t@ u dxt[5Z} hx4&0aZN0h45p#j0Pj5HhPD11File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sUWVS=XtX5&4u}ݸ5@4H $67P77p7767777777=wEPEPB %s U\WVSu=u#EPh9V V53 }]SU Pu U89;E  9ÃG Pb PSj@]Sq uEjwyPjjw aPjG PEPh:V U0wW%PRh:G0W4RPh":V EPSh(:V EBwE Ph.:Vx EuE Ph6:VX %FPVЅ|  Vj ] V1 e[^_%s%s %s U\WVS}u+8j1 99 9ƃ8P۰ PVj@uV uE]S PGPVSh;we[^_ÐUVSUM ]AB9su)9s B9r[^UVSM1ۉu A9s < t<0t}u[9seB< w\,B<w\B<w+\A9r\A9s  5#hTj[h|*hTï 1 3hAh|*, HFvh|*hA膯 5)4K hTWEP4ǡ$YYYZZY?j7}9 ?u?uhBjZ P} ?t jPmh)auރ=hthTjBZ  e[^_Ð%s: Invalid combination of options: -%cUVS]15hZ΃PhZh|*2 uHu *x|* |*h|*j ! e[^ÐUUE 025 ÐUܬtBܬÐThese format options are not supported %s = %s U=ܬt6h[jXp0h[h|*4 \u1Invalid option nameUnable to allocate space for option listInvalid options formatU WVS}tE8u h[!EPx EuNh \jWhI\ h \jWEP& u>tj,V] ǃtj=VF Ãtj & ƒt2CZB1tw=ܬuܬPt>u1e[^_ÐUWVS]jEPSݡ u M9 kt%btimt'wt2]É CÉ 3É#ÉֹE‰UEU9`u9wZE}xt KtK*uBÉփGPEUEEE‰UEEEU9u9v11ҍe[^_UVS]EPS\ ƃuC fƒhLE| t@Eu;$ ÃtEHPVSC/ EDh1e[^ÐU1Ðusage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory Uh|*h@_蘥 h|*h_膥 h|*h_t h|*h_b h|*h_P h|*h`> h|*h@`, h|*h`` h|*h` h|*h_ h|*h` h|*h`Ҥ h|*h a h|*h`a认 h|*ha蜤 h|*h_芤 h|*hax h|*haf h|*hbT h|*h@bB h|*hb0 h|*ha h|*hb j* usage: tar -{txru}[cevfbmopqswzBHLPXZ014578] [tapefile] [blocksize] [replstr] [-C directory] [-T file] file1 file2... Uh|*hd\ h|*hdJ j) usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Uh|*h`e| h|*hej h|*hfX h|*h`fF h|*hf4 j' Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sU WVS}tE8uhlgYUPCS ǃuEPhg+jz ƃu hgjS^S)t=hSRPP"EPShgjKV UGPW u(P)/VT URhgj>@F8tjPtGtgtpt NBN:P.V URh,hjJ0@8uF=t p551[^_Empty pattern stringUnable to allocate memory for pattern stringUW}t?u hjj ƒuhLjjIQ:BIJ BBE B=t P1}ÐWARNING! These patterns were not matched:%s UVS1t?Cu2uh,kjI3hVkh|*w [ue[^Pattern select out of memoryPattern list inconsistantU WVSutمt =u K1Cu=CuFP襐 u(hkj)HCt/CCt /CװэAC A</uC CBӺt99tȐS[t&9utCS džhkjqGe[^_UVSudžu=t|=mCPFP3%[t)CtߍVC </uPR3;" uԅu=%<=u1&V|dže[^U WVSu] }F?t4t*t6[tWyt=tt ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s U WVS5hlq@URhq@hq@hr@h P@ru h,r%эA= vhlr3@[uhr@<.uuhr?1_Rhr?PU2ӃSƃh PS+U|1[^_U WVS]} uVWSCPZ|+wVW P P0|1e[^_File name %s/%s, too longU WVS} E] ހ>/uCI+u ~SEPhtjT?57}9r JI9sW;Ur JI;UsE1e[^_Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s UWVSDžPTURXS$ ލ\\T`HTLjHPj VLR} DžP`FC9s9r9twWST0HRLPV }#}URhuj=Ë`h)‰9t>tT@;Pu*TRT PFC9su9u'>t"}tn\PURhuj<U}tCT@t7\uURhu\PURhvh|*& \u .h \PUR|‹E Eƀ 1([^_ÐU WVSEu}@EE9&uE B\u33)؍)á t 91tAIuj uh(~jc51A 1e[^ÐUE$/>3)Ѝ)¡tʐ9u1 @uÐUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUVS];= u+jh=D uh<#t.<\u{#uCSu Shrpj jCPHƃ/>3)؍)á  t 91tAIuj uhHjC31 A 1e[^ÐUE(/>3)Ѝ)¡ tʐ9u1 @uEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]U WVS}E1ۅt?uhҁj/WƃtF?tGPЀ v6<,u}uAE1<.u u Wh{A9uj4 ÃuhHRt>u CXC>tJujܸ C?t#SW}Wh8K}trE8tjCPEP^}#EPhłj/S ^C Ct$C9~WEPhj/S BUװuRDBЉ=~߰эAw$ĆrQ0 SDBЉFDdFSDBЉF jHFSDBЉF ESDBЉF$SDBЉF;V;q U t1e[^_Cannot allocate memory for hard link tableU=`ujh `t1hj,Hard link table out of memoryqvUWVS} `i<f".E%@ )؍)؋])Ë4U MFEv9Vuꋇ9Fu߅twh 6 S譳 uLJ LJF PV ЃwFU6l Vc xj ƃtQGPs t0FF"F `F41!V h"j*e[^_qvU WVS}5`f"v~tstn ti%ԉ )Ѝ)Љ)‹t= S[t,9Ku9CutC3? S6 e[^_ÐU WVS=`tG1ɋ`yt+v3 S u ~e[^_ÐCannot allocate memory for file time table/tmp/paxXXXXXXXXXXCannot allocate memory for temporary file nameUnable to create temporary file: %sUS=dt1jhG) duhj(xh#q Ãuh0j(5dCS7< x|Sr; S 1"Shp5p#j(S` ]Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryU WVS=du1E8hGWÃSd49>uujFV RP5x ;Fu;V thZ5p#j'CWS5x 9WRS. tvut$M8;F~ F1j. ƃjjj5x\ FV |_WP5x5 9u*U8F>dF41gh5p#j&8h5p#j& hrhЌj%t V [^_ÐCannot allocate memory for interactive rename tableU=hujh| ht1hjA%ÐNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryU WVS}=huhpj$1hu W ơht^[tU3Wn usEPX ts. EPzl C uhsj ÃtVWHl t8EP3l CthC)3 S hЏj#e[^_ÐU WVSu} =htWh7V ¡ht63VU uEHPsV0[u͍e[^_ÐCannot allocate memory for device mapping tableU=lujh=y lt1hj"ÐUEjOt1ÐDevice map table out of memoryUVSu lt~/>3)؍)Ë It 91utJ} tAj D t1AlA hpj!1e[^ÐUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedUWVS}MEE1=l#E 9tEE!M9Et E!ƃjR}Ãt4KI91utAE8}u }&j Ã}u3t/j ACAK|P|Ѕj5|u%|#U 9uojRu[|P|Ѕ=|~;j t(1|QCAKE%GPh0j-hpj1e[^_Cannot allocate space for directory access time tableU=pujh=u pt1hjÐUVS=pt61Ґprtjss 3[u<~͍e[^ÐDirectory access time reset table ran out of memoryU WVS} p/>3))Ƌt&9{u E 9Ct[t9{uU 9Suukj ÃtIue t)E C{EC ECpCSO hpj1e[^_ÐU WVS}u ptk/>3)Ѝ)‹tI S[t:9su9{ut,CS ESE3 S 1e[^_ÐCannot allocate memory for temporary filenameUnable to create temporary file for directory times: %sUVS5tuoh`d ÃuhjHS{/ t}ShPjS S. S 1e[^ÐUnable to store mode and times for directory: %sUnable to store mode and times for created directory: %sU0VSu]tjjjP EU}Vh0jrU BUCfEC ECEEERV5tS ;Eu'jEP5t7 u pVhpj@e[^ÐUnable to set mode and times for created directoriesU, WVS=tD1jP5t jRP5tv S5t ;jRP5t$ |t=u tPSΑ=įu =ȯtjW豏F;5psjjj5t 5t_ t;5pthpj[^_UWVSEU E@~ L@U19}'YUp9s AB9rEE9|ڃ}t$EEU9s AB9rMME1u[^_UjhVÐU1UUM1:u@=<t=t} uPЃ~1ÐUVSMu ]EPt%~/tu%@P$@ @P@ P J J9r$ 0Ju9r 0J9su1[^ÐUWVSM] }uEPt%~/tu%@P$@ @P@ P J J9r$$ 0J u9r 0J9s u1[^_ÐUVSu򍊔9s B9rM 9s B9r[^ustarUVSu} ~P>tKjhP9 t.jjPÃhV[9u1e[^write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.U WVS޿ 1t RuUֿt"RSh jhhhLvEPShjjx…g1e[^_ÐU WVSu} hW} k^fdž"džh WSݛjjGdPf jjGlP$jjGtPϛ(jj G|P赜HLjj P蚛80@Edžxdž|dždž <1tU<2t<5džh P SӚ !džfdž"h P S莚 !dž!@fdž"Ɔ dž Ɔ dž E8/udž!@fdž"edž!HL1)ډӁx|HLU:/u1e[^_ÐTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sUWVSuH $|Ȥ$ܤ$=xtw h hLhh dv PhȣuCcvFPhpjcFPR7Acdžxdž|u3E}1Ƅ/jj xPj\IuE2 w@E1jc PEP論Ejj xPj E}1jj xPHLRPV thNHL%1)Ӊȉ%x|jjdP PbjjlP$>jjtP(jj P8uyjjPhSPuEhS[K|jh9L} 0 tu1h,j [^_ÐUW| (X}1U)V| V}1UVSu} ~P>tKjhP u.jjPwÃhV9u1e[^U WVSu} 1ۃhWq} Ffdž"dž‰UYt&h YPP術ËU/BC )PWR耓؉UjjGdP蝓f jj G|PHLjj Pd80@ƇH(P)PZ}jjGtP(Ƈ($P PX}jjGlP$Ɔ dž džxdž|dždždž,7$\TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT<Tdž!ddž!@fdž"HU</8-4udž!`dž! jjIP ÃjjQP É,2udž!dž!fdž"h P S[ edžHL1)ډӁx|HL!1e[^_ÐUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %sU WVSUuh̬t t u!M cv Ph ]3߃WÃuWh, Eǀxǀ|9t#hWeP'/Ce1&fjcSVFc]H $Į44įƆ51󫉆IMQUjj F|PjP]u Ɔ3 Ɔ41jjIP]-PKjjQP,P{(jj F|PjaƆ61󫉆IMQUjj F|Pj{]u Ɔ2 Ɔ1jcE PP_ƆdžIdžMdžQdžUjj F|Pj JE u Ɔ7 Ɔ01󫉆IMQUUHL%1)Ӊȉ%]x|jj F|PRPf thLjhP2jhjP jjFdPU P}*jjFlPM$\ jjFtP](;jj P8j j$FNP Pnj j()OP)PI jjPh PPuKh R/@|jj A}6M tu1]hj[^_UME c<=,ȍP@BtUVSu ]}t =t3=t*5Я* h|*j k 5hh|*jV Suh|*W ~V Ph7h|*9V h|*j e[^Uuu uiUEÐUVSut%t؋P_ ;ue[^allocate bad sizecannot allocateUWVSE} 111ۅuheWypFE5M1ۋQA 9t9rӋ9u ;Mu1ɁEuv]CP! څuhwWLy=u I HADA A A‹EBJA A 1ۃVSRQW$e[^_allocated object too smallU WVS}u U]K)yhWx7STJr}uVE؍e[^_Ðallocation resizing free pointercannot re-allocateU,WVS]]EtCE} uheURwE H@E}=s>NMF 9Fth]Sw]C PV) ƒ؅u69uEUW:M91u9h9]SVw9t&9uR WM]93uJ MQ]MYD B BE+E9E~a}XSUE+ExERMq 9t5MDM9w$D9u9zsWU9t MD9v߅tgE9E_=X+UCMKLQAEPQoWMQREPURr‹CBCLMQ] S4Ã}t/UB;E vE PMQS EPURn؍e[^_freeing null pointerfreeing memory outside of block (corrupted?)freeing free objectUWVS]uhE PWus{vU RVF E9r;^ rhU RuEN9s M 9r9uhE PtA9uy{ }u^0UJʍC9uKEHUE96t"V;UuB;F u U RV e[^_ÐUSM] 9u ABQ9 uQ^ ]LPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s ULWVSEE/Lt ?)PtE EhXhlUR苈ulE=th[hwSE؃h{CEԃ Mu4h'P%EЃ =,hg}uOEЉƿQEPEЃ=,uhEUz, :uhżPR.= Ãu h+5, M9IMMQIM̋EװщMȃt PU̍2PlEЃV5, Q ]}WEpS 5, U<2MQWS E hEt EPhEEEhSPQE }}č}u}tXEPWVUR5, &E }t]]Su]S |}:}tMQh #5p#^ PShjF, 8tjP}WE8/u?}tPÃu]t S#jSEP h,]}u}tSh'_1e[^_Ðcan't get current directory - %sUVSu%Lt ?Pt 1hXhlVpul<0t hg, 8tt P轎1ۅtjS#| }1ۅu6jj&Ãu!5p# Ph8 Sh'.1e[^Rnprsu,ne-p: %s-u: %s: %sU,WVSEEU8eE}7>-x~nFt)-~uS6$8(4@hpxMe[MeEPjE}huh^LeRMJ5t>u E4EPjVE}uVheShlURFF|u-l}4t*uBlEt llEEt EPh}tjj5p Wth PtR6^P6W轰à u E#t$h s #>u}tHW]S"t$h s #VӱÃu΋Ee[^_no argumentsUVS]{uh1}tjEPRu׾e[^lpnzU WVS]11uKnt+ ?t4lt5ptzt(! jhhlSiulÃ;uVWjRt,E#VW38tE;uދEe[^_bgjob control not enabled%%U WVS]3=uh#mh,hlSh?u KlÃ;tV3Q;uVh61҅u =u‰Ѝe[^_%*d %*s %s%*d %*d %sU WVSu]}M ALtPRvQ6hWSڄPHvQ6hWS躄؍e[^_bad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %sU,WVSEEEx?-WU up,Dj_S覲Eu S|Ur<utmlt ?G6st-E#j5t,h?hlMQful}t}uU…u(}u,hXh Hh,}tzEPM4:\~Uw€UEPwLt Ph' QhCE<u=tG,l,tPWho -9~܃h/S E]gfffE)ƃ EC1L]:tэAEM;A~CPэA;E~E ,~CEUDPShjhg15th,U1E}tM Mǐ?%u#EPWEPWYuWhVM}URQ!|6EPQ3 }"5p# _ PWh CU<Ge[^_ÐUS]~-=uPh b  ]missing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGUWVS]h,hlS5b?u lËEuh,3uhE>tjV8tVh[t @@Luhtjv;uX @1 ;t@<u9! t/|эA9vhs URh Saǃ|+?t tE+EE|UE?E?t  hË€tjjhjh9 u jS jPSV_ƒjEPR ؀=tjjjjV|؍e[^_lmU WVS]1}17lt ?t &mt E |hhlS_ulÃ;uVjjjf`ǃ;t9j=3| t@jURP37`t;ulje[^_Ð4,p\ p\X}xbind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasUE8f%%s: bad numbernothing to shiftUVS]t ph,hlS]?tgltjEPS臺M} Sh (9N|FF)N1he[^Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad maskU,WVS]1?>SuhhlS\uҡlj4ЉUR% tfU]1ҿC=C1ɍrR)‹Es9CJA~,C~CURhEPhE t7EUTЉUC<v;@h"jRЉURCEЉEE1 ;7Ch u|PJt@Ph huTPtUPh gh %^Eȍe[^_:ptime: -%s unknown optiontime: -%s requires an argumentU,WVS}E 0j]SJEA?t :t$2pu+G#uhLuh<hSVJuEt>19}t P4dC;]|1ۋUt CBu>uGE 0e[^_UWVSM55=uK.K)0 F~݅uى[^_ÐUSt x t\1ۡt @ f-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tUtDFE;t9E:Cu(SVJ uSuBv ;u1e[^_internal error: unknown opUWVSu]}}u 1E H#[$@ThDp@ 0 H\xxxxxx;%;%;!tCSM2<}Dž<$#u911ҹ9}"t<1#t12B<1 %A9|ދE1W19} <1 uGA9|;E |/K|<1 uJ2#J12Iy#E8[^_ÐUWVSE}kE PUR ƃN}ujM 1t ƃ1G;}}jU PO 9~;}t O~} |2/t N~|2/uEPP]EEDE1;}}YE;Er8U)t PPRܝE؉E؉EEU EG;}|E;Er9U)t PPR腝E؉E؉EEEj j E }tEP}tt Pu͟e[^_fileglob: substitute errorU|WVSE}1Pu ,111ۃ?t%:<\u u  ;Ct1B<:u; t Pj.8x j =t h7j1/ t PhhEE耉E h EP5 =E;Er:U)t PPRڛE؉E؉EEEt PUE)$PR蚛1;t F<uu=W3s uEP3 |8uSV1t PWt E Ux[^_ÐUVS]u FPCPfs u F[)É؍e[^FPATHU Bu7>*<;\uC9} | uC9};Bu ;<'t<"uЉ])u}t~N|9p,DtIx 9DuE|9Ph A tE}t"9}<>/t A9}<9/u9ЉUEUE0Ee[^_ÐUWVS] }EPWuuSƃ EuEEu t1RTtEPVSMQ҉…uE 1 }$tEM$EM E70Ѝe[^_*+?@!U WVS} E} 1t PGPu7>tW;\u {tC><*t<<[t8~u}t 7*D>e[^_ÐUWVS}1TE װI;E}41ҋu G9v'/u H9v8/t9v8/tH9v8/u8/u H9s)_ÐUWVSu u]ShvjURxW&t];Fr8V)t PPRXF؉؉Ft PW ‹EP"hse[^_ÐU"'\UWVS}] jh:'6P訑EE1 .jhM'U҃j>PUF) F9tI>Ph>'; u>PEPw; tʃVWU҃tEt}u SWU҉EEe[^_D-:-L-XM~-(Mu-2`-4K- 37-5#->-t?-:-x:,@M,8<,D,;, 1,0,|B,hK,M,pM,@B,TB,hBy,Cp,8b,\?P,4B,D?6,8),4,@:,:,<+L+:+S+@9+9+|<+TK+8E}+Dq+8Aa+LY+KA+pC<+M.+M"+T+T+T*XR*R*commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#- 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDUWVSEdtU ‰hplxpt  <EP5  M)щ x| ) jR |@ H)ы + 9|)R v!ƅ}1ptEEE @$(ÉDu=6tp p[P;Ѓt5 tVt7JD;=E/dp)‰#jbjtjJe[^_USEuj =EfEfE =t ]S =u1]ÐUM=ttjT 5% ȋtt8u t1ÐUS] p;hs9l)BRPP` Su5l` lp1j]U WVSUl5װэAPRe} s#x9lƒ|S;5u(x;lvKP;lw|1e[^_Uu uu1Ul+duj.9~+Rj5P1Ulp)‰Ѕuja 9~j51ÐU WVS}D t"l9v9v  ) } t W8)=p5lE_tPFEslp)@PPR^ |5l)à ~C;E~EÉ]rj Bs]Ktj&s|!;5lvNP;5lwe[^_UjXP1ÐUA1ÐUlP1ÐUjP>1ÐUWVSEld9ujG1 =EE;]tjCp,Du2K_t*$t%}KE9t?CDu K_t$u;]t"KE;]tCDuC<_t<$tEHwSEe[^_ÐUWVSElp9uj_1 =EE;]thp,Du1 _t*$t%}֐CE9t=Du _t$u;]t"CE;]tDu<_t<$tEHyEe[^_ÐUS]t9r 9rlXl9s$Pl@P:l9r&9v"lPl;lwދ]ÐUSuVÃrjs]ÐUVS]1;tPCƃ;ue[^UE u Сp,D u ÐUVS]5PC';t;xs;5tۍe[^ US] uhL8?ӡp,D t%j^?t @P S]ÐUl+duj9~+R1Ulp)uju9~R1UVSlpM|<;ptVCP) 1Åu$V5d) Ãu j =uS 1e[^ÐUVSlM6ڋ dJ9up|9uj$9uՉ =uS1e[^ÐUj @j 6 "p pÐUÐU5 1U5 1U)‰Pw1ÐUPS1ÐU=t5 /&  R)P1ÐUWS};= r;= vj=5dÃ75ddt?эD lp 8p9vR Se[_U  )R)‰@u UUd9pu=t R R I-search: U WVSƅ<)<u$9vK9u Vjj<utE9rjn C|>W5d[ƃ|&d)Ѐ^uHP$VjWxƃQE}ho<W |$ҡ} j1[^_ÐU WVSu=} ugbV7Ã|L}} j WDdуD >^uHP$;= sjC e[^_UWS]E 8^u-PװэAPRSZQ 1҅tPS"t)ډЍe[_UVSpdp)ÃPơdlSdptxlVP1e[^ÐU5p1U5dt1Uj1UVS]|u j j d9tu.jx Pj5  )‰5td9tu x9pv x9pv1 +t)1j C9}9|޾ x9pvd>9tv*d9tv<Vtjsx;lvKPS;lw|e[^ÐUl d9uj8;pt =tg)ȃtԃBPl@Pl@Pl@PlHPPlHgBPlP^l@PLlHPllP?l@P1Up1ÐUp1ÐUp1ÐUSdl)‹ p)ȃ=u9~)ydPۃjS~1]ÐUVSh`u5ljáh0th`PwhHgfff)) he[^ nothing to yankUhu ll lltlR$h\COj1 yank something firstU WVS<0t<thCjf{l<0эYl)PjS ʐlul Hll<tԃ4A1e[^_ÐUdtlpxUj 1UuSdtplxjW1ÐU1ÐU WVS]t PSǀ;t8^u%C>~@?tр ^@K@C;ue[^_ÐUMѡp,D tX^Z?t @Y XYX%s%s = %s '%s' UVS]u u5PhED u5bPhE# VKPhE  <t @4((hE 4hFe[^cannot bind, not a tty%s: no such functionUWVSEE=uhF}tB((Í@0t,(uRhE%À:v!udE1}E@E쐉t t}tuVUR[F~NjMM~PkEA1U<u E<u EӐ} uVEPOU :u}ubÀ:w%Í@((tM QPSH uԀ;tÍ@,(t=E PhF{U Rh`PdE  MU U<u!E<th`4qEEM u* >ȅ}A) ( >ȅ}A)1e[^_ÐU WVSh`rlh`hl1Ƀ A~1ɉډA~Ny1-1ې--FGvڃh`h S1e[^_ÐUVS=u31tPƃC;ps;5|މxxe[^substituteU WVS]= t Pj[Ɖ^5 j講 =thlVjOn= t PVdu 5 e[^_ÐUWVS]} ;ut PhR_‰UU􍂀E9r"t PjR`EEEEE;tuWV3;uE;Er9U)t PPR`E؉E؉EEEt PUE)$PRB`e[^_ÐU VSu] t PjO^EEE SEPV UE),t2t PR~be[^ÐU VSu] t Pj]EEE SEPVUE)t t ,2SV#ƃt Puae[^expand(NULL)%S%s: bad substitutionparameter null or not set%s: %sUWVS]EEDžxuhYjkEtSZlt eM =te=tM=tUt@UEt EPhw\EMMƃE]EDžtE(ЉpEDžlMMeEEȐ|EH)…~RVEPƃ}U$ZZ`,a:aa`M ME $Z[ [4[x[,\L[l[(]^```EEEEgMUUEOEDžpEEDžpMtVE$F(FE8EH)…~RVEPƃUBUF:uMQEP<Eu EtEjURE @EDžxSEDžpMtW$F(F(FE8t4EH)…~RVEP.ƃUBUF:u)F)FEE EjjMQP]SfFjEP| @ES3\Ã;EH)…~RVEPƃCF;uTE}jW @EEPEPURWEP E0}8jMQfLƊGPh$Yj@j1GPh'YfEtEDžp}|zu)t PjX@|HA|@|E|f+MfJEfBEBMfJ EtUU%t #t[=t'?tFLeMEFF E@uM(MeDžpeMDžpMjMQKEEDžp|@ E|RUӃtM|f%t& f#tEf=trf?/F)F|puPV|rYPEEMtE|@|rujVt PQVPeP|rZ|q"YEE tE|@X|Z]9tSSPWWM Qp EtE%PU RWW Mu}|RU ;BruE j[E PEtS@<*t<@uHUz]u?1ۃM Q fPLƃ  tEtctCvuQ*t@ut @X9E PPLPNPE =,ЉU}эY=tu}uU RhgZMt Pj SPUE11ۊE<u^:uE1ۀ~u^Ӹ P t  ]6@u}t/9]<1uD9uM}u}uˋUEEU *t@uk}%t #t=tt @xu!M,@3)@HUJ@B@j[E PE@<*t<@Uz]}% # =t PhKEE耉EM QcPJƃ tetVE;Er7U)t PPRME؉E؉EVM‹EEvuEU)u7E,My@ut PRUO;Er3t PPR}LEЉEЉEEEEUBBMy@fJ Q}=uU E jbM QHUBPLM } @u6}}U8u!M9,u=t-t ?t+u1=t0E8,u%} @u t+tU RhgVe[^_%Rfunny $() command: %s%s: cannot open $() inputUWVS] t Pj譟X PƉ  u 1 f>F8u~F8uvF toBtRhlj j7PhlUj0jjjrASǃuShmUEf@ n]SXZjjuǃjj[YEjjs Ys j2V EPjYiEf@ Exe[^_U WVSu]jVǃ%% #t=tM=9EjE PVurEC9v9EjE PVu6EK9sq9rijE PSuK9sJE@t P)SV&9wjE PS5uC9ve[^_ÐU WVS}u F)uVWuW;Fr8V)t PPR(HF؉؉FWW‹!hE F))RPe[^_ÐUWVS] }C3)Et EPhEEU‰UE%PSEPEPEP&uu JC)É)e[^_.UWVSE 0"}]uE1EPUrUu tfMQ9v\~/uVE%f=@tHf=@PRt }uH%f=@`e}unEP9vd~/t^E%f=@tIf=uJu*@PRbt } ~H%f=@u/FU;Br:R)t PPREMA؉؉At PUB)VPͿ‹MxE;pv/FU:/u1MH)…~RVQǿƃUBUF:/tσj/MQU<tÊ;< ƅ;}ыU\ SMQ^uk+]DU+~PVR0ƃMQVэtU 2MQEPtD>uF}Ph3uu$< tC(CF>u9}t WEP蒆Ee[^_ÐUWVS}]E0Et EPjs@EU‰U*EH)…~RQEPbGA?uGEE ܨE t j軧Et'E u=t j薧j Ee[^__builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundU,WVS]EE=uH=t?؃;t88ujpjhjhhq9 P\3E 1j W E E Wh;E x (u{E EE x 1jhl追hhlSptEt=SE=lE;EP3E E t4E xu+EE x ;E }t;t;E t E @u+l(E@}t E tE xuE @uE=tM1UB8j MA4ǃ=u7 jhz+P/PPhzh  UB/|t-RWh"zh MA|uh jjjEPW6 FUB<1;u MaE uL=t0j/WAtWhj9EEPWE E @t: tSE P E E xu?E xtE pPWhWh$j(9EqjjjE p}45p#躶PE pWhdj8E0+jWPW@tu E pWhj8EE p UE @t p t @X1Fut BNpE @t'BH z( jVEE $E %EE Ht fjP#ƃu$E%PE p Ep EM E E ‰E %=u.E tE E pE p E FwH$، EWVVhÆj7'E ulE xt+E puPWh̆j6E~ Whj6Ehji6E=u2jE p jhjhh2 P,Et6?Et =t!jh jh  fUE @ jEPhDEEtM j芞Ee[^_EXECSHELL/bin/sh%s: %s: %sUVSuh`&P^*à t#;tjj5p SÃt;uVFFFu FP0蛨5p#該PSvhn4shcomexec: %sUVSu6P6h ^à u6h.j5VSe[^U WVS} 1ҡt XÅtKWEPsVƒu1CLuك}tӃWEPVMBB Ѝe[^_ÐU WVSu1jV6PVdËttC$Ɛt$ss } uS3sE pCC ƒU fzt 1e[^_UVS]1C<=u <*u<+u ؃S[PSh 'ƒ2BE B e[^FPATHUWVS} EPE1Ej/EP t ]F tEPEPh /1t tFtthjEPEPÃtUuHh 1#P/'ƒ ,uCCCPjREPCt tF tuwttue0uWEPEPh| IÃtPt4js 莫t t$h s M(#t{ uA}t)u%EPEPh| ,CCCPjEu p x PEPtth PȞC UtMh !P%ƒ ,t-EPjREP0tCC؍e[^_ÐUWVS}h| ]SS3t,uC 8/t th s &#V(Ãue[^_ÐUlWVS}u1ۃEPWR }^E PW裩} p#6} u-MʁfuIu f@ut t>ue[^_ÐU,WVS}t Ej/UR^tGMQEPUR+QEKuMU)PR #+}щMEt EPh!EEEu ]j:VEuэLM쐐9ut7})+E~PSEP辜ÃWVSY /CuU+E~PSEP膜ÃMQEPS URMQu F.1uu$1e[^_UVSu] hh hjj跾 jhlSF ЉÃh h h؍e[^%R%s%s opencreatedupcannot %s %s: %scould not finish (dup) redirection %s: %sUWVSEEXPUDž|DžxDžtt"=t PSÃ}uu}t]EM=tHVhj j PjhzP P9Ph- EHC$d|0DžtDžt Džt=E@@EPSM |E%f=DžtDžtDž|UBPrEqDž|;-u{uEDžxHEPMy}PS/E}uVhj j# Ph@z&|tJ=t&ttShj7*htRSL E}}K}u΃5p#軧PS}t}t}u Phj)뉡t M@ ft C<uuhP 8uVhPPhz'(hԝj hPt17h{Py 8tP,~9TЍe[^%*d) %sUSMU ]4BRqhΞuS؋]ÐUWVS11UEE:t":IM9}C:u߉] ~gfffAEE)‰U EEuMDPEPh؞Sh ǩ؍e[^_ÐUWVS}u 1ɋGu%^:u :t:%w@tcMG:u]9sBA:u9rEPVW a(1Ƀt t4 G0qȅtGȍe[^_ÐUMAu19A}u,$E w j jRY‰ÐUuuuu u`dbteste_error: %s (offset %d)UEu uhj#++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():U4S] EEuuEP‹EЋ]U$SE UUEEEEjNjt Pà tBEt`肊 u!Eu 1h,SCEPtUz(uB'l UBj EPLPUR ƒ Ex(tjjPE@tRP= EPRPURc賉]end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %sUS]U E$TlإC't w &tG(t)t"8C:s}*g#CEfEfEE @(P3hy8P3h.P3h"P3hҤP3h P3h-jj ߆missing )zero divisormissing :UWVS1}} \E@E߃v }t}ugURjEPPURƃ0}!uV }"u~ ƒV }^ }#uFEPNj URDƃ Ex$th!jPURH}w*EPjUrEPR<ƃUREڃwEpPjjURUBjVPRƃEPr] KSUR{ƋE@E]DE@E 90.UR8u}tVEPoƃUU w4EPUREPj URPEP0ǃ02}t+}t%}tUREPPURǃ Ev }t}u, u&Ex t G h+jURYE$,@p̩Tdp̩ܩԪpTdp(F G E?F  E/F  G V ЉEG V )O F EO V G 9F G 9F G 9F G 9F G 9F ~G 9F jF #G E\V 3W LF G E@~ uUB EPURPEPE ~ t EH ~ tUB EPURTPEPE ~ u tE~ ~ ؅uE@ j URƃuEH Uz%th8jREPtUB j EPǃtUJ G EW U} w4EG UBt WREPUR }tEF URUЃwRU 90e[^_missing ]UWVSExËp,DtGDuUzu B(ú BѨtGBu[u(Wy!uh4jEP[NjUz tdUBH@t PEP)PRWÃSUBt PS E@&5_t u#uG_tAu#tt PO)PR݄UB`B@BX BPP uSjEPat PS UB'UEP}hE5(tXE(E,E9uEEPURWtE E E EE(u…u UB)Exe[^_ÐU WVS]u }WVSSWSà us C s K Gt SW s W }us ؍e[^_ÐUMU Exu@uR(PjQ@tR(PjQÐUt Pj @t P@ @ÐU WVS}] {u%=u]ƃSV uBCtCPjWO_KjS PV-cGe[^_e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sUWVSEEEDž|DžxDžtDžpDžlPЃC$ȱXXXXXXXXXXز8@HPt޿8u xt P߰эAPSLEh:R腍 nEiEa|VtN5tPh>̯Ãpu p$lthDBlhhlEP\lEx 1`}u}u|u tth\AUtO8tJj=@P&Ãt5t PE0}lj؋U+8C`UpuEptEluU:thD2ptjjpP jƅUR`PWV}t"}u |th2puUptEluEltEU:thDgpuS}tjjh jhh!jd}%P1}u ltPpPahlt#}%PjlR)}tj hddhd9hv%hhdtЉt}Dž\|t Dž\htd )@)P\Phn>WC)PhhN߃j W ÃuуWhh"tt;hr ;dah01?t P@RjPExu$5p#PUrhi htt0d(6hWttt;hr;dvɃWu 5p#jPhܰ s=u&jEpjhP EuPBq jjjUrǃuEph\ EPw 赸 |UBU@$EPBPLEU‰U+ӋU)؅ +E)Ѕ~PSEP0yÃWE)PS胣ƒ|(W话E)SPu:*w$PEph<| WkH[^_ÐU WVS}tmj VAÃt C;u19t jVjWBHJPVh ރtC u Wuo e[^_substitution failedU,WVSu} ut P6[w\} IM}IMEEt EPhaEU‰UÃ6u_E+uM1+E~PSEP;wÃVEPS URMQS ] }}E PUR#@ǃt}t}z}uh{^}֍+E~PSEPvÃVEPS2 ރuE)VP Pe[^_%s: not in history%s: invalid rangeU WVS]u }EPSt^U|+P ; stu9vt^Wkud9u`ShYD;?uC1PSj  )‰HPJ‰U}ShF1 Ѝe[^_no history (yet)U  9r }u9uhN1ÐU 9 whN1U ; r8B9$t'HBh 1 @$ÐUÐUÐUSU  )|9|[ÐUWVSu  )EE} tE}эy|9|ލ9rb;]w]}tWEP3t&EP3<t+ E; r; ve[^_ÐU WVS}~^;= tV  )49}V)PR2 h V5  =  e[^_ÐU=tNt7uPt2th P5ÐU= u) h hU  ÐU WVS   9rAh 2 HP BPR   \ h u qq‰։эD 9v x u@ e[^_ÐU WVSu :IMэY~ | uYh MD P2¡ E<} t GSVW ;e[^_HISTFILErUWVS=3Eh{XPV t8uh P:phP1ۉj0jSǃtjS@jSj)X29Љ;|1ۋPhjV|gRh[^_w%s%cU WVSP  ) 9|ڍ4Ρt]hPÃEtE1;5 w/>t*j4hEPH G; w<u؃URe[^_US]  ;t.jE PSh şh j 2h ֔jhUS] uEPSh uh j h 艔]%s: US]  ;tPjhtPhLh E PSh h j X h h u=tthjg]internal error: UVSu] jdh h FEPSh Hh j 赚h \t j{ge[^%s[%d]: US]t& t@t5p Pt!p 8-u@PhLh 袜t8 t.At'QQRPhh o @]ÐU=t!E Puh Mh pshl_stdout not validU= uhbjE PuhÐUhEPu 1҅uE%f=%ÐUhjj蹌h jj訌hjj藌too many files open in shellUu uh}=p# t}uh1ÐUVSu Lj jV Ã}"=p# u 3h1} uV] S؍e[^UVS]u uh 贐} S jSVV e[^can't create pipe - try againUS]Sm}hL j3jsC]ÐUS]3t si ]bad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameU WVSM} ]p,DtoyuijjpV2}tphu5t0tu ttt9u&'9puyu SWt e[^_ÐUTPL\XÐUUL|%9u!R5L LÐUP|!L|9EuR PÐUUT|9uRy Tno coprocessUU EtLT}tÐUL}t =P|}9|P LP|P PT|P T/tmp%s/sh%05u.%03xU WVS5 uэQ+UuA?PǍ__GE G 55 VhEPSǖhhSX |jjP耇Gp#ttt GU:e[^_,argument must be %job or process idambiguousno such jobU WVS]P jh j  j)hXhȳu=tjjja=u =t1\ 0j jHP0Kyހ=t =t je[^_ÐUVS1S; u{C t$uoCu=t`=uW;duOCu jS# jPm{ u"Cu jS# jPEpt j_ 9du+(|"P5hm5(jq =t e[^j_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlU WVS=j1=h|=< % }(5p#qPhj =tCj jhjj舻 5hrl; uӻj jHP<Ky=d9 Pju}^5p#pPh;j 5p#pPhj P5d5htk}-5p#wpPh\j (d =uh|jhhh< P=t-j jHPKy;\0 tj RHPKyՀ=ue[^_Ðexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procUWVSEE t%PUR/]Sh j <FFF E t==u5 h\jU05wEE uu UBE@ UBE@ @$@ @ UBPЋUBr(B05jR]EPhj0FPnU UeWYnÅ}W=p##u tЅ}Ct}t't@thWS C HwK }uut 3C thSujEPj 1e[^_notifyU WVS]Sh jЫ 5߅t6=tF@th jVF HwN 6uˋ5t F th)V*ޅuh wjWjG e[^_ÐUS]Sh j" tHjSj ]asyncj_async: job not startedj_async: bad nzombie (%d)zombieUS]t B%=uh!RGCuh'joC,@ z1ɋt&9tB ttA9B}ыuu2@ tt>Rh@j"hZQ 9v]ÐUUJB(8t 8uB,=tj5 ? Ðj_waitj: tcsetpgrp(%d, %d) failed: %sU WVSu} FƒVt F=uXSh  t FÃ$Fh- ^t辯ÅF tttFƒVT$F==~~ u5hXF`|N 5 5hW}*5p#\P5 5hhj0~ uN F4P5hQh|^~ u.~u(F t"h< R$9f~ %Ph< R ~ uf F,@=t.~ u(ƒtt\} RdF$ F ^u/=t~ t?h jV6h r ~ t=tu uV ؍e[^_ÐU,WVS=p#t) 9BuBuuރEPzFuEP`Ft J(t 9Y t uuuEEEEEEEEpE])ÉB$E])ÉB EEEEEEEEE܉Au At A ARxjVj Ã#=p#e[^_Ðcheck_job: job started (flags 0x%x)checkjobUVS]CuPhj1ɋS(tB9~uK C,Ptt@C@ C CC HwK9`u`5TC0t!;Xu \u5LC @C={ ujS=Ct|t 5tB t fxtHRuVjQl5jS5hoCu{ th)SW=uACu:{ t4;t{}CChS e[^%d RunningDoneDone (%d)[%d] %c %s%5d (core dumped)%s%s |%-20s %s%s%s%s%5d %-20s %s%s %s%sU\WVSE E} u.UBu R,EtB PhEPwUbEz ~E9EuE+ U;uE-EX(.UU1CtB ttgtEECn} tWCuEEaPhj@URswH{}} uuCt uECPEP} t0U;Z(uEPrh URhEPv} us hURv} u5}tpE,tPEPh%UROvCE,ЅtPЃ;t+PCPEPh-UR v {sj} u6,;t+PCPh-s EPh:URu +} u%,;t+PCPhKEPut9{u9st}th/URfue[^_ÐU WVSUE tcR^YtS,t 9B utSt9mu} pE bU:%t} ME ?EU?$          <EPW9Cu1s(t=E@PFPk tt} U ߋ6uċuX}эq1t:VC(PUR$ut} t.E #ߋuȅt} t U 1e[^_ÐUSt h jdEt9PutBꐐQȋ]ÐUt ‹h j@‰Ðremove_job: job not found (%s)US]t9t$‹t9u9tu hjmS(t Ћu C t 9Cu ;u ;u ]ÐUVSM] օt9t‹t9u9utt/ ‹tx t [^ÐU WVSE} 1X(t#C tWP诙 }u݉e[^_no closing quote UWVSPLhTDžDžL`PhTiDžx@t |PjHtx‰pǃMtDžXEt5GDžX`BDž\GqDžXMt DžX  t\t=u\+#\\ t\ t\#uU t\t=u\"\\t \ u \P2" B t$B =tUtMXLXt X u\E 9pH)…~RWpP=ǃX X$ H  l4 ,  \[E`jt dP4 tmG[Gd;t9pH)…~RWpP=ǃGCG;uɃt Pd: p$j‹dB B B8  \*t(\@t\+t\?t \! t\t=u Ã(uL G\G` `T;JuQR!`` S\'to\"\\ t\t=u\ \\j  G` `T;AuPQ4 ``DžX G` `T;AuPQ``DžX \\t/\\\$H\`6 t\t=u\\\$t"\"t\\t \`u  pH)…~RWpP :ǃ\ G\G  t\t=u\\\( t\t=u\\\(u`` `T;JuQR.``DžX@+tPG \Q` `T;PuRP``DžXAAG \{cG{GWpPwǃ t\t=u\ s\\:u?G:G t\t=u\+\\#t \%u[\P` `T;JuQR`` DžX o \R5` `T;AuPQ8``DžX \ PGXGpH)…~RWpP6ǃ\G t\t=u\ \\FuGGXG\Pb tKpH)…~RWpPK6ǃGXG\GGGXGG$G\Q` `T;PuRP``DžXGA=`h9t8u`A9i@^;\'uO``;huRTQZ``XG *\"``;huQTP``XG`A$,\(t3\"t\\'tc\)t\\t&`@`J`A`@q`B[H`AL\"u`@4\\u+`B\'u`A `xX`;huPTR`` X\(u`BP\)B`APQ* t\t=uÃ)uH``;huQTP``XGwSC`Yt)PSsVZ (G`@@DžX V\}w \}uO``;huQTP``XG}G\|DF\`u \\ t\t=u\ \\$\"t!7\\\`u`xt "G\\\)uS`B~ HB t\t=uÃ)D\(`A\\uW t\t=u\ s\\G\G\'uS` `T;JuQR``DžXG\"u` DžX G~G\Gl\"uG` DžX B\\ur t\t=u\ S\\$t3\"t(\\t\`t\tG\GG\G\)uC G``;huQTP``Xf\|u GW\( G G` `T;AuPQ`` DžX  t\t=u\ \\pH)…~RWpP-ǃL9`thLuX u DžXt\X)t$>FE t Pjǃu FЉ\>ƒ t\t=u9\t\uk!\>u GG G t\t=uÃ-u\O b&u\u G G\>u |uO@ SGG G|t = L9X{|RԳ\)P2\&t?\ &\(\;t \| t\t=u  3;\uA\;t(\|t,\&u\\|us&unDž\k?Mk =uD t\t=uÃ(u Dž\ S \)G|t)WP蜯 XH\P     s!BF s\Bt)QjV赅 \t = E SƃUtMVSh JÃt5}}C = t}u t P5 UC MVh ht Ãtptk zu9Z tWR8zt p$j‹C BZ B8 t P5 辰 J8[^_USD ;l s3:;l rl D ]here document `%s' unclosed U,WVSjEp OMEUBuEt EPh芫EU‰UÃEE}UB E]U)U@}t t3E9uVEH)…~RSEPA'ÃCG t\t=u  G ƅu?ut u ]]V ?uEPh EH)…~RSEP&ÃC t\t=u ƃ uEH)…~RSEPV&à CCuE)SP֫UBBu e[^_US A] wQ8ыBv  ,jSuh Vh,觶U WVS]} Wj } ${PS3=#? } ${PS4=+ }KSH_VERSION               (         y l ^ T C  ? ; 8 2 / * ' !            whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-i-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.RANDOM$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV     U|WVS3E 8uE @EU p h }1fE]EPؕt  虦,Jp虩jh h|  jjh ht ijh h ibj@h h i =t%1ې4o<u=t'1ې4o<uڞx  jjjZgt)@Ph P(Sj3gx h 蕓j5x P$p װэt  1t  t&ֿ tֿ ujjj?h#t(Ã;t!jjjh 3胞 ;ui djjjjh Tjh 3h  茒ǃW腖Éރ;/uN\PS|7Ph |9\u9`t1V,, 8t P+, 8u,tjPW腗kÃSh ʑP荘jdPh 蟑Pb,jh< h P = t%Sk;t ;u;ul  t 0 h Ãt'=l u2j#SP+?uj50 Ssƅ0;l ujj9tƅjjM QÃ} jj =tSt Pj0ƋU FCuh# 貞M  p C;]}w=unt PjƋU FCj0jjvY-F u' 5p#cPvh; )Fp t PjZFB jj Pj-F j@J t0j/J tN F FQjK |%f= u j%=%P舦=tt @M TPM)ىHp jT=, 8u=thh j+=t=jjjh #=u*jjjjh b/P=t jjjh -h ӍPёjP"/8tjjjPE 0u#h 臍P腑P{0tth gt=tV觙ijVV1x[^_include: %dU$SEj0jjEPg*Eu }tt PBEBEEEj0jt Pà EtEp .SEt t QEBQEBCw\$( ) 4) ) 4) ) @) @) 4)  }t= t SSh ( j̛}tt PMJ@U Pt PjuEEMH t PEP‹EPjEPÃEp - >Et t QEBQEBۉ؋]ÐUS]t PjXjP+]shell: %dUse `exit' to leave ksh U$SE@ EE 1=t E %E EjEt  jt PÃC$* X+ X+ + X+ + p+ p+ + EtMuh/=tExuEt E@MU,A;E SE Sh.* j菙4 t jhEx8u=t EH  E` EtYuQ=tN5Ft8 Àtu%jjHPiSj] 5 a` t @t PVe[^ÐU WVSt tJ{ t<1{C f()*@#!$-? =-+?#% "#$&'()*;<>?[\`|U  Iy  Iy jh0 jh0 jh1 jh 1 j h1 j@h1 hh1 0123456789ABCDEFUWVSEu SS1 K1:ȅu[^_ÐUW}u1'Wu Q,P}ÐUS] |"uCPSuP11]ÐU WVS]u U{C9sCCs PWtCS‰)e[^_Ð 5 a5 4 c4 4 e4 4 4 i4 k4 l4 X4 m4 C4 n4 f4 4 4 b~4 uu4 o4 d4 pY4 rV4 P4 sG4 h?4 v<4 64 -4 4 4 4 xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexportU WVS}1۾2 ޅtWP[u C"v޸e[^_onoff%-*s %sUVS]uM D^5 t[5 Rt3hb5 uV--e[^Current option settings set -o %sU<WVS}h5 yDžDž1ۃ12 t<ǰэQ55;~C"vPPhl5 PhNh5 Ï1ۃ<3t2 tPh5 虏C"v؃h/胏[^_U,WVSU1ɉ׾2 Dt <tBA"vt PWe[^_U WVS]} u  u9t tu!ty]uGtCu?l PU5l WPUWPVUu tuGwd9 u e[^_o:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifierUEUt1-t+u%xu-u=uE}t$1҃}uEu EM<t}}tKE܀8tjP谉8t0URho8 ӈSh^8 j耉㐐}t5uM<t F}<uhE E)VUPH}t;EEPMQ}WŒEU<tBM|uUEe[^_ÐUWVSu1<-t<+uA1E EECtTBACu}-uڋE 9uu1[^_%s: bad numberUVSuu VaÃuVh< v؍e[^ÐULWVSu] tu 1эLMэ| }uYWSsuH)ߍW@w}t PR"yǃSW7VWIS%EPWSEPVQe[^_*+?@! UWVSuEEE1;u >F*t?u E[uCE~~!u~~]}]utt}uL1j}4؃Ph= $tEtE;E4|ut(}u"1@)ut msꐐ}tMF;u  1}tu }%e[^_ÐU WVS}t6}t0UBU1ҋM 9MsME<t91MAM=1?*D[tG=/=!== =uREPEUHU9UMMQEPURM QEP tEE;E rjURMQjEMExu'URMQEPU RMQp }jEPWƋ]U 9wuMQFPWSEP* tPURMQEPU RS 9]t'MQEPEPU RS ~C;] v;u ]jMQEPnEMUzu'MQEPURM QEPt }jURWƃ]M9MuG] BEPFPWSUR* t$MQEPURM QS C;] v;u5눃jEPUREM]M 9}jEPWcƃURFPWSMQ0u4;uu1u)URMQEPU RS\ t 7C;] vMA9vE9EAU 9U%e[^_ÐU WVSM] 1M19u A9!tAA<uA}<t  u(u1[uqEl9u7y-u1yuy]t%AuA}t9~1.9t 99vy]l19tA[^_ÐU WVS]} 19sK;u>C<)ur<|u}t uC&}Ph= QtFC9r1e[^_ÐUUuE PRU WVSE +E/U<֋M M9s,36U҃u ܅}Ӑ9}voM17U҃uMՐ~<9uM볐MMgE뎐9uT+UE )9| EPU RGP] MQSEP}UM}e[^_Uu uKÐUEU @@P @@: %s%s-%c: unknown option%s%s-`%c' requires argumentUWVS}] StDEtC-u%x-uxuBCKt-t C t+u @EuCC$C-u  CC}?t3}:t-};t'},t!}#tuVEP]uuOE8:uECCCEPC E E tRʅuRhE @<:t<;3LS< t S<;u CE8:uECCC:EPC E E tRʅuRhE j| C t h,S|?j<,uCDCCN<#uGLS< t E t#щK̋tE tS뱐CEe[^_%s'\''UVSM1ˀ;t% DBuC;tDBt;uQhzH }ˀ;ti;'u~H )P}1FuhH s}AuQPHAQAC;ut hH '}e[^%-*s%*sUWVSt P]CSmE<ÃuU Dǃ} t9~ ߉;} ~} EË5<)ƉEEE9}1ɋE@E9}cNjuq;U }GE@PEPRURUPEPhXI URS 9}h,EPh]I UR59|uVj EE9qt PURhpe[^_UWVS] SjEPEtg]]9sJF;us>tE)PjVǃu})SVEPG ];urEE)EE؍e[^_ÐU WVSuU }~)װэY;]|]KSRVB 3e[^_U WVS}1EPE PW@ Ã}0u,=p##u#W$~ p##؍e[^_US]jjS{|&u1#$PjS{| ]ÐU WVSu} u%t Ph"jÃWSǃu=t't P߰QSkt PS:ne[^_U WVS}u jjWzt*9t$p#V=? p#VjWze[^_UWVSEEEEX} uE ,U /uE@)/FD>U+~PVRƃWSV5< hSEpf9 }=p#t61BUr/tSVEPƃtʋ[^_U WVSutt PG0Pcát C,C0C{(uE Pu胓ǃ |/ t= 8j jWtEW9 }}s,Sg11}E tu SVWe[^_Ðshf_fdopen: missing read/writeU WVSu ]ttBjjEPs|(tt tuhS jpt/tt PW-bC1C)t PG0PaÍC0Ct C,EC CCCC {Cu{ C3C${(t EP %؍e[^_Ðshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeU WVSu ]ttBjjEPr|(tt tuhU j>ot {t9{(}h;U joEC CCCC {Cu{C% C$t EP#؍e[^_shf_sopen: flags 0x%xU WVSu }]tuWhgV jnnut Pj0_Át S,}u&BBu@RV_EC ECCCs sFCs;C$s(؍e[^_ÐUVS]1{ |"Shƃs 4 }ts,Shcts,sQce[^UVS]1{ |:Sƃs c4 }C CCCC e[^ÐUVS]st-CPSuSjCCCCt s,Sbe[^ÐUVS]1{ |SLƃts,S`bts,sIbe[^shf_flush: no fdUS]t1tx{ }hX jltC$p#I t+ωC ~$jؙRPs <3 C CC@u1jS]shf_emptybuf: no fdU WVSuEFu~ }hlY jnktF$p#1 t"E t1VEf߃t^U t%@=@uv,FPv*^VF)ȉFF)ȉFFFVFN@F^)ÉDž~]SWv 0 }Ap#u>}ِNF$FF9SWP7 ^^)롐E tFFFf1FFFFN@Ee[^_shf_fillbuf: no fdUS]C{ }h[ jitt{C$p#q@tjStfK CCsss C }=p#u;}׋C (}"Kp#C$C CCK1]ÐU WVS} }p#tG$p#@tjWLG tg}uT}}*G W)‰ӉU Mڃ9.u9w(G ‰;Mu;U v+E G E GEE1]EL$Pd e f f e f f f f f f e e f e e f e f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f e @΀EE}}} }UU] E AEЉEE EE E UAt(}UTBЉUE EE EAuM }}E}tUU}}E EE }}E}E<w E ES$f pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj pj \j ;h pj pj pj pj ;h pj pj pj pj pj ;h 8h pj pj 4j pj ;h pj pj ;h ρ t EUJ E}OEU BUЉ Uۍ}}ԃ$h h j j j j h j j j j j xi i j j j j h j j i } EEE @EЉ Uۍ}}ԋ=c K)0 хu}u}t K-t K+K U BUЉ$Eۉ}}ԐK$0ute<0ta[E܁c úetEpc E @EЉ Uۉ}}Kȃ}܊8utK}tXxK0CU)‰Ѐ}tu9E~ }}@ZETEEXuc ߰эA$E}GEE]U BUЉ};E}E}9}%)}]%@=@<+t<-t< uUBtYk<0UBuRPH}GWGCEM}~N 3‹EEjhHE;Er9U)t PPRAE؉E؉EU EjEMME4 ED E E EPI . u Pƃj@hpj5 Nu!Vq uRq Ph]q =t Ph ºFS]S F"FS S}W  u P ƃjF FW멃j ƃjh FS]S< FS[ S]S j Q ƃj9FFj h ejƃu j jVjjp ejbjjVjL !jhj5 ƃ #}~h4q 聓UMBUEPũ}ut PURAF -MEt PPUR>F ft fE;Er9U)t PPR>E؉E؉EEEt PUE)$PRJ>FE;Er8U)t PPR>E؉E؉EEEt PUE)$PR=F)t Pup@t Pu\@e[^_ÐUVS=tj wÁu{u} jB jzƃj Sie[^USj hJjP Ãj8Cu j C؋]ÐUS=tj,v=t =t$JjÃu1jkj ÃjC 'C 1]ÐU WVS=tj vÁu {u} j11'SkuƉGFƃ=u&hu9u 9uj Se[^_ÐUWVS}t Pj@m9EE@Ejkƃ=tj u(t jh E;Er:U)t PPR:E؉E؉EU E=tjft|iE;Er7U)t PPR :E؉E؉EEEt PUE)$PR9Fjj)jF=u"j s9u 9=tj he[^_%s: invalid function name U WVS} u+Ɖ>t'E u:=uVh~ HB:uڃjDÉsf{ @Ctj j{ t Bƃ fBjCjCt Pj6‹CPt Pj6‹C@C@C@@:C@@C@@t PjG6‹CPC@C@u t `؍e[^_ÐUSt Pj@5EE@E=tj q=ti;E;Er8U)t PPR07E؉E؉EU E=tjp={ t;t jEU)ut PRO91e;Er3t PPRy6EЉEЉEEEt PUE)$PR66]ÐU WVS] u}ucXpxe[^_Ð  { v s n i Rq Vq c ] Z U R I D B {@ }> ; 8 5 2 / , $ newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifUSj h h L =L tUSM] Q @[UEPUS]t Pj 0ff@@@@ @@@]ÐUEl D  galiasexportreadonlytypesetUWVSE=uu1i1ۀauƿ, tHeuƿ2 t0ruƿ9 ttuƿB u[^_ÐUE@ u @8txt1||&&!()    ]]<>U WVS}] =u0@tAPjE1u = ȅuuu5 u (u )CwxuGu? BHw0t P0 zu- P!EOtJh SWxƃ E$th( 5 -t|}ut P4 EW;BrA+Zt PPr=/‹GPGPډGXGM e[^_ÐUVSu=u j@h=t1mV;BrD+Zt PPr.‹FPFPډFXF ,e[^UÐUEM }+@P)$ uUU1ɀ:t HB:u ȍAÐUUE MBfBfBt QRUWVSu] FEVU6P+19}@9|f^ gfff)fV~}1;E}mU@EtUtF EEFu:Ft= j蓗@= juE8tlt uFEeFF  EP3 t u%Fth EP %EF E Fe[^_UVS4   H CCtC t8tjSP NyӍe[^UVSH C0tjPS7 Nyލe[^ÐUVS]u C th P-$h VLC Kt>t H 1ҋC C@t uH 0Ct)t =t($ωCu C C jRSxe[^ÐUS1C ujjSOC%{ujjS-]ÐU}tjjhÐUWVSu}  F u0EPhRV }u FF]FtEut =u1[EPVuFE t~H 9~t$~EE}jEP6e[^_Ðsetexecsig: unset signal %d(%s)US]C us3h j,KʃωSE t~1tt!% t C S]%S #no-vars# #no-args# ( %T) %T| %T%;||&&%T%s %T! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi whileuntil%s %T%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%sUWVS}B$ ԛ d L  x 0 < l | $ Gt-Ã;t>3hL E PEP ;uhP E PEPk Gt1Ã;J3hL E PEP= ;u$h[ whf E whm :whr .wz fuw Pwh} h E PEP|h E PEP1ۃG8t'G4h E PEPlCG<uۃh 6wh E PEP;f? uwh E PEPE EtRh E PEP_3hL E PEP;uh E PEPwh EPEPh wh E PEPwt{E Ehș E PEPW^;t3){t|P3h̙ E PEP$ ;uvhљ EPEPvuhڙ wh E PEP5ǃh E PEPwh E PEP t0h E PEP|wh E PEPd Gt6f8th E PEP?wh E PEP' h w f u Ph E PEPh E PEPwh E PEPh wh$ E PEPh* E PEP nwh/ Rwh5 FwwI ft: PE PEP8 'whQ hY E PEP_ E;t3E PEP;u_ ;t_3Fu~tEPj +EPvjv Pha E PEP|E 뜃}tEPj ܿe[^_< <<- << >> >| > <> <&>&%s U WVS}Ept8t3t.t!tуu49tJ1ɋE9tWB0P@C$ P t D hH U R t hK nhP U RbhT R@thX U R>h\ .h_ U R"}hc U R hf E PWuUB t:PhL E PW(UBtPL Bti PE PWe[^_ÐUVS]u `u-V^}$PV@S=؃u&V^}$P躽Vj?诽 VS袽e[^ÐU WVSu} EF w$ ܢ $ p ̣ @ T x WPF-F}t"t `t$uWj\WS{Wj$Wj( >tWPF>uWj)跼F.Wj$衼Wj(薼Wj(苼WPF^>uWj)gWj)\F EWj"EWj"Wj$F<{uWj{FyWSFu^F<}QWj}3WPF躻Wj(读 'Wj|Wj)葻 e[^_UEPuu uH1UDSU]SuBPu R袱EPujSS]ÐU WVS}UBU%UPE:j$D x 0 D EPwj_uF;aURPC賹;uBEPw"W1duj ЅtP;ÃtK-uF;URPC;;uEPU Rw^UBt;uRj;EPj yURj ڸ] uF~EPj 躸~GURj 蚸K,wE PUR URPkuFUuSe[^_ÐU WVS}u 1tE Pj NjUfBfGf: uE PrCU REpGEPu GQӐuE P)ӃSGƋUZE P3;uEPu GQӐuE P)ӃS GƋUZE P3s;uUB tU RP11G E PUrGE PUrGUBGe[^_ÐU WVS]u jSR)߃VW WSPe[^_Ðwdscan: unknown char 0x%x (carrying on)U WVS]} 1C $ d U U , , 8 H T X X Cu볐FCu룐Cu$tFCC9uu,{ vNpCPh jTe[^_USPF Sj$Sj( >SPFδ>uSj$赴Sj(誴Sj( SPF蒴>uSj)Sj)wSj$iF<{uSj{TFSP:FuF<}Sj}3SPFSj( Sj|Sj)ݳye[^_UWVS]uE P+]S EU:ME ME Pj EU}uExtU RpMAUB tM QPlUB MAtU RPMAEEU<XM؍e[^_U WVS}u Gt VP Gt/Ã;tV3i ;uVwR Gt-Ã;tV35 ;uVw G t VP.VwKVw?VW e[^_ÐU WVS} uLCt WP C t WP Ct WP WS ue[^_Uu u,ÐUu ju/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %sUVSh|Ph< jjh 6Ã}q< 5p#đPhЮ j }E1jt1.jֿuh jj jSBh}"5p#DPh0 js fPc}85p#Php jA5hoh}th< 5ht S7e[^Uh|Ph,USt PjP6C St  BuCC4 @CB@CCDCHjSCPjSCPt BCLZ]ÐU WVSt Z{CLBsNxAt3@t-Pt P4 P NyC t s(St PSe[^_{ w p k [ T K B ; 4 / %      LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNSU WVSj h h(=p t

SE5DE; uPjEj\;( u$ tx u)S4RSuADt#uu;56DÃ+j Dj D {Du29ptp pVwP 2 @ @ e[^/?U WVS] $t \ ` ` ` \ $ =u^St3 tr4\=uH=%P m dptCσwЉt@pS u_@@ /ujjhK jjhM !t j)= R@@ j@ װэAPRP!j( ؃\ t"B@Pr!w2HP @je(ӡp,DttDCУtp@pxCσwЉxp@p@9؃\ utӡp,DtxDCУxtuxxtp@p@9tY؃\ tSyqu\p@p< t uJu=u08HPh&; tu_t2HHP/¡H )щʉP P3j3&; u$@ @; 5u~JVH p,Dtօ~)VDuօ~VHDt]HP.¡)P K9}މ5B B'u 9/H}0=t'HP  M@ HP  -@ ~u"HP  ^@ HP @ HP  @ B Bj$ct?It=h@5tt(t %P$tth5]tvtc=tEMQRPh 5 u>Ds= =5 x t1@,jjHB Bk jhN j ¡Pp pnP F8u,cu9Fct9t SW&>ytSWx>cIvx t@j5h/uJOC1j5huOڅtBtHBp pp p p pB3HB*u=Gu  @)=)ǃ_S5hG;jhN j¡PP5=J)P5)= y g^u p QAK S9~)׃Ps*P uL=t+@ Bjpr z)ǃWh\ t~ PppD|zIJ K S9~)׃Ps. xWp"[ Q9}׃RA)P p@)P )x25P<9u E ?>NuhW55nÃ}!} jrj>r %ѡp,EЋUDu uC‹MDu tфOtuuDu# tUC Du uDu uC Du t ʄiOu^;1Ҁ>t- p,Du; u  t1҉C;uډP;P tBP t0ѡp,EDu tGCtDu ujjh-x ujWVe tB~HBux dHHp,Dt!l#t"DPB HJ9}AJKuzP Rpp-…| @nj58==zWj j2=uBt ;B |HB1e[^_ÐU WVS}U E1t$  i i  X X ` X X 4 }uxW }uxW }uB@;B Wj "}uB@;B W ƃ}r;p dF^B 5EftFuEa؀:,uEPSW5ƅ}F}u zr)1}u B@;B J r9}uB@;B _WW}uB@;B 3W+1X K9Hp,DF9DuH 9~΅NH 1pF;p }@P%Etۡ;p ta}~F;p |INxE@PÃ;]uG E9uOu}t}~F e[^_ÐUS]4=%P5ht 'KŋB~HB1]ÐUUE )УtPPRhLÐUE[t1(t")t5K{t# ]t,:}t+1+# 1Up ph@ @ @ƀ@U@@P Rh@p耠ÐUVS]h jFƃh s4FCFsv C F CFe[^UVSu] s sv qC F CFSe[^ÐUS]h sh S]ÐUEM BJllH@ B @BlEP5 G$   U)‰ <9~)У)  0 <tA9tBA0h P5(_(h 505,A, 50j 5(诚50j 5,虚<)‰Ѓ$48 <@ÐUju uUS] }tB;B};B ~FB AJ  ;B|I+JQBBPBBP褝X SuPPR聝X1]ÐUVSu] B 9t)PBPBP>))X e[^ÐUWVS}U ux t6Hr!ÅtA;K u IxC9us}ut I A[^_U WVS Q;Q mMA] t'5p,;Q }gÐBE tT;Q |Mp,DuNO E u*Du4;W }B E u Du;W |MADt!E;P }*_񐐐BDt;W |;Q } m:[^_ÐUWVS}HEr}Ep,EI~lUBp,UDu Bt]Ix4CBu%uڐIxFE uDtA~s[^_UWVSPH 9m}MHE p,M}B;U}pG p,uDuuF H9}N Ht]K ÐB9}4GCu%Mq B9}GE uDtJ;U} m{[^_UWVS} QM;Q }lrg5p,MYBDu;Q |MADt&E;P }+MYBDtE;P |M;Q }s[^_U WVS]Hƅ~MrHu=p,Ix2UBp,DuDuIxFDtA~s[^_ÐUWVS}PH I9}br]uMp,EB;U}FF p,]Du]C H9}$^ B9}FDtJC9}s[^_grabhist: bad history arrayU WVS} |B9E 8u E P0uh jZ}tuэAC S9|JS p Vp@E 1e[^_ÐU WVS} ]u}tkH9|}t[}tGO;^u C1PSEPWnƃ}1t%}tSh@譕| 1nf}tV߰эAB J9|IJ p Sp@e[^_ÐUS]50j 4( tj j  j 8 ]ÐUS]} <<=tS4(4)4U+44]USH9|?1҉9})R@PCƒ;X|;$}1]ÐUWVS1ۉ]]1u1F+U$$9~EE}]uV@PC]ƃ;X|"W@UPBU/ǃ)$$9ơUe[^_USE] tPC]ÐUWVSE1u]‹=$9};J ;Hu}t uEBy< u CF;5$}RuH}=tMCF;5$}-CF$y;5$}<v<u^CF;5$}4@CF;Ju}u HE=$9} ;J H;Ju uU9} CF;5$|E 5]E E=$OtCU8t-95tEPVP{CEFsƒ:~ }t+<: }t>:8t4UR$@P>P8 E9t URP e[^_ÐUVSu] 9V)9}Uj j 9PC{9|b 9~UjN 95+9}PC9|5e[^UWVSE}u>=u5|tKP5|1H|tP|jEPEPEPpp pj ƃ u5|uuEB1ۃ C9}Pjjh-u19}4h U<эAP4u%tE|EZ)Ã}u ~XjEe[^_ÐU,WVSMu udu!tjPj1Pu4u/tEP51tPEPEPEPEPpp ptPE uN;u|:uuEPuURp j:g}tXjE4 ËE1G;}}69tSjE4j ‹ERuʋE߰эyE0EPUR^}ЉU5uuEBh WS"ƃu1}t+~|;/tjjh-ƃuEP)j3e[^_ÐU$SUEPEPEPEPrr rjà t)uuS>uSjh1 ]ÐUU}=t~u@M-US]=t}h} ,~uj^@S]ÐU5 }u P UjnUS=t+h 5 輴CC]Uuu uUicmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfromA{Gz?.AUWVSuD+DžƅƅƅDž|h| uh jupjjiD}h j,-P -P,Dž=T PDTHX\`dhlpLtxV3D$X `            h                ( t    $    0  < \ t    T ` jj5#7LO5#h js -ƅ& ,@*tj55Ph jls ,jh$*PR5#+u95#趩Ãu5#h jsC -xj5#>`t  u؃5#h jrEu!*tj>4Ph< jur `Eu`؀ , pƅ)tj3Ph jrjj5#5~5#h` jq ,] ,5#W*&? ,1 , % ,jj5#b5P5#hv jYq=5#h j8q -jj5#[6|=5#h jp -jj5#4u[5#h jp -Fu1ۃq8' ,*x$* $*h$*j )EԋUBUԉAAMuh &$ffPPh i& ESEԋu>FuE9v; uEE9Eu:EԿ ىu',uh/ %)]]F'w SEPh #m  h= %14' ,*x$* $*h$*j EԋUBUԉAAMuh +%$ffPPh % ET[hC $Gh $7h $'PhH $uFU؍TU؍D0EԃMEԃ},u9 ,*x$* $*h$*j h$*Je[^_ÐUVSM U11~Ãu ÉҍÉ[^--- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms U VS ,*,*};<*|$* $*h$*j h$*UI}t5@h# }"5(h## g"5Hh=# T" TtPhT# :"(t8 H9~ h|# )ȍљPh# ! ,*x$* $*h$*j )HC=h6TÉVS|RPEUVS QRÉ֋EEEE‰UE؉+EURPÉփjhVSPjhVSpPt5xjhVSPjhVS@PjhUMQRPjhEURPPl5pjhVSnPjhVSPh# z e[^ÐUVSEEE E u11h]uVSEU RPEU]uEU1EUEUEUEU)uuwEUe[^ÐUjjcj=H%PhEcho Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d US]$, $- 0 0 8- . . 0 0 P/ d/ / / / 00 @0 P0 `0 p0 0 hD' {Cg$L- - - - - - - . . ,. <. L. \. l. |. . . hP' ~hm' nh' ^h' NCftf%Ph' +h' h( h*( h;( hI( h\( h( h( h) h\) h) ~h) nPh) ]h) #QCt# t?tt&0h) /h* #h* h\* Ph~* stuPh*  h* Oh* { Cf%PCPh* [h+ GCtth;+ Qh\+ EPh|+ 8{ufCf%Ph+ fCf%Ph+ CP=h!, rh,, bh=, RhR, Bhe, o2CffPh|, PPh, ;]ÐVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02xU WVS]$%4{h0 CPCPCPƒR%Ph0 S,CRf %Ph1 /C PC PCPh$1 s rPh61 srPh61  PGh;1 N ,*x$* $*h$*j e[^_%s (%s)USEE,ujjEP蚈Ãu%urPh hh %uqP3h_2 hh ڔ ]ÐTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) US]S$% C <u+AQPQPh2 3-<u(AQPQPh<3 ]Ðpatterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x UWVS] ٍEEUU}uEEUUEEUUEEU܉UE؉EUԉUEЉEỦUEȉEUĉU;t&p,DDuh3 jKA9uڃEPWVUR}WEPUR}WEPUR}WEPUR}WEPURh<4 S`ƃP~<1)9w/U1ۍ<}9}M}BC9|E;Ev,uBhm4 71ۃ9}UPh;1 C9|hy4 h[^_ÐUM$<@u,y u&ЃȀ8u@;u1Ðusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host Uh<6 h|*DjjXUuu uhaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %sshutdown~SIGTSTP init/etc/rc/dev/consolerevokesetsidopensh/bin/shSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): ULWVS58>-uFEEEEEE7 uEE8 7 S7 &2$9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 T9 9 9 9 9 9 9 9 \9 9 h9 9 x9 9 MCE8EM(}tEMEkh7 E PEPZtjPh 7 j.F}tEPSh7 j'} ÅucP%t}t@j"jh7 S}tSh7 Sh77 j8'j"jh7 ShD7 j hS7 hT7 h]7 }uQjjQuh_7 jDjjPjj Ojhl7  ht7 vRuh7 Quh7 wjht7 Ãuh7 NjS jSjS ~ SyP]Sj5MSjjTjhT7 hl7 h7 h7 j?UjjP{jjOu=p#th7 *{}j}uDPjPCj jDOu =p#t%~˃h7 zEP QjjOu7 RjCusage: %s [-dlnpq] U58h< h|*jRUuu udfiPRrWU WVSu] hL= jIE= "$t> > > > > > > > > > > > > > > > > > > > 8> > D> > > \> > > > > > > > > > Y$C$+E hM= SV`4)ƍ S ;t0j*1(}t S3 S5 2P%s: %s%sfts_readU WVS1=$u=u =(u=t jPu'ƃjjC4H $? @@ @ @ @ @ @ ? @ @ ? sPsh? j@C=$t 5PPsh? 4w  =$s)FPVЅ}W@T)) tu1ytYue[^_Ð"." and ".." may not be removedUVS1];j3H;v8/tj/3ƒ@u8.uJPt .u>xu8FuhLH }n Curie[^Ðusage: rm [-dfiPRrW] file ... Uh,I h|*jEUuu uroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. UEtPhI h|*hI h|*hI h|*jDroute: %s: %s UVS]5p#hyJ h|*mtShJ h|*SVPhJ h|*7j]Dnqdtv/dev/nullsocketUVSu] $@K K K K K K K K K K K K K K K K K K K K =1%| jVhJ SV(<4)ƍ-@{=tjhJ Zjjj'=}hJ 8P4H*$L 6M pM 6M pM 6M pM pM pM dM pM pM ,M pM pM pM pM pM pM pM pM pM pM pM pM pM pM pM \M pM pM pM pM pM pM pM pM pM pM pM pM pM pM DM SV BSV87*W"!SVj31e[^Ðmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done U }hM EtZP2E܃uhM [jjWEPjV> }h N 0E܉E؋EE؃=t-hLN k=\t@PhqN N}JE]܋E9)=tPS&C \sLtF9 ~=|CECPS5@99(E==tWSe&kCt P PPhN M>t H D0FPPhN !hN ;]EP0e[^_ÐUVSEH0Q10B$0AB.BK~ B=rB0[^defaultinvalidiso %s(%d) %sU,WVSu1=ԸtV=Ըhh u.j.h ǃtGPh 荨 1>u\S `S $HF$ T |T ,V ,V ,V U V ,V ,V ,V ,V ,V ,V ,V ,V ,V ,V U ,V ,V ,V ,V U U FEt>w\S uT=uKjjEP{fÃt2j.3ǃth GP;u;huuOPh 4E =tE!}1]PVS8EEـ>u=Uu E$u=Uu E$RhZ A~(u<=\uhPhZ  uhZ tKt t #7tZ Z [ SPh[ e[^_ÐUVSE] u1Ҁ u1it )Tw E=w 3=wtftuffCffSCJ:u9wC(ˆ[^64128U WVU1Ƀzu!z uzuzuzu RZ KB$< u@EEEEr}1t c uc t Qwe^_Internal Error%s: bad value route: %s: bad value U\WVS=\u\\E H$4d d d e d e e e d e e e e e e e d e e e e e e e e e e e e e e e d E_ESEGEL;E0*E\UBhc MYu \S uJ}t8}ty}t"kjE PjvOUCC$e h h h h f g h h Lh h h h h h h |h 0h h h h h \g e }1]EEEPEPhRZ E P蘃uEăxuxt"U Rhc h|*ĥj(}pEPЀf=t fuUztBffB B}uMQduR1O}u>BBB B޸B EԃU RPxdEԋMAE؉AE܉A 1fyu y}u7BB BB EȃU RPmEȋMAỦQEЉA 1u fy QGE PkƋ}󥤃}t}u;UBDBUʐH;Ev8t(ЋMEPU R(iMQE P&}u rU,RM Q=믐}uEEUj/M QƃtU}uOEU RÃt,jjFPTPMQffS>EU RSÃt9}u =u*MYS?rffk ]SҖ EEPVEffPhDk h2h [ e[^_*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sUWVSUJMBEB EEf%fEfEf}u>f}u7f}u0u,fu k +EPhl hX }1t Uu k ׹u!k ffdBPBPBPBPBPEPhl hc ff=0u=s@80u=rf}t*EffEEPhl h hWVhl h2hXSYXe[^_Ðactual retrieval of interface tableU,WVSEEEEEEjjuVjj]S  }hM }EtyPǃuhM TjjVWjS  }hn ,u9sPSS 9rWe[^_got message of size %d on %sU WVS=|tjfhV5ÃjPW&PSho SVuwriting to routing socketroute: read from routing socket: %s UWVSELp#1U}au EJ}cu E8}gu*E=1u!10  EEE PУ $`  t tQ=tH XSVEP]=thAp VtS=tH XSVUR@]=thAp V_tS=tH XSVMQ]=thAp VtS=LtLH XLSVEP]=thAp VtS=0t0H X0SVUR,]=thAp VK tS=tH XSVMQ]=thAp V ]f=tSEP =|SUR5}hCp x}uphLh5Ã~9uҡ9uŅ}!5p#oPhlp h|*賗Sh1e[^_US ȐvJ:t(ˆ$t u au u au au au u Du au au u au au au au au au au au au au au au u u  H}19~9v H9wvJH w=u [ÐRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:US]={tCPhLx PC4hwx C |t ~7ujC Phx h sh$*sCT.shx thsh$*ssCP3ssshx 9hsh$*8S] route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire %s %8d%c %8d%c sockaddrs: UWVSu] EE1}hQPhy  ~tFPhLx 79~SPhy h|*贐Ft"PPLPh z h|*荐VL^ tatSt t1tt#UUzu ztU:t H Tu}t't UBGEP^Ph8z  t-W3PhIz  }t FtURPhZz l }tEPUBPhkz Gh~z 7hvh$*6hz hz  F$tLPv4hz  F$tLPv8hz  F$ tLPv Vj>Qe[^_ÐUVSuԺtVPuCe[^%s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; USU] B$ @ x (  T RPPSh8 BP\RPShF ore"PShS XhPBPjZPSha 5r rrFPShp r rrwRPSh} ; h$*ÐUWVSuU ‰U11ۉ]PjE P M AB< w ƒЉE7B<w E%B<w ɉEuFwG$X y t A})}1ۉA1 A ;MK*E U e[^_$OpenBSD: show.c,v 1.16 2000/01/14 19:59:17 deraadt Exp $UGHRBD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables U,WVS1EE}}E}jjEEPjj]S  }hB ~jZ EtbP,ǃuhX j( jjEPWjS  }hf ~j uh~ t%9sS9rWe[^_FlagsGatewayDestination%-*.*s %-*.*s %-6.6s Uh h jjh jjh %-6.6s U WVS}wL^9t&St uWY u j$jV/jwV>tH D0FjjPh G%PV ,*x$* $*h$*j i{e[^_ÐUInternetInternet6XNSIPXISOX.25IPsecAppleTalk %s: Protocol Family %d: UUB$\ Ї                  ؇      ; 3 + #    1tPh! ȾRh' 趾link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s UWVSU uMAxtExu'fxu BPh8 VWzMyuWA|Dž|@ 1ۀyP|PhA VzDž|F CGUB9|aMQIExu H ?tUR MQExux u xuxt)tURMQH j:V`эA;EIMURƃo]MǍFz|APhP )PChU Vxƃ9s$PCh[ Vxƃ9s;|rx}}Vh` "0=tVURhd VMQQhj X[^_ÐU,WVS} U܉f= t&E9sÐtABf9t9rVu 菻e[^_%s/%s:%u -> %s:%u (%s) (%u) (all) %s:%d ->%s:%d %s/%08x/%-lu UFf%PShs F~t1FPOt 0hz FPh h f~j(EPFPj F$f%P]Sh j(SFPjF&f%PSh 藹~(t2F(PNt0hz F(Ph h Ofu6GPGffPj(EPGPjPh fu-G PGffPwPh ۸e[^_xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpireencapdstdeletecloningchangeblackholeaddUWVSE} E fE @ *u,F] } <,t\]<.t<:u/}EEP裶U fBF]BB< w|9sxFC<,uF] } *M fA]}9s8SCVƋE f@t<,uۋU fzufB>uW1XF] }M fyt!}>,t9s׃SCV0ƃ>uE fxuE )ËU fZe[^_USU] :\u B5p#蘨PSh j Ct,<~w$p,DtC<~w Du;uhr h JCt,<~w$p,DtC<~w Du;u F h S F oCt,<~w$p,DtC<~w Duh S[ F ߰uh jVCt<\uh jj }FPSà uh jYKvSEÃvSOà t-<~w%p,DtC<~w Du;;HKCFPS Ãt,<~w$p,DtC<~w Du<;u Cu*h je[^_Ð\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])US] EU@E}\uh E@} h jx[u!SEPtÃuYh ː\u3P[t :Uu@E+nu  CE'\u \EC U8iEECE8u1]ÐUWVS}] BC:^u^BC:]u^]W:[uCr.t :t=u0CBCB <]u9t( t=BC<]u9u:\u znu BBCt<]u:]uBC11[^_RE error: %sU WVSSuJƃt߰u U ZjU t.jSPt U 2PiPh jU @9@,s@,[^_123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionUWVS}EGu21`GC+]]URMQU B5M AD,AEEPEE]]]?<\ubGPhj t9\CrЋM At;pvRht j,E 9p}4p/<&t<\u%\C:E< uh jCG?j+]]E+E=U҉UREh!WA h je[^_Ðmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'UVSu FFF 1ېMt3<~w+p,DtAE<~w DuU)=W hPe>FPP [^_Ðunterminated regular expressionexpected context addressUVS]u <9<0}L<$t<#u~nu P,++5+,w=D,u+8#uxnu P,񐐐OH+Ät t&<,+;X4+  A+D,+A듐e[^_stdinUVSu=+ 5++@++u+)0, D0,h P蝖+u$5p#CP50,h j| +BHJȅ}R @5+Pa=H,t5F1cH,1OH,8EP5+á+@ @t-p#uPoP50,h j u uSVtD,5++@+^u+)0, E0,h P%+u$5p#ˏP50,h j +BHJȅ}R D5+Pe[^ÐUVS]u j ‰Zr$$e[^ÐUS]j\B((]$OpenBSD: misc.c,v 1.3 1997/07/25 21:05:41 mickey Exp $%sUSuÃu5p#菎Ph j؋]ÐUSEU u R0RPÃu5p#;Ph jz؋]U WVS}u +t Pjh VW~ÃS/+ SPVWb+e[^_sed: %lu: %s: UVS]uh h|*W#|50,5D,h h|*WVu h|*(Yh h|*W t je[^$OpenBSD: process.c,v 1.5 1999/06/06 15:42:24 deraadt Exp $%s %s: %s %lu U,WVSD,+L,UR0u M MuFC$T ڻ ڻ ڻ Ļ ڻ ڻ ڻ ڻ ڻ ڻ $ ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ 0 ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ ڻ p Ķ Զ  ڻ ڻ ڻ ڻ 4 ڻ H ڻ  \ t ڻ ڻ H ڻ d ڻ ڻ E@p8,9,|%8,P5<,<,,5<,[oURU++Myt = ,uv hش +=++HPj 5+萇ÃtË+B)+)ȣ+PCPR,j5+5+h+X :+=+ujjh۴ P3 j5+5+h+ j5+5+h+ j5+5+h+ Ep hش 5+=P,u$=+uh$*5+j5+2Fjh+ku j+/jh+4=P,u$=+uh$*5+j5+jJ=+h$*5+j5+{=++HPj 5+脅Ãt+U+H) +h$*5+j5+Au5+3=P,u$=+uh$*5+j5+jh8,9,|%8,P5<,A<,,5<,[MA Dy ILC,uV $,d=$,Y$,E@I=+5UzuGhh r +MAu$5p#Puv hݴ j" 5+5+Epi;+5p#蜆PUr hݴ j +=+ujjh۴ S }++ߍuD=+u9+ +It*uVCIu5D,h EE},=P,u$=+uh$*5+j5+jh+e[^_\%d not defined in the REU,WVS5+UBHMu-(,t#H;Jv@D,Qh@ jo5+jjVEP u 1 ,=+UBEt,MMWjjVEP }uT,B9uB 9Bt.T,j0Vh,UBpVh, T,Q9uY;Y t)E; u j@PV jjPh,5T,@)E3jWVh,Kt-T,@)ǃWjjVMQ KuԋT, +)jPQh,UBpVh,T,@)ǃ jWVh,tMM}++,,u,,UBxth$*5+j5+MAx=+x uOhh p`'‹MAP u'5p#臂PUBphݴ j 5+5+MAp ;+t$5p#8PUBphݴ jne[^_rstdout: %sU WVS1;, <,[t t${yh$*tjt{Zh t߆ƃ{t=h$*PjSVVh jSіuڃV;,\$*@ @t$p#uP&Ph je$,,[^_COLUMNS\ \ \abfnrtv%03oUWVSu=8uah BtP莅8:]Shht@juCft C8 8<1>@;=8|h c1|\ѡp,DtM\tH ,*,*} ;<*| t$*$*h$*Rb@G ,*,*};<*|$*\$*h$*j\@PStN) ,*,*} ;<*| t$*$*h$*R?Ph KF> ,*,*};<*|$*$$*h$*j$a? ,*x$* $*h$*j 5?$*@ @t$p#uP~Ph je[^_first RE may not be emptyRE error: %sU WVS}GЉE&u1\u#Ep,DtUBU}W\uU<\t<&uEWB9Gr#GPw LG GEE@EGT, 2u|2thD2u|2 tX)ˋW)H9Gr$GPw G GEST,E 2PUR]_E@EWB9Gr GPw yG GEUe[^_UVS]uSB;CvCPs 0C }uCVu CP]SSe[^%s: %sUVS]u 9Cmaximum option value is %d -- %soption requires a numeric argument -- %sU,WVSuEEh j jh ]S謆E u*h j jh S苆E u 1$PXuEPhP &uu޿r tu>uUR} t$h E PqEt 8 e[^_ttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingdeccookedcolumnscolscbreakallUUE 02illegal option -- -%soption requires an argument -- %sUWVS} U;-u GC G]h j jhEP茀ƃ u1cFutSh  Ft*MP@GuSh  WFиe[^_UEjpPDRP)ÐUUzt R"J"JB$ B$B ÐUS]swrfCFC]ÐUE@+@-@0P$߃CP$`@ ÐUEjpPDRPuÐUS]{tEEPh`t3.EEPh`t3C ]ÐUS]sqPCPhC ]ÐUExt``߀`'HH H'@ ÐUExt HH ``@ ÐUS]s#qPCPgC ]ÐUS]{t SO CPgC C C ]US]spfCDC]ÐUEP KP @"+P$g@P$@@ %d %d UEPFR@DPhJ xp%d UEPCgPhv PpTIOCSETDUUEEPht2%}h jG`TIOCSTARTUEhnt 0}h j `TIOCSTOPUEhot 0謴}h" j_     x r k d \ U M F #> 38 #1 3, 2& 3 3 # @ @ @ @    -mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5"           @ @         z s k e ^ V M E < -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk                   { s @j @b @Y @Q H ? 5 0 * #    @ @ C$ C C$ C      -xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho   | v o i b \ U N F @ @9 @4 . '    -onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopostU WVSEu 8` =` t33WuC#F F CF ;uл = t23WuC#FF CF~ ;uл, =, t23W聮uC#F$F$ CF$> ;uл = t>3WAu"C#FF CFF  ;u1e[^_tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s UWVS}u EDž0tdt$ t?tt&0h /h #h h Ph fa0WHXÃW1X 9tPSh Sh$ &a0}vFPPh3 a00thI `_ hK }wuR P }w|Z P}wu ` P}wuh P}wtn P}wtu P]}wt؃| P<}wt P}w@t P}w t P}wt  P}w} P}w@t Pe}wt P>}w t P}wt P}wt  P}wt Ph O}w t Po}wu PK}w@t P'}w} P}wt  P}wu  P}wt  P}wu  Pt}w u $ PP}wt؃- P/}wu5 P }wt= P}wtD P}wtL P_hT I}wu؃[ Pl}wub PI}wti P%}w@tp P}w}w P}w t P}wu P}wt Pr_h }wu  P;%=t&tF=t!=t&4h "h h h   P}w t  P}w@u P~}wf} PZ}wt  P6}wt P}wt P4}unh  = t?]G4PW1P7h jdS$S ?uŃj+j Dž0= }tWG48 7h 0d)SE,P`G4PWuPh S8V4000 u/Dž0,Qh 8XSh *X ?C0t%EPh X8Ph W[^_ÐU=h,thI Wh,El,%s: %s %s %sUWS]h,uS5l,h< sWh,P߰эD Hv%hC HWShF :Wh,ShI "Wh,e[_%dUEU @wRh jh`,Su H`,}`,Ma,-b,u ^@?^@@@`,-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZUlWVSFD1u50ẺEUUEEUUE Elet' atftgtF>6j5#0E}5#hx jE4;U}Thl E 4IMá4U <эA9uhr RURD`84E EPu}h{ jURht@uؙ}h jDEPhht@u謙}h t(r w7 E 8u*VuUREPuUREPEEE 8]UREP8UREPUREP} p,Dt+QSǃWSVJWS\JERjh 7蓜u E PURoEE 0h E PU x }t)EPju}h jJC}t+URhgtu}h jj1usage: stty [-a|-e|-g] [-f file] [options] Uh, h|*jҚUuu u3call completed call aborted call abortedinterruptunknown ACU typecall failedr%s: can't open phone number file unrecognizable host name missing phone numberUWVS9Džf=9u=9tP<P59591? h 59h h( j5h( j&hx,16tzjjjjh Ph h h 5K' t$=p,t jN@ и 59u <@ft<,uꋅ8t @59S@Уp,uh 0S5a&@:nh 59Oƃu 59h O ah Pw:t܋8 u@5W h, P:u܋< (t<,t< u担8t59S@Уp,tTVۥ9tP9P5959<< h 0S5$1h 0S5$@VhWўVEu@h/ 0h 5H$,V 0V/ @ Ћ/ t Ѝ[^_call terminated disconnecting...UE=p,uho 59h 5#bu8ho 0h 5#f=t*h LP0h 5P#@ÐUju赐jhx,1UVSu\=\t#3VUu ;u1e[^v831vadict3000courierhayesventelhourminutesecondLocal file name? %s: cannot creat List command for remote system? USU ,*,*} ;<*| t$*$*h$*Rhh;h 2h;hPz? }h;h $KGhSh ?2th;55?S[[take] usage: from [to] %s: cannot create cat %s;echo UVShh;h 1j h0h;~~h! .Jwu 0050_hP9ƃ }50h; I.50hQ hSh_ VS5[^ %d write error lines transferred in UWVS]S4PS59'7d;j5?%jh?5L;ƅ jP596jP59譍=?t< u uȃh;jjsh0-h j蛌j>1 =d;jP59 %=?u=d;URP-3t< lB uf=tGWhA G);SVE P9thE xGd;)t%SPU R΋9thE .Gf=tj=+PhU  hp;jj貐jh?59iPjЊU R[^_Local command? can't establish pipe can't fork! can't execl! UWVShWh7 -TS1thG F,'Bƅ}h^ FhWh -t.j V蟊h j 菉5sWjj q S#~h9ubj6肊 SoC~POhl DjL[^_ÐUh;jjȈr%s: cannot open UU ,*,*} ;<*| t$*$*h$*Rhh5h +ueh5h* PFD uh5h, D/j5PKf=u59d: timed out at eol chars transferred in UWVSu]j5?聈h;h  j|Eh;jj$jh?5L; t[;tP<C;uf=tjEP59Շ59~9j0* 1EjU9E1ېFPVЅ}VU=h;uЃju f=HtMMf uf=HuWE N u?f=Hu?f=t5j ACt0j .Cuf=Htu } tf=Hf=tGWhA Af=;58] E9tbjS59M=;u =h;t$h _Aj誄)H=?tE9uj肄K} tf=Hu j } t] ;tPC;ujQ7ÃVEPjĄf=t/f=Ht+]Sh# +]ShU jh?59hp;jje[^_[put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo UVShh;h "'j h0h;c ~~h ?u 0050 Ãh* S?ƃ uSh, h?Jf=t50h 50h hS؃Ph Vl[^ timeout error (%s) U WVS}1Ej]S59,f=tx;58jS59cj=;t9W|*Ph q> Fjh59),눍e[^_Uh j3;can't find `%s' away for U WVS]jc4ǃ ,*,*} ;<*| t$*$*h$*ShPh7 $uj5?cjjkjj_h;jj jh?5L;D9Ã}h^ =t0jz3ǃV~t9unj59-SC~jj誀jj螀SSh }<jӄf=tj2)Ph W jh?59Àhp;jjjjjj[^_ÐU WVS]j_2ǃ ,*,*} ;<*| t$*$*h$*ShPh7 "j5?_jjgjj[h;jjjh?5L;@7Ã}h^ ;t4jv1ǃV9uzj59+jj+ SC~jj~jj~SSh i:j迂f=tj0)Ph C jh?59~hp;jj҃jj ~jj}[^_[sh] ! can't execl! UVSh 9jj}jj} 5Ãut=VK9uw h j9jjb}jjV}ljjH}jj<}j/55Ãu CjS5#h 8jFe[^ can't create %s Uj5?}f=t#5x#P5x59} jh 59|jEP5L;!} }nu5xh =8[cd] %s: bad directory ! UShSh 1t=9u4S΀}Sh 7h 7 %s [EOT] US]j5?r|S! tSh? d7hD T75X;, UjUWt.װэAPR59{j0 jG}ÐUd;jh0-cUSj/553ÃuCbjuh4 S5E!]UWVS}M] 1At t tȀ9t At t u9tF9t A9t9|[^_%s%d %s%c UWVSE }1ɻ<T Kyuh 57uu-}u'}u!1҃tsRPh {5Kyƒh e5e[^_[set] onoffUShSh aS-qt$qj 5?yt$qt)$qqt$qf=tt-$f=t h h Gat$ahf9qt$qj"ÐU %s USj@Pi }h< A=ÅuPG tjEEPh@ uuhK uPShL 55Oj@P]acan't open log file %s. Uh2 5((u5(h4 h|* !"$'(+-.03569:t xj:hH ut j:hK ut j:hN ut j:hQ ut j:hT ut j:hW uft j:hZ uBt Hj:h9 ut Xj:h] ut9ǀx=9u 9` =9u 9k 9tPh G:tPh -9tPh% 9tPh h9hp u u 9h9hs u u 9h9hv u u 9 e[^_HOSTtip: no host specified UE=duRu2h@& ^uhE& h|*jhP901d01u1Dj,Py<…u01901019B019cuusage: tip [-v] [-speed] [system-name] tip: must be interactive tip: %s, unknown option tip: phone number too long (max = %d bytes) tip%ldall ports busy link down PHONES/etc/phoneseventip: bad baud rate %ld %s [EOT] fcntlConnected connected UWVS] Ef?f9??E 0 ƿ' 1t u`;U RS~h8' h|*9j_fjGuh`' h|* j/fu~lM A8-tERP0|49~ntvu%\;3?*@PF9Phz' h|*E K}Ep,D}эA=v#hh' h|*8j^ehURh:9E8t @8u9:59h' j V~uh(- j`h(- j`h(- j`h(- jt`MQ Ãuh' Njdu'h' 25X;jzdjh$*hh' ZZ9 u 9' h' J 5à u35h' K5X;Ijcf=:t Sit-Ph( S5X;jcf=:u Sj59ΛÃuh"( .Sj59蛛Ãuh"( h?jEp;? %|;%p;%t;;;;p; ;;;;;;1h9$ahL;ah j ^4( =`;t(( P?tF j%bUi5X;g=l;thl;htj^jaU=<2u5?_<2ÐU=<2t5?_<2ÐU5?_5?_Uhp;jjbÐUh?jjb%sUS]E E9h / j\Ejj\E Sh!. wh@2 uN)E CPSЅ}Sm))tЋM < tMuE URj\MQj[1=9uU9U u] Ujj[9h/ jh@2%cUVSEf=tj)uCPSЅ}Sl))=?u$EE:u%}t=?9Et`;u&:huf=XƒXg< u4EjV59f=X:h/ uD:u5 u??EE1ۉƿC5 u EmƿG5 u EOƿL5 u 5ƿ' t PhP5 h|*h|*U71Ҿh2 E2 "E2B~e[^_Ujh?5P;Tjh?59Ujh2uaUWVSjS59T t0FjS59T t )=vf=t@;t Pf9uƅy:h6 W@;u ƅnƅyjP5P;Sjh2bUf=t@;t PJfjMWUf=xƒxjh2UWVSjjRjjRh6 jRh7 jRh|6 jsRh7 jdRh8 j URh2`Dž hW59Rƃ-=p# h@9Rh`HR9s=?u$C9rVSjRf=@;f=xuPVjS]l9scƐ<^v5PNt8 @;Bxz} ;B| t RQJC9rPQ/var/spool/lock/LCK..%sCan't open lock file. Can't read lock file. Stale lock on %s PID=%d... overriding. Can't seek lock file. %10d lock writeU|WVSEPh : hSŒhh Swƃ jjS]ƃ} Sh8: h|*IjPSVVPǃ1PjVPhO: h|*SǃjW*P t =p#tVuPWEPh: h|*8jjjVP }-PV1Ph: h|*rPǃWh: S߰эyWSVO 9u VO1*VOPh: Kx[^_ÐU$Suh : hSSĊHome directory path too long: %s %s/.tiprcrset %sUWSl=lt3Ct3HtC C tC C ;uЋװэA=vRh< h|*Rh< hS h= SK ǃ t\;=\;tSh = j StShWhSYuW`%[_access denied out of core UVS]u jCPuh3> gC$< <t<tl<C tVPQCPus DVC uhC> NcB9s t?s 6C !9t%!ƒS 8C t C Ke[^all U WVSE_? u=l=lt]jCPyt S;u.j EPÃtCuVP]u҃=,~hc? ,e[^_record%s: unknown variable U WVS}j=W #Ãt\WEC@tS.P@ uSÃS{j?W"Ãt<WEtZjBP1tBuV^B?!tWGPHE}tWEPWh!@ e[^_%s%s=%s=%-5ldUS],B!wV,"K ,*,*};<*|$* $*h$*j ,,"~3`,,St' tpf{ u?@, ,*,*};<*|$*!$*h$*j!33hQA u,C trjPC,s 3hUA F3hQA 1,{ t/C PÃSV,ShNA =,"~,hc? ]ÐUMU u t 1t.%ÐUVSul=lt;V3=MtCtVP%Mu ;u1e[^n r t bf U WVS]E EފC8\t#^t C^}CB<w H*C ~=C tA8tAA9u@C/~$7LЊC/~7 LK FCt :UM1:UuC[^_ÐU WVSu] VEu QE@tSPEPP.@ uSÃSEP 1e[^_parparitylelocalechohdxhalfduplexrawrawftpetetimeoutcdelaychardelayldelaylinedelaytatandemdidisconnectecechocheckHOME/bin/shSHELLverbverbosetabtabexpandscscriptremoterecrecordrcraisecharraraiseprpromptphones/var/log/aculogloghohostfrframesizefoforceexexceptionsesescapeeoleofweofwriteeofreofreaddialdialtimeoutbabaudratebebeautify starting call...K can't initialize bizcomp.... can't set dialing mode...D%s 7 can't get dial tone...ringing...1 %d second dial timeoutbiz1022UWVSuf=thF ^hF t hF |F E؋E Eك]St hF NVhG j(S߰эAPS59iChG uh!G 1qf=th8G hCG ǃ=t:5hFG ]S輺Sh]G V5 =tIh[^_WUhH uVUhH uUjhH 59qBjj59Ujh#I 595BÐUjh3UWUװэAPR59AhHI jNAEh3VuO5}@jEP59Aj_@EPj@E$E< %EPj@}ÐUhHI j@EM5?jEP59BAj?UUMAM8t1AE8th3WtkMQj%@=%Using "%s" can't synchronize with courier can't synch upcourierAT E0 AT C1 E0 H0 Q0 X6 V1 OK AT D %d second dial timeoutcourUWVSuf=tu hJ G]S59&M@Sj59D u-hJ hK h+K V5j1$jh3K 59 jj59jh:K 59hPK wh$*7!jhWK 59 >t8=u,@8uэAPV59ijh\K 59T  =t:5h^K ]S;ShuK V5U =t h[^_Ujhxt 59>jjhyt 59>i59>ÐUjh\K 59timeout waiting for reply UhM jh83@UhM j<EE8uMQj<sh83uL5;jEP59F=j;UUMAM8tjEPjJ<1 9600/ARQ 9600 2400 1200 RINGINGCONNECT%s UWVShN u\]S59"vSbvSfSj59eAEPj;ghM j;EEE?j@EPE$E< hN /}tuN u f=ujhN EP?=]ǐS6@>uaUD*BUM}~Mh83u959jEP59&;Ãj9EPhN 6EPj,:1h[^_ AT Z +++Ut8=u,@8uэAPV59%0jh.Z 5901h.Z gt-h5Z S<1tPu1cj59=t:5h;Z ]S7ShRZ V5Q =th[^_ÐUjhxt 59/jjhyt 59~/ÐUjh.Z 59.timeout waiting for reply Uh\ jh3HU WSEh\ j-Eh3tEPj-15,jEP59N.j,]]}1҃t,]ME: uˉMB}эA9r؃}Rjj-Ee[_ OKCONNECTRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)US]h] Cwg$h^ ^ ^ ^ ^ ^ ^ h] Kh] ?h] 3h] 'h] h ^ PPh^ h] ]ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 Uj59%jj59`jh^ 59+h^ & <0t!<3th^ h_  j8EPhf@59+jhW_ 59X+j j59jhxt 59+59+AT Cannot synchronize with hayes... UVSujhb` 59*j]Vhf@59 +Etk(~(Ph459*Ej0h4; u,jOh4%tjKh4tIjhxt 59*jhyt 59n* Ch|` N1e[^Using "%s" can't synchronize with t3000 can't synch upt3000AT E0 AT E0 H0 Q0 X4 V1 OK AT D %d second dial timeoutUWVSuf=tu ha ]S59jM@Sj591. 5u-ha Xha ha V5辺1$jha 59CjYj59jha 59hb wh$* jhb 59 >t8=u,@8uэAPV59jh b 59 8@=<t:5hb ]S菟Sha V5詹 =<t@h[^_Ujhxt 59'j'jhyt 59'59(ÐUjh b 59timeout waiting for reply UhRd i<jh84Uhpd j?&E<E8uMQj&sh84uL5>%jEP59&j %UUMAM8tjEPj%1 12000 7200 1275 7512 57600 38400 19200 14400 9600 4800 2400 1200 RINGINGCONNECT%s UWVShe u\]S59 vSvSSj59*EPj$ghpd j$EEE?j@EP<E$E< he }tue u f=ujhe EP)D=D]ǐS6) >uaUD*BUM}~Mh84u95"jEP59J$Ãj"EPhe ZEPjP#1h[^_ AT Z +++UA%P>j59`t9}@=p#u hp hp jj 5hu Djjjn }W#;htu}u 5:1}ÐUjljh85IU4Sj39~ajhxt P]S59jSZjS_Sj59^jht 59 59]ÐUj蠺h~j P9=:~jht 59,5:k9~jhxt P59>/dev/cua1/dev/cua0Unable to locate dialer (%s) U u uйƒ4)EE =uhP jh@ jqujj]h@ jKujj7h|*菼h R+\}uEE PU @z &$ P  ^j6jkX ^=n~~=th| h$*rh #XjU6 "=th h$*qhؿ jhz 9+M-j=th h$*qjWj5 =thǔ h$*\qhؿ jhz M9h (.1jID 3=t5=th h$*ph jhz 8jh Reh Vq8h - <1jC}2jh R \j4jV M}WE 0E Weà th SV!8M}u\jY4jV M}tWWE 0E Wà t'=t V hL SV7M}u'.0jB=tS1jusage: %s -i [-chmvy] [-b blocksize] [-f file] [-s fileno] %s -R [-cvy] [-b blocksize] [-f file] [-s fileno] %s -r [-cvy] [-b blocksize] [-f file] [-s fileno] %s -t [-chvy] [-b blocksize] [-f file] [-s fileno] [file ...] %s -x [-chmvy] [-b blocksize] [-f file] [-s fileno] [file ...] U58hМ h|*m58h h|*m58hP h|*m58h h|*~m58h h|*fmjoption requires an argument -- %cUWVSE 0UNMr9-iPËE t(}эAPEEujj跗EU:MuUPhО n>эAPI‰ujj*-MB6BPO\%}uE-@EEUMAMEE8<}tUM uE +KUe[^_/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help U@ WSEEE@ED E E E E Ph } h E t7}tEEEP莬h EEPPPP9$  l x ` L  ت װэAPh R^S褆ǃ9=t S{hL WSG- װэAPh RwS,ǃW6<uSh h|*dhSPyװэAPh RRS>t@uSh h|*Ddhd pS3,װэAPhѠ Rc"$j6=t% װэAPh٠ Rjhޠ h hP hp h h h h0 hp h hТ h h hP hp h h hУ h|*$cPװэAPh R[PPװэAPh R~uh h|*bRPh h|*cb1װэAPh "װэAPh RwװэAPh R?=t"h h|*axh$ h|*aZװэAPh5 R2ji4װэAPh> Rn\װэAPhC RuK=t"hI h|*`h] h|*`fPhp h|*w`E[_%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! U WVS] u~=h58h h|*_h|*G50shh@;0s@ t  C=@ t@эA@@J< t< tBSh@‰^4:uhUREP]Shh@5h{ƒ:u hh@=@/u URP(PEPh hS>URSFPjh@EPΘÃ}fURv4h« h|*_^t' t*u#h˫ !hګ h h h|*^FtKFhFV)‹F4EP(FPVuFPU[^_Ðcommand lines cannot be continued missing %c UVS]C< t< tu   t\uCuhp h|*&]J 't "tCF9C CF8tuCuPh h|*\K< t< tu؍e[^../..U WVS]޿a tjhc SUuf U +;/ua U fc U fe BhSE Pؑu >t(FS/u /F/tӀ>uK;/uu >tsFF fFFu2EPV%P%bURV0)N ~u"EVJ%PEPhܾ dMURE PUR%ÀK=cSiPEPUR|Ph }uzWcW'E PE PURz%Ã}u SaK=SIiPEPURPh }uOO=WFth V~gz~uZt5~th< VXgVbV& vu̓EPU REP$ƃV`? u V_v!"hEF 5hEURE PURK$ƃ N=V,hPEPURPh h$*G=t#EPURPh^ h$*tGE\E PURh| EPURlPh h|*5G$EPURAPh siEe[^_|NIL|ONTAPE|INOFND|NAMEFND|MODECHGUVSuHE HE CHEth S8{th% S{th- S{th6 SzIEe[^Find unreferenced names. %s: remove unreferenced name unreferenced with flagsU WVS=th h$*E; sSƃ{to~tiKnsO^tHf{u:=tS Ph h$*WE S_S# [u; sn5hEtn^t`{uRf{th Sc=tS Ph h$*D S@_S# [uv ue[^_ÐRemove old nodes (directories). cannot remove, non-emptyU WVS=th| h$*@D1hEhEt0{ts C S]SU"G uӅuhEth Sb[ ue[^_ÐContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeU WVS=Ru=tHh\ h$*B1=th h$*B5 EP$jc`VÃuVh dSPh h|*`Bc V`ƃ;5nrn9tPVh h|*)BPChV Ãuh adCuh S`CtSH\cS\P>c 9tPEP#B=  s9n)e[^_Extract requested files UWVS=th h$*; sSǃCtY_tRCtEW9PV. ujjSPV Zc[u; sr[^_Check the symbol table. incomplete operationsUVS=th h$*=;5 ssQVÃFt吐C€fS{u$fCf{th S\[u멐e[^Warning: missing name %s missing inumber %d type should be LEAFU WVSu} EVÃuVh h|* =1ZW9tE@t9uuWh /_{u}th S[Ee[^_Extract directories from tape %s/rstdir%d-XXXXXXXXXXwcannot create directory temporary %s%s/rstmode%dcannot create modefile %sopendirfileRoot directory is not on tape UWS=th| h$*z;5n5nh hh W$mt8ủ؍[^_ÐU WVSu u tbpp5Uэy5UÃt!C9uWVCP觸ủ1e[^_lsMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) reclen name too big (%d > %d) UWVS=t?}} ]9bf;tVSLVO 9r41;u )]=stSh^ EI=nt;t=suCCC%)CuS9C$9=tha h$*03Ct=thu h$* 3SC$9s=t2PRh h$*2=th h$*2փ;S[^_ÐUVSufF$fFF\s=~7f+fD5UhjS贼FPVS>F‰e[^ÐU\sf+fT5Uj5Q;5U)UU WVSUu 1BFjR^SډװɈNf$fFe[^_Ðbad seek pointer to rst_seekdir %ld U WVS}] uW9tV)ySh h|*0j%RP7%GthG P7Ge[^_error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d U WVS]{u>hC P3OC!=h h|*/nK;K| C뫐T fztr)9~"=t7BPh h|*>/K:ur> u18; sr*=1Ph h|*.Ѝe[^_ÐUVSuOt6P-Ãt$hkƃssV1e[^ÐUS]3茮S]ÐUS]jjj3衮+CC]ÐUSjuÃt+h t@S1]ÐSet directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopencannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes UvG  +@th nMWe[^_ÐCannot find directory inode %d named %s %s: cannot create filewrite error extracting inode %d, name %sreadwrite error extracting inode %d, name %s writeUWVSu} WÃuVWh< aLhhVK}Vhe (1ss5UU0s ~SWPu*5n5nh| h jBT=uCSWPvu*5n5nh h|*(h jSNPP[^_Uutno memory directory table U,WVS}u jj(Ãuh JMb)ʍ)pE  {EC Utd}܋FE~Mb)‰UFE~Mb)‰UfEFdEFpEFtEQj$jEP؍e[^_ÐUSMMb)ڍ)ЋpEt9Htu1[UM3=#th=#t hUS]t; sr1'15$Yѡ Yt 9Xt @ u1[addino: out of range %d duplicate inumUVSu] t;5 srVhU H15$Y YsC =t!9suhn S%E[ ue[^deleteino: out of range %d deleteino: %d not found US]t; srSh ,H15$Y Yt9Xu@@ P @ uSh G]ÐU WVSujWÃtUFBbad name no space for string table U WVS]uh A߰֍N(Y9t 9(F$Pǃuh LASW'e[^_ÐUWS]߰эA$(Y(Y[_Check pointing the restore wfopencannot create save file %s for symbol table fwriteoutput error to file %s writing symbol table UlWVS=thy h$*=8h EPXEu!h URh ? Ma E܉EUU;5 swKVOÃFut'{ GMQC$Pj3赧[uۋu;5 svE;5 sVÃFu} UEC$‰UC@ MACt@ ACt @ UBCt @ MAC t @ UB MQjj$EP[uu;5 sJ1;5$Ys; Yu E @ EURjjEP虦F;5$YrŋE E sEԡ$YEȋMMġnE̡nEСwE؋EPjjURHMA @t!h EPh = UR觭e[^_Initialize symbol table. no memory for entry table .opencannot open symbol table file %s statcannot stat symbol table file %s cannot allocate space for symbol table readcannot read symbol table file %s lowhighIncremental tape too %sinitsymtable called from command %c UWVS}=th h$*u[ s%< $YjRQ Yuh ;jjh €JjjWÃ}h Wh ; EPS~}h WWh4 Q; uVjEuht &;VEPSI|jEPS3}h Wh : U=|t$=nu5nh h @n nn sn=|t|jhHb%ÐCannot have multiple dumps on pipe inputioctl MTFSFUtt= uk=tthh j;yfEPEP=tRj-+Phm5p} h TDump date: %sthe epoch Dumped from: %sLevel %d dump of %s on %s:%s Label: %s UhoPh& h$*}=otho6 PhA h$*G=Lrt>h rhLrhq5qhQ h|*hqho h|*%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special fileextract fifo %s %s: cannot create fifo%s: cannot create fileUWVS]nn nAEyMb)‰UAEy)‰U1yd%=`&= s =/=@ti&==P =tPSh! h|*=GSh< h$*,=t3SNt @ ShO $=tShi h$*5nS>jypqtxb|fh ht =|fu=t%s%s; too long %dUU|fE |f=~PRhxb5nhH j_nRhxb.Ðunallocated block in symbolic link %sU5nh jnUS] Su5tb(|tb]hole in map US] h3 )tb]ÐUmid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failedEnd-of-tape encountered partial block read: %d should be %d U WVS0^;4^} }58^w~8^Nu=4^u w4^=w 1ۃ=tW8^PW8^P5pwƃtuBw94^},~(=thi h$*w4^ttu!~]w 9tPt)P<t=tRVh h$*F} 4^h h|*n<t4<t<t h ,h 5nh 5nh h|*=u h ;u jy5w Vj58^2y=tjVo.jRP5pvщ1u %th% j"!=th9 h$*=tu1 @ 4^PEP*itw PShh E=8^߾@^0^}58^0^@bxe[^_tape read errorTape block size (%ld) is not a multiple of dump block size (%d)Tape block size is %ld Uw~8^Hu0^=tw P58^w P58^5psh jAthPh j h w4^=tPhH h$*ÐUp|=t/ PsNote: Doing Byte swapping 8l4s31l528b1l192b2lNote: Doing Quad swapping gethead: unknown inode type %d U WVS=EPUB=ltHPZ =l=su(=th[ h$*sMQ7=s=]Shv F$Su1҉󫋅UBB B BBBB fB "fB"$&(B(B,,BHTB0XB8\B@`d@kuSDu 1qE@lUJ(Z,ȉڃu uH=vA}G %f=@u/=fu/ȉڅuth +f=ftMA(Q,щ‰ȋ]C(S,}B$@   X   X E@ MA(A,19}REA};|8Exu nUBRh =ntMA$A&=t ]S [^_oldnewVolume header (%s inode format) begins with record %dDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksUVSu>ul =nt Ph( h|*|tPhI h|*hw h|*(Zwb$      h_ .hx "Rh Rh h h|*@bH,Z9tPRh h|*hw h|*1Ƀ>t19}<tA@9| ,Z@b(ZFe[^unexpected tape header unknown tape header type %d resync restore, skipped %ld blocks U WVSn nnnExlt&URjtnU9BuڋUH$ @  4   ( 1ۋE;}5ǁǤ<;t VCU;|EPtnU9BubE nUBnJ sn>n 2n &h 35oh E8~Ph h|*[^_ÐChecksum error %o, inode %d file %s U WVS]1=su ;Nu3[ǃNuIu!5n5nWh h|*1e[^_ÐUE Puh|*6USM] KxAQKy[ÐUSU] Kx BJJBBJKy[ÐUS]M }ht49a0|\st lt0JwtADBCDuPQEuPQU uC1;y]lUEPh\" IEU WVS}j/W@tXƀ>tQ>/uCWÃu'jWt0WÃS K/F>ue[^_Ðmktempname: called with TMPNAMEU WVSuF th" VN VePS 6VYPOlj>ɈN(VPS[^_not on ino listRSTTMP%s%ld%dUVS]1s4F@t9uuh# SsVh# h# hhf菣fe[^cannot rename %s to %srename %s to %s UVSu] =u%SVCi}SVh5$ =tSVhL$ h$*fe[^newnode: not a node%sMake node %s UVSu~th$ V VÃ=u+hSi}N@Sh$ 4=tSh$ h$*e[^removenode: not a noderemovenode: non-empty directoryRemove node %s US]{thk% S"{th% S C $fCSÃ=u!Slg}Sh$ 3=tSh% h$*]removeleaf: not a leafRemove leaf %s US]{thi& S^C $fCSÃ=u S軠}Sh$ 膐=tSh& h$* ]Ðcannot create symbolic link %s->%scannot create hard link %s->%slinkit: unknown type %d symbolichardCreate %s link %s->%s U WVS]u }u)=uhVSd}WSVh' ,u/=u:VSdf})SVh\' N1HWh{' B14=t$SV' u' Ph' h$*e[^_cannot create whiteout %sCreate whiteout %s US]=u)jhSme}Sh~( 蔎1!=tSh( h$*]delwhiteout: not a leafcannot delete whiteout %sDelete whiteout %s US]{th) SC $fCS*Ã=u Sb}Sh&) =tSh@) h$*H]ÐUS]; ss'St xt@u C; srۉ؋]US]v#Sߺt xt@uKwމ؋]bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %d flags: %s US]u hU* h|*S耼Phd* h|*,sbPhn* h|* CtP?Ph~* h|* CtPPh* h|*t CtPPh* h|*Q C tPֻPh* h|*. * {u* Ph* h|*sh* h|*SGPh* @]|NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTEDUVSujE, jI, CjFthJ, SF thS, SFth\, SFthe, SFthj, SF@thp, Sje[^%s is not on the tape UVSuVܨ1ۅttKnrVh9- h|*|؍e[^%s? [yn] UVSuVh- h|*Ih|*? 0sBHJȅ}R7n 0s@ uC t00sBHJȅ}Rm uytnb1e[^abortdump coreUE Puh|*=u>hp. u)hv. uVjj`UWS]߰Q&TntSPH nh/ j [=n| 1e[_ÐLost connection to remote host.Uhh/ joPtcpshellshell/tcp: unknown servicewho are you?malloc/etc/rmtUWVS=uZh/ h/ suh/ jO\Puh/ jO0ǃuh/ jj@5n2Ãt/5nV%u j^Cnjh/ VWphn舃nWR=nw E=~EE]u E}~"jShh5nB |΃jShh5nwBEjVjj5n[Bjhjj5nBBe[^_invalid user name: %sUVS]ހ;t< |ѡp,Du_t-tVh1 Z1 C;uƸe[^O%s %d UVSuu Vh2 hSe SV[^C closeU= uhq2 ht2 { R%d readU,WVSu h2 j]SSh2 :ƃ } 5p#719}/)PEP5nXÃe9|Ӊe[^_W%d writeU,WVS] Sh33 juV[эAPV5nWSEP5nWh83 "e[^_ÐU0WSuh33 j]S߰эAPS5nWe[_ÐUu u5nrWUh83 L%d %d seekUdSu uh4 jP]SlSh%4 ]S statusUVS= t12h_4 hb4 1dwCF7vdwe[^I%d %d ioctlUSE |/Puh4 hS’Sh4 ÐUWS] ߰эAPS5n4V‰߰эA9t%uRe[_%s: %sProtocol to remote tape server botched (code "%s"). U0WSj]S/E% FJ x JJ fx ; ; BfABA=tu =lu6h| )PQ&thLJ Mh<| Md\| =`t+5h}5\$=tt55h4)$*(5hFPCP(Ѓ`t=u 9| u=xt\=thYJ h|*u?u8h|* | P| )щ)PVhhB h|*4e[^-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %sUlWVS]޿L u\B\h| S $| %f=@ua=pt,}| S_ EPS*=|hx 5hM h|*if=t&=|u|hx 5hHM h|*;`&| fvo=\uf=du]=|u7 fvsP&| HPhx 5hM h|*ټ=L| =lt =tt<| 1=\t8=tu/=u&; ; BfABACShjhx 蓖hu65hM h|* hx _| =`t5hj |=tt)55h5h;=\t2*| Ws=`u@=t@=xu.=|u%hhx 5hM h|* =u=hƒ=xx װэA4װэAM ~M 9 Rhx hM h|*膺%5h |F5| 5h(Ѓu=`t=u 9| u5h6:=\u5| :tb=u=\hEu=x=thM h|*蜹P=`th|*P| | h|* | P| )щ)PZb=u#=\uhhM h|*hB h|* =\u h| ,e[^_Ð%s: %s: warning, name truncated UtSt5h8Whh hǒ| uh 5h_8c]SPtd5hM h|* hï5h85| 8hRsShu1w=`t;=|uh5hHS h|*x=u븐5| v7hrhD]ÐUUE p#=\u=du PR肑 PR:_z-z-gz.tgz.taz.zzUU tCU uW W C}wtT=xu=pu'=|uShx 5hW h|*Ӳ=u h| h81e[^_%s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored UWVS=dtJ=\tA| ;s| j&TE| ;r@jM| ;s| jSE| ;s| jSE| | uY 1t UtֿY | ;s| j2St%Phx 5hY h|*(H | ;sE| jREE thx 5hY EEet4hx 5h(Z h|*z=d]Et<EPhx 5hZ h|*8 =d| ;s| jRá| ;s | jQ á| ;s | jQ á| ;s | jjQ Åt=lu9| s | j.Q9| s | j Q}| ;s| jPá| ;s | jP Ã=xt!Shx 5hZ h|*k EEeEe| ;s| j2Pá| ;s | jP Ã=xt!Shx 5hZ h|*ǫ EEe$Er*9| s | jOsր}=hu=\t =tt =| ~0| ;s| j>OuthPƉrh([ R| ;s| jNCu=tut t}t0| ;s| jNuӃ=| 9| | 'O[ ։ǹuK=| uBǹu/| (H ut/ֿT[ u( ֿW[ u( hֿZ[ u( <=dt:=\t1=tu(( | }o=| u+hx 5h][ h|* ;=|uhx 5h[ h|*٨=u e[^_deflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s UWVS} =tK|O=xthc w=|hc Z8+=xt PRhc =|uPRhd h$*P| )щ)PPhd 5 | =jjjEP' | tk | j]SMQ+&tNuC SC  KC SC  щ he@ =xtPV4h%d 55 | hd  | u&|  | |‰u(|  | |‰h$*P| | )щ)PTNhh5d e[^_ÐUSUM 1ۋA9BuL9uFAf9BuU CBU j/URÃEtCÀ;t)hg S^(Ã;E~CE;tC;u׃}u MuUBBUu3j.EP*Euhh cJUzuJUh| EP֒e[^_Ð%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten USp#] =p#?hSh{u΃=`u;Sht&hOSh{ ~Sh| tyhhx %u89 =`tI Phx 5hi h|*ˠChhx 5hi h|*袠=d j fPh5h j h|*g=| tM)CP=t4h(j h|*0h|*SjOPP+Pp,Dt PYu 0Pyt'hMj h|*՟=uSGh/[u145hM h|*萟hG8US] CEC UBRu t\C%f=@tM=|u5hM h|*=u =|u h訖]%s: time stamp restored US]=`t4t+9C t&C =x~hh=m h|*耞ShC%Ph! tP=|u5hM h|*-=u =|uhŕss hs!hx PY tM=|u5hM h|*謝=u =|u hx D]%s: %s unreadable ..%s: %s/%s: pathname too long UWVSEP MQ5hn h|*rg 1t ֿn }щKэ =BEPV軌t 3/Q3P藌V-PMQ5hn h|* P)ƒQ[^_ÐUS]=t S|| tP4|| tPSU=t5| ohV jYU WVSE} fEfEh=| tuxtx0x=x@ua?=tx0x=x@u7?x?w)2xxf2xI2x=x@u>xf2x=x@u>x?w&2xxf2xJ2x=x@uc>xf2x=x@u;>jj=wWhEP\ EP5xE2x =x@u=x0x=x@u==tÃx2x=x@uz=Cuסx| x?w*w2xxfw2xJw2x=x@u =xfw2x=x@u<x?w&w2xxf2xJw2x=x@u<xfw2x=x@ug<x?w) | 2xxf | 2xI | 2x=x@u<xf | 2x=x@u;x?w&| 2xxf2xJ| 2x=x@u;xf| 2x=x@uk;| _;1e[^_ÐUVSuu V5h+ÃttSV:w | ؍e[^bad pack levelU WVS]u Cvhu =w1@w u u;\hh| Уwtuww_w=wO=ww =wtw1ɻ1Ґ1Avwe[^_ÐU WVSw)¡)ƒu =s t1ϐGv ƀfA fA@=v11ɐv ƀf f@=v׉ڃ=wu:RwP| Ѕtuw we[^_ÐU WVS1|=ww 1w%UfEfUt$)ف~wSYǡw9vǐGPt)‰P[E)=w;=wwgO5Fw1wUfMfUOu5X11‰w,PjE w}t:j)P1|P=w<=wt.j)P1|Pe[^_ÐUWVSE=wDw 1w%UfEfU=|5ttPw9|sC)ف~w9SWǡw9vǃut)‰=v|9PF)‰PEwB|)‰w|5Fw1wWfMfW |uEV}jЋ)P1|P z}tVHPjt>j)P1|Pb  E ws=ww =wt=w}tHPjk j)P1|P e[^_UWVSEU f=2111ҐT~㐉 FKuG~ʸT0E1M OM~㐉MAMKu}~}^u E~&E@EKu}~ffIy1۸fCfX~%Zf Cf@~fZ$VfCf@~fV$XfCf@~fXhho1ۃ1fdž2jShf0C~e[^_U4|fIy,fIyfIyf{ÐUWVShU U] ۋ\9U9}7KM4h h}f9ruh8hw] hEuf9r0uhhU8:vu h ] ۋU9{UE h[^_U 32 bitstoo many leaves in Huffman treeU WVS| ;s | jv أNy| ;s| jB ~h 1; Cx| ;s| jƃC; ~ǁ~hH j x19_xC]~9{| ;s| j^Nȋ]; ~ xe[^_ÐUWVS1ҋ ~&)xK  ~ Ht91xΐ)ًKr Hs9~H=tw[^_Ðinvalid compressed data--length errorUWVSEU h| yPL HHE xHEH9P}TL| ;s | j أLPP;H|PH)ѡL#Etم~)}֐F?x9}NL| ;s | j& أLPP9|P)L!;r;Eu;5 t<xx=xu)5Ps9t h 11e[^_UU1ABuUUM :t9u B:u1ÐUVSu` 0T9s9r` d)ӉУ`T9s9r` 0dT9s9r[^POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c U,WVS]=ud`XU<-u\BU><+u\E+h 軸t \ \Xt 8Z=\us`d9t;t"M Q9t`H ;E}U 8-uxtڡd;EtcM 4 uBPd9`t@9tM Qc@`Ed;Eu`;dt%M :-uJu.=\u jQ1t -%@‰X&U 8-x-t }=XEEEEGt<=uE#}uuMM EEtEX)PRQ(u؉+X69uuEEE}tJ}uD=tU 42h h|*<5XvX}^H ?UztG==tRPM Dx-uE01h h|*m<'M1M DP1h h|*D< 5XX1aUzuk@;E}M R=tU t2hP h|*;5XbX1M9::5X6X}tUEMQt A 1UB }t-M x-tXPEPum=tMU x-u5X2h h|*;#5XPM 1h h|*:X 1XEXSEPXX:ut}:u.=tSU 2h h|*p:1x:x:u:t ja:t N;Eu6=tSM 1h h|*9EE8:uE:U XEe[^_ÐUjjjuu uÐUjuuuu uyUWVSt$-=~s)ҁǦ|fD;fO;r0+fD;fOf69vSMtPf;3uf;u؍ft2O*N))Ɓ9~5t;|[^_]æUuu u4ULWVSuEUԃ>uH MM }u,t(PЃu E tE EEE EE}u U9U+MM}tEPQU҃~ M;}7uuE)EUMf9DEL3u܍GE;Mr.UMI;MrEЋuEu8t݋E@;EI}uv)~V9sM) 9r)5uVPSr9sIURPMу9r)uVEPUMQuVEЃUU M}ur)~Zwu9s M) 9r)5uVPSYq9sGURPMу9r'uVE uVEPU҃OM؉uuEԋ};}/})~]9sM) 9r)5uVPSp9WURPMу9r4uVEPU} +MMuVQEЍ{;}UUM)MuFUf9BuvFDEBL3u܍GE;Mr.UMI;MrEЋuEu8t݋E@;EtaluhU 4j=Qh| h| h| 5l| ЃuG| C)9B~ pEP)SRWf%p=pxuO5lŷuh jPlv | @<5| h e[^_U WVSu} =ttt| U| `ЈC;;]uGGK ;thFPVЅ}V̴űFPVЅ}V蠴p;| u )"h C+| _1e[^_fwriteUUu PjR蕮uh jOÐUMu Q)PjADPRuh jNÐU WVSE}@E 4]9wVVjjWnu V苵 U<)9}#V;PZmKyVjPGP/n1e[^_cannot allocate memoryUWVSDžDž}t}Gt Dž Dž DžE@ =uwhvtjh"uh j=u+h*uh j}|HMMDž| W}Wh, EPhl RhjXDžDž|8 =t Dž| pE }G I `@\Džx@$DxMQWxPURMQ}W|҉ u.M xDuDžtu ;Y&‹I < 5PR5Zt jjJMQh  } WP54 to􋽜+xW蘖ƃuh j\WxSV% \URh Phl QhjP` \ Dž,WVSV肖I'%`PPpRQ} W5` \ Dž| upug~25PR5?Yt jjHIMQh, }WE PR5; |>-}Wh, EPhl RQj1111ۋdU Bl@hptp;~މC~ߍ=}p9 }d  jPxRQPj|1ۃ 9}ip<u,jPxRQPS|&MQEPRQlPS C9|9U9ttt"t^9kp<u,jQxPRQS|)MQtPRQlPS C9~lU hu}Ep1󫉅:9EA=t E@Q5tWEPMQ:P E9tt"tRPMtQ6 |9<=tPEP= KyЍH[^_fwriteU< WVS1u EEu;s?| U:+ ;rϋM| 9s&B;r݋}9U406U4049r|;nu1ۍS )$ EPjjWHuhW jCM;sEP6V;r䋝^[^_U WVS1ҋ  9}!uF;C~ωƍC B9};0R4D3}9Gt/)эIPP Pm GD2Extq;xtl1ҋ  9};{~MC B;U};0R4;|3t/)эIPP P MAD2e[^_UWVS]@ DC ${td׉}1ɋCS$UU;BtF A;uISt"1ɋF9tF A;uIC ]{u[^_%dfield numbers must be positivecannot indent end of lineillegal offsetU WVS]} tw FPhc SlÃp,DtCDuVuG 9thl j;.ucuh jЉFPhc CSÃp,Dt CDu9uO~}h j聉wPt GCwPmuuG؍e[^_illegal field descriptorfields out of orderUVS] uC C VSuu C$,th j踈VS@PT{usKȃ9ttC !t C  ȃ9tC  t C tC ` CC{u?CSt*C`@t;SC9C}h jSCe[^ÐUE$@ } u 5@+# 1cannot allocate memory-k.%d,UWVS} jP uh jE;s8+@ h P  EPhc 5 Ȝ p,Dt H @DuE@Phc 5 g   :.u^EPhc B PI E@Ph 5      8uۃh 5  L9-zQp,DfA URhc P蜛 p,Dt H @DuE :.uREPhc B P7 p,Dt H @Du}tAE@Phc 5  uh P Auhc 5     8uۉE;0}DBM;|EM;3e[^_ÐUWVS1ҡEE)E=p, ;U~ ;U}Ј( ‰D7t 8 : Aw`9~8 ( 8 (  Ƃ  tD7t Ƃ  Ƃ Bv tD7t Ƃ Ƃ CB'  Bw8 ]}tt =u #t =u  t hPh t1ҡE9}  B;U|t ƀ ƀ =t@t<1ҋ=9}   B9|  e[^_cannot allocate memoryrU,WVSU B =u$=tBt t <= u*h荄 uh0 jNE~t~eSP S7uh0 j=u+huh0 jǀ}|M I EE E EEEU9U0}MMEEE}+}~}}vUU~KME 4U.UhG 6 GMu 6j7E Ku΃E PURMQEPWhRU UUMM~!URM46B KuE PURMQEPWUR }~E}@UMMME9E}EEuE}}EEl E }ie[^_ÐU\WVSu E19EUUfPE@E$tjWEPEP$ÃEEu+URE0PVjEEPU҉à uONEEG9o UE@fBE}EPE0PRVj@PU҉à u=EPEPU҃NPEPWhUE@fB 6jVEPW;ÃuEPEPU҃g_e[^_ÐU WVS1E Eu >G9t{E̋M̃<u}}u#h W6Eu Wj&}t.EPh, URMQ4U)‰PMQj%EPUR4M)PEPjj? ;}t_jW$-t Wj&UR耶MQWS} tWEPh j%WOj}U j}U= t h Ðusage: %s [-T dir] [-o output] [-cmubdfinrH] [-t char] [-R char] [-k keydef] ... [files] UEt PJ58h h|*j}sort.XXXXXXXXXX/%s%s%sw+UWVSh< 5ѺN |/tL RVhO hS DžVPjMzSp } Sj>$hV P:ǃu Sj$SjVjy[^_Uuu uiMemory exhaustedUSu ukÃu hP ؋]ÐUSuoÃu hP ؋]ÐUSu u+pÃu hP ؋]ÐUSUE у#[ÐUS]U ك [ÐUS]U ك![ÐUS]M 1ҋBv[ÐUU1@vÐUU1@vÐUS]M 1ҋ9t1 Bv[ÐU WVS}1h ;r}+1ېPWuf Fh ;r|ډ‹B9B|2BB9B}h PR0}¡h h @SWe[^_ÐUEU Mp l t x ÐUEp,D$UEp,D$UEp,D$UEp,D$UEp,D$DUEp,D$UEp,D$UEp,D$UUp,D%UEp,D$UEp,D$ UU1 t u:blank:]:cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]UWUװэA9 rP5 Rx%1}Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [ULWVS11ې  8 J Gr$ $ & & & & & & & & & & & & & & & & & & & & & & & & & L & & ` d   & & & &          & &  &  < & &  & & & & & & & & & & & & & & & & & & & & \! & & & !  &  & 4 &  & & & & & & & & & & & & & & & & & & & & \! & & &   ( = uh{ z  l ( ==   l   t~* 8)~ 8\u x)f=l }~* 8|~ 8\u x|* " 8  w m @     n   Z  n   . | n o   P n C   $ n     n   ~ l  9 u =   7  l u = r    l M 9> u = ,    l  49u = Eű  }|E̍TBЉUA9tUBЃ v9tF9,uAA9BЃ w0| DBBЉA9ZBЃ vu9A9}8}."| ;u = u PT 8 GЃ wY DGУ = u 9P 8 GЃ vh ,= u P 8 GЃ v  DGУ = u PH 8 GЃ v |&; }h  m uK\th = u P 8 }t h    l 49l    Vl 49   l 49X u CH   ]StS l @uSx P=l }Sj S'n ]S1ҡp,Du_uURVyF~уWuEP UR(]S= u Pb 8 ^uB= u `P' 8 E E[l E=88]43w<=t t t u 1V׃tEPVF~ڋ8װ I эA )‰У u BP  U -EԋEԃ< \u?l t6= u P 8 = u Pu U -= u lP3 0 P ]u \u?l t6= u P 0 = u P U EfEfE܉UffE1]ލuܐEfEfEރSV4kEPS WURW=t t>ҡp,DtEPtEPlDPPuGi}ԃ]}t/URm tEPx PG URs =t tqp,D0t`]S C j= th* C P=h 0 { t hC ]ÐUWVSu} 1;^}T؉ىTC;^|FG[^_ÐU WVSUM 1EX9})];s G9};r;}} ;u L:Ӊ΋UBHJ9}"ULtGӉ΋M;y|[^_ÐUWVS}EEGEU;BM ;A]3E M΋M9v]ދTwTC]Q9suT_ىT/]ދTwTC]O] uD DFuGEU;B}EM] ;K\uE;p}+wU]T؉TC]Gu;^|֋EU ;B}-w] ]T؉TC]Gu ;^|[^_ÐUWVSu1ۋUB9}H;2tC9}8;4u9}/PMQ9} EDT ىTCU;Z|[^_ÐUG@tPE=G@GHtP-=GHC;_8|G<GPe[^_ÐUujMÐU WVSu эy];t!WVSAu C;u1e[^_UEt P4UVSut%1ۃ>t44C<ue[^ÐU WVS]E P$E uSEU 1;t E P4uvF<u1t+PU RuG␃43N9uPS4Åt"E DU R31e[^_ÐUWVS]t} tj2Eu 1E;t{EPE P2S3xt:PuAt:t;MvMVWuƒ}tEPSEP_EtC;uEe[^_U WVS]t} u181FE t%װэAPRSÃuЉ؍e[^_ÐU WVS}t} tj1ƃu1VsEE8tm1U :tQE 4UE4eÃtSVƃSS1tGU <uEEU<ue[^_USUZJB 2]ÐULWVSEEUB@P0EƋMQ|EX =X }HMx}ȋH 1Z}U<}|}ȉ|L Ku1ۋE;X}j>0j20Gj%0Gj0G ?SOHW=5CU;Z~EM};OUB M "RkL }< +;uE 9lu}w v <tF 1ۋFtMy:uC t:;tVװIMMIMĉэyEE9~}1;]}/MĊD9M8D uLIC;]})؋URD8t19}})ߋF9A9|FM16]Ãn66. ;;uEF "E9(1ۋ}E̋G EЋŨ:t>UؐM؋4эQ}эA9vuCŨ<uȃMQ}W;EE 9uԃE06 wV:tqMԋA8tfRiÃN}wSÃ2߰эAPS6S@- >F 8tUrvSFMԋA 8uF}wv#FF 8\W :PRPF d|utq~V FVN VFN VF@BAjv 6 tEEU;B}tHj +ËU}Q{+CURP裤MATCYT1ۋ};_Ju66vvv CE;X~UR|+e[^_0123456789A:B:C::EFGHIUVX:abcd:e:f:hiLlnqrsuvwxyZzword-regexpwith-filenameversionunix-byte-offsetsbinarytextsilentinvert-matchregexprecursivequietnull-datanullno-messagesno-filenamemmapline-regexpline-numberignore-casehelpfixed-stringsfixed-regexpfiles-without-matchfiles-with-matchesfileextended-regexpdirectoriescountcontextbyte-offsetbinary-filesbefore-contextbasic-regexpafter-context%s: %s: %s %s: %s US]E t#PPS5 hY h|*S5 hY h|*ڱ( ]ÐUu uj4memory exhaustedUS]S(tujhrZ ]ÐUSE] tSP1) SK(tujhrZ U]ÐUU:t< vB:u5 t‹E 1ÐU WVSU] T H9w@tPR( P'tƋ=T 1хt)1e[^_fstatlseekUWVSu}T Et9 D %[ U1uхt )MEEU@ 2ET uv)] s ى1ut)UM @ UD 9r2%[ 9u#UB;Urh8 R< ujhrZ < P 5H GPVt5p#h[ lW =, u%f=@u 1f} u=jjjVY/X \ =\ }.5p#h[ 1nX \ X \ h l 1= tT 1RPSQ%щ %` ` e[^_ÐUjX \ RP5H V,}5p#h[ E}u?UR@ < P5H F+}=p#t҅} EEM X \ @ < ȣP Ee[^_US]   B)Px PRƒu҉ ]ÐULWVS]u E}EEEOjj VS0jj VSÉ uh$*G)EEPjW85e[^_%s%cwriting outputU WVSu} ]= t#t P5$ hta -= t6VS   RP= = t#+L   SRPh$*)PjVe40*@t5p#hya = e[^_US]= uIL =H )Px PR0ƒ@u؃j-P5  ~  9r]--UWVS} x E=x u= ~URUu=x  ]څuL 1 9}M@9vN9v]8^u;E|u = tI= t@;ut;hb )E)PEPV,Ãj-CSVރ ;urӃ}tYE9sB)PEPVÃCu=x uj:SV|E9rUE=x uj:W]SL1=x u  e[^_ÐUWVSu x E1]EEE=| ujuREG= tn9sEPRS"}]EP)PS4 Љƒt9u;uvE8Ft;uu=| t9sEPVS}e[^_Binary file %s matches U,WVSu] x EURSVZ?tS=, uJUB %f=@u8V&t5p#SIEPS1      EE1ۃURju'p#u = utP5$ cEp u =x tu3L P )P1}uPREtE}t=p u1E x @+M9vE8BtK9vE8Cu)ډU9sASQdE= t ST}t= t =| K1ً  EȉE9}4L 9v+9t5ƉU]GI9vU8Qu;}} 9v;Mu9t  ])ˡL P )‰)  = t QEPSu+p#u = P5$ v L = t P )9}tCEP 5P L +]SE= t5P U) x )Уx Ѕt}t5$ h&e 6Ee[^_(standard input)%d U WVS}u1$ h jWy}ƃ=p#t߅p#uP=, uGE PW#}t5p#W=E PWw(= uփ=, u7 t u-E PW|uU B %f=@tSW%느=$ E PWVTÃ} = t9= tt :P5$ hta Shh ؍)9 ut P5$ hta tt%V!tp#tPWT؍e[^_recursive directory loop%s: warning: %s: %s Memory exhaustedUWVS] EtJC9Buu = uH }tMQEPEh[^_ÐUsage: %s [OPTION]... PATTERN [FILE]... Try `%s --help' for more information. Usage: %s [OPTION]... PATTERN [FILE] ... Search for PATTERN in each FILE or standard input. Example: %s -i 'hello world' menu.h main.c Regexp selection and interpretation: -E, --extended-regexp PATTERN is an extended regular expression -F, --fixed-strings PATTERN is a set of newline-separated strings -G, --basic-regexp PATTERN is a basic regular expression -e, --regexp=PATTERN use PATTERN as a regular expression -f, --file=FILE obtain PATTERN from FILE -i, --ignore-case ignore case distinctions -w, --word-regexp force PATTERN to match only whole words -x, --line-regexp force PATTERN to match only whole lines -z, --null-data a data line ends in 0 byte, not newline Miscellaneous: -s, --no-messages suppress error messages -v, --invert-match select non-matching lines -V, --version print version information and exit --help display this help and exit --mmap use memory-mapped input if possible Output control: -b, --byte-offset print the byte offset with output lines -n, --line-number print line number with output lines -H, --with-filename print the filename for each match -h, --no-filename suppress the prefixing filename on output -q, --quiet, --silent suppress all normal output --binary-files=TYPE assume that binary files are TYPE TYPE is 'binary', 'text', or 'without-match'. -a, --text equivalent to --binary-files=text -I equivalent to --binary-files=without-match -d, --directories=ACTION how to handle directories ACTION is 'read', 'recurse', or 'skip'. -r, --recursive equivalent to --directories=recurse. -L, --files-without-match only print FILE names containing no match -l, --files-with-matches only print FILE names containing matches -c, --count only print a count of matching lines per FILE -Z, --null print 0 byte after FILE name Context control: -B, --before-context=NUM print NUM lines of leading context -A, --after-context=NUM print NUM lines of trailing context -C, --context[=NUM] print NUM (default 2) lines of output context unless overridden by -A or -B -NUM same as --context=NUM -U, --binary do not strip CR characters at EOL (MSDOS) -u, --unix-byte-offsets report offsets as if CRs were not there (MSDOS) `egrep' means `grep -E'. `fgrep' means `grep -F'. With no FILE, or when FILE is -, read standard input. If less than two FILEs given, assume -h. Exit status is 0 if match, 1 if no match, and 2 if trouble. Report bugs to . US]t25 hl h|*5 hl h|*t5 h;}EU| } @Ep a Qx   -x      x  |   t x ƿX u p \ƿX u p =ƿ{ u p jh | jRjhh| h\| h| h>| j = t j}t}u 5| GM?;U}%E UװIMj&5 Juh3} 6uURMQ0 СU)‰Ѓ~ = t}t  E9}bEU h ޿{ 1t 1҅tRX!EH ;E|h j)Eh$*zu5p#hya =( uEPRUUM :t9u B:u1ÐUWVS= EU99~|U+UE)9~5M)M~U ƐNuMM/:E~ME ֋Nu}U9U~9+   [^_POSIXLY_CORRECTUS]  h ( -u C1+u Ct   ؋]--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument UMytF5 =tOPM Dx-uE01h h|*}'M1M DP1h h|*} װэD UB Myu@;E}U  f=tM t1h< h|*S} װэD UB ?M9:: װэD }tMU EPUB }t-M x-t PEPu}=tMU x-u5 2h| h|*h|#5 PM 1h h|*C| ?  VEP 9ut:uR=t6= tVU 2h h|*{VM 1h׉ h|*{ã?wP8W;EEEE9t Q;Eu:=tVE 0h h|*({5?U:::M  5 5 Ft<=u]E"}u]E؉E EE؋ tI )PRQlu؉+ ;эA9u]U؉UE}tZ}uT=tM 41h< h|*3z װэD ?}:>taUzt F5 =tM1E 0h| h|*y װэD ?}Uzu{;E}M  ^=tU t2h< h|*Ky װэD ?U::: װэD }tM܋U EPt@ 1UB  W:x:u 8ua ` 8uH;Eu8=tPM 1h h|*Oxã?E8:u:U   Íe[^_ÐUjjjuu uUjuuuu uaÐUjuuuu u=U WVShHÃhhZ jjSC, C S)‰Ѓ }j SC C {9uK(CS !‰S K)ʋs)9~s C C{0thC0@C0@C0@ C0@C0@C0@C4C8ǃ<ED S 1e[^_memory exhaustedUWVSE@0EUUM Mm]DtMMU M]]ExEEEtWU:W tGU|ЊM:O sDE?Et]:_ uąUB J)ȃ}jR#]C C s9uK(UB‹MQ !‰Q I)ʋEX)9~UZ MA At|G]C S)‰Ѓ }j S MA A q9uI(]CS !‰S K)ʋ[)9~EX UB Bwu [G@GMHG@ G@GYCXG@EG G MM|)u UЋ8 UЋx}UuЋD*ЉӀx uNMM]ME<u 2H ]@ M>ʍuЋD)Љˀx tƃ}#|+uD+ЊP ɈH u"|+D+ЊP H t+ЊF tCV)‰9C~C[uv `G0p t"F@9F~FF9F~Fv u1ɋAvSG0p#Dt)1ɋAv%1ɋ1ҋAvDt(1ɋ1Av"1ɋAv1[^_U,WVSEU x4u ;}uMQ<PR诟p<}<]]KM@E UU9EGU)E;MA0A0хt`A0A0A0хt>A0A0A0хtA0A0;MvEA;Eu39UB8AuC9{)ڋE)؊8t9hM8A0E)9c]]mA0uAA;Eu59$U8AuC9)ڋE)؊8t9~)UE)9~1e[^_ÐU,WVSUMA495M<MM;uw9t>MƊU<t;urFNU<uc^M<}tK E K 8sRt!B 8utR:t]Uz;] w}uE)991UUE+EMQ89~UUEE)FU<us^Mta9}tK E K 8sRt&B 8utR:t ;]w]Uz;] w}MuE)9o}tU U EBUBMAE[^_ÐUVSuU E]~,u2Du)PRV…ttSF4C SPRV[e[^US]jSS&]UVSuM U]uu^EF JVf(F(t Qv$QӃÉ^uЍCFF FCf(e[^ÐU WVSuM U]}uu^EF JV~$N(F(t QWQӃÉ^uЍCFF FCf(e[^_ÐUWVSuFEFV )‰UU E|d9}F(t Wv$WFЃÅuЉ^ECFF@~IEH{EE|FDIy $URv$F S1ɍ{EE;M}FA;M|U9Vu!F(uUBCF(uRF А~}~ f(e[^_ÐUEU @t9s9r%ÐU WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CSt;e[^_U WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CSte[^_UE1ɋPt)Rumemory exhaustedUh|*h hah|*j 轮5UWSuB @1ҋ=p,ِDt B~? [_UE| | ÐSuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \),Hex D_alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitUlWVSEEEԋU UԋMIMEEEEhEu n*E Eu]s cCC{uJtj Pj }E8uu끐UB M M؉MċU;U#(]BU}t ËuЊ0EEr%$ ļ Ȭ ؼ E@U9t$}uWREPd(#UE)@R9&MA=vAuv6‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)@W9_E U;UMQ]SR'"%}G=vGEp0‹M9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰuE)@V9\} UE!}uE $!EE MJM}t EuЊ0E}*tdEu}+tX}?tRH}\uB;M BEJM}tEuЊ0E}+t }?HEEM+E}+t EÀ}?t ËU;UP}<#UE)؃R9#MA=vAuv6‰!9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)؃W9]}tUB]  EHƒ}t uF.9tp.uk}te;Us`}t}8}tMA 9t 6 u/]@u'E+E؃PuVj #E#]؃E)؃P}Wj#؉E"uF=vF}w7‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰEE)؃MQ9Z]S+EPuV}tP"EE} !UB=vBMq1‹u9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)؃W9ZEPjURj"EM؉Mȋu }G=vGEp0‹M9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰ŰuE)@V9\}G}3EE9EUE)؃"RMA=vAuv6‰9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)؃"Oʉ9YE؉Eȉ)@9,UB=vBMq1H‹uR9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)@W9\ME؋E8^uE8^u@EEE܋UE)@R9LMA=vAuv6h‰u9tDE)ЉE؋E)ЉEă}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)@W9_E @E؉1]؀{uutKU;UEJM}tE]ЊE䐐EtN}\uH;MBEU}t EUЊEEЊMM 낐U}]u E@9}t}-uK:]B}-u}tҡp,Du'}t t t}t*ҡp,D t؉уU}tҡp,DuE}tҡp,Du.}tҡp,Du}t*ҡp,Dt؃U}tҡp,DuE}tҡp,Du.}tҡp,Du}t*ҡp,DDt؃U}t;}u}t/ҡp,Dut؃UFZE=}tE萐HM}uEM؀I IEEEЊM]u؊Vt'F|uȋM؈At A|t]CÉ]@u } Ef}E%=E;EuuEEEكUh$@ H  T  U MAEU;Uu/PPu:EH]ۉ]EU}ċu+>E]؃}t+EP}WjE؉EU)؃R9MA=vAuv6ܿ‰9t:E)ЉE؃}t E)ЉE}t E)ЉEȃ}t E)‰Ű}E)؃W9gEEE؉E3U %= UB;Eu ;U }EX;EuMoEE}t EMЊEMEE}t EuЊ0EE< w&}}EEEDPЉEE;Eu},ulE;EtYEE}t)EUЊEE}t EuЊ0EE< w}1E|PЋE;EuÅ} }}|IA9}Mt4UB] ؈€]C$ЈCEAEEt뺐UBM Ȉ€]C$ЈC1e[^_USMU ]tA$ AEBEBaBB[ÐUEPuuuPu jjuU,WVSu] E@EURUMMM39} ;E~])}t#~< t < uGu }t(E@uPuvn};uUBE];u| E+E3;E| E)])EU }t6;]~X }9BM<uDK;]~=}8BM<t';]~"BM<uK;]~ B}<8t)]uB}t;u| +EUM }t%}8%E8tJ|;uu}t E@tGU(RM$QV}WEPURM Q}W tt~KFCNe[^_ÐUEPuuPu jju,ÐUu$u uuuuu uÐUWVSu$EEԉEЋURUEMIMȋ]Cx}EEEEEeEE$)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe}}}}}}}}uGEEEEEEEEE}EE9E;]s7 UE } E }  $C;]r׃}u } tE EUUE EM MM]]]艍p;u u uu}}uE)Ɖu}~U9UM MM܋]]uu})u܋EE؋U9UM9M}t]9] w p9v}9}8t E9E U9U}tQ}t+EM܉Mu9u }UMuC;]r}tLuH}}܋EE؋U 9r M9w]]ػ;]su}UMC;]r} ]CuWE@su P茡FP{F~}G$ GSuKE@U 9s@Pr M APq] C{u >t+F}8VE9Eu M+M E+EEpu= t }< uE P@Yu V}t9E w 9w+E +EE} W}tu9E w 9w+E }+EECE ;UvE9]]9sM QAC;rE+E]9]tu)u+]+] }G}ԃ$| h f | | H ( h ? ? ` ` ` h h $  E@Eԃ}tHU9UuM9Muu܉M9t}MԊAMG}܋u82KuA}9}uE9EUU܉E9tM܊uԊFuAM8uKuƒ}EEU9M @;Ev]9]uu9u(}}܉u9tE@ @u*}tUMȀ< ]܀; u~ }'}t}UȀ<uM܀9E@}EM]9u A;Mvo}ԀEE9EuU9U`MM܉U9t}t]uȊ0}܊ËM 9s %}T؃suEԍt0uԀ}E@}EMU9] A;Mvuԉu}u&WEPEP$ȈU ]tuE܁ t }UMu܋]4} $EE}uEEUԉUh] ut}E܁ t U]uU܋}M$E]9]uEE6MԃJuԊ6Mԃt ‹}ut‹]tuEEE}t EH9E;MEM1E<w <s< t .<u(EUBÍBE}t U𐐐UU:zy]Ԋ8Bku}+}tC$ C9s1U]u9rEAUS9rыUruZBÃUu+UO< D99sYǐP9 $)ĉPuR<E EEu+E9ruU9wuPU;Es+8tE;Es8uP@ЉE}uUu+EU+UJ< T99sZאP91$)ĉPuR蜠EMɉMu+E9ru]ԋE9w=MU}EMU}EMU}EF;uvċUEM EUEM EUEEUE]܉E uFÃuԐF;Es<w됐F;Es >uאE؉E;uu}GltUB ƅx t NxÀ{u"x8CtUBlSBMԃl<|C8xs$x%Txs]ԃl,uF }ԃl EÀ{u3FS9K%TȃC<ub1~Uԃl9}<~tC9}.VCA9}|tC9}TD Ѕt9unMAe}ԃl<uR1~9}5C9}-F"Cu%tِB;t}A9} D"Dt9tC9uE@lUԀztB pEUHMLX]\9rJUruED}UBEEDUUruED}I9sEE@ËUԍ\] ]+EU+UJ4 T19sZ֐P91$)ĉPuR蜜EMɉM]+E9ru]9wMU]EMU}EMU]EF;uvċUEu4EUEM EUEEUEEu^FÅ~K^u}GGTEX@tKUԈZZoEMAÃډUAÃMԈEXQ}t] 9]> u9u0}&}9}UJ;Uu EEH9u MQ ]S <‰u9uu }EH9Eu ]Cu<82}t} 9} E9E}U9UUJ;Uu MEH9u ]S uV <‰}9}u ]EH9Eu uF}<8E9EuMEH9Eu ]Su < A}t} 9} E9E}UJ;Uu UEH9u ]C uF<K}t} 9}uE9E}UJ;Uu MEH9u ]S uV < p}9}uUEH9Eu ]Cu<}9}+E9EuU9UMM܉U9t]9]u uEH9Eu }GU E@}EM]9u A;Mv}9}uE9EUU܉E9tM9Mu ]EH9Eu uF} t=E@}u EMU9w] A;MvEw觍EpuMTtU܍x}TUԍX]TUX]DE9rHUruED}UBEEDUUZ]EDuI;MsE}[}9}sTMԊ<w <s< t ?<u9E@Eu^@ÍD3Et 8 8} 9}_E9ESUUH}X[^_U WVS} uUE9<<BEZ@U)BEZ@ÍBE|tU3E|u&VUDPR|tiUډU:tEXPӃVRPJt7]'E#VWEPt U91e[^_ÐUVSE] uE9sC9tVSEP=u 1(AEQ@D EM9re[^ÐU WVS}uE@E$  d          EVu EPuʀ$Јuu1{EPExȉERUZ]JCBEuU Bˉ]Eu 땐E덐Ee[^_ÐUWVSM}u] t:CF88tIu1[^_ÐUEPʀPP5| u uIt@ ̧ 1UWVS}EtEܲE@@hJUBt]h,MAu 1ۉ}Exӡp,DtK ;CvUB}teMMI E`E$MQˆQQEP} эAPU RÃuu2Myt)QuEp跅UB؍e[^_ÐU u)PR5p t jPP9sF9r5p ߑt jPPe[^ÐU,WVS}x EE 9UUEEEPE)PS5p Ãu= t-9v U8S;EU8= مtt9vSp,Du`{_tZ;Msap,Du9_uMEPNVS5p [utt9vQp,Duy_uC;]18U)RURP3BuUEK9v{ u؍e[^_UMU ABuAUuu uE_block_table_block_countusage: %s [-n] [-v] [-s sec-per-track] [-h track-per-cyl] boot biosboot device U58h h|*"jHvnh:s:open: %sboot: %s proto: %s device: %s disklabel: %sbad disklabel magic=%0x8xdisklabel type unknownproto bootblock bad size=%ldproto bootblocks too bigstat: %s%s: Not a character deviceUnable to get BIOS geometry, must specify -h and -scan't read master boot recordbroken MBRusing MBR partition %d: type %d (0x%02x) offset %d (0x%x) no OpenBSD partitionwrite bootstrapULWVS]u a'DžDž  xntS htbstvtJT5#8 5#~8 8  wh VSCp+4L4 D T  h j= PRXƃ}5 h j6(= tK5 h h|*5 h h|*5 h) h|* PhedAV|t5 h5 j' =WEVtPhC j'fuh] 詧P5 %u jftPht j#'=~h joEPVa}5 h j&E%f= t5 h jo= t = DžDžEDžjjWPjS~  DžDžDžDž jjWPjS~ | = t = uh jnRV5 t j}zjuff f jjjVz|h WVy=wh j %f UtYh> jmK4QQhhB)PhL h|* % 9s{ t{t9r퍅 9rh jLm= uOjRPVy|!RV|x;th j$Vy1[^_nlist: %s: symbols not foundnlist: %s: wrong typeread: %sbad magic: 0x%xmalloc: %s: no memory%s: entry point %#x proto bootblock size %ld room for %d filesystem blocks at %#lx U,WVSuEh<V1tVh.6<=<txj 8ujV#ǃ}Vh qj EPW)w u~Utfff=u t RhjS]]jS E܃uVhzoSEPWv9tVhaYU ED UP  = tKuVhh|*E 0hh|* 5P5 hh|*yWvE80hK蝡%}tURm| WVv1e[^_%s: devread: lseek%s: devread: readU WVS}EjÉ VSW9v9u9tEPhj URu W@u;EtEPhj e[^_statfs: %sffsufs%s: must be on an FFS filesystem%s: bad magic: 0x%xfsync: %sfstat: %scross-device installsuperblockBad magic number in superblockBad inopb=%d in superblockNo memory for filesystem blockinodeNo blocks to loadWill load %d blocks of size %d each. Using disk geometry of %u sectors and %u heads. Too many blocksindirect block%s: %d entries total UWVSGtjjEPƃ }URh jPVvtMQhjbjhSwt+jhSvtEPhjfj xPVr tURhajfxtfff= u  tRMQhjfVtEPhjEPVXtURhj]@PM QWt5 hj-DžhDžlTpDždjjdP`PjhPu |4E}`}9thjeE)UXVqh h XAPh E PF 0\Tth,jeGxPhKjw0hTuhljdE1ƉG!ww1wxËO`3Odhw0XAPTPU RE1wxTPw0F<@<@PAQ DHRPDHRPL hjc= tVPhh|*UBft f tf u =8t MA, A8= t%EX8p,1SVhh|*zP( Dž\Py(LaEPG0} POdXBPSÉ+ y; ~hjb\L\ >t LuLOdPBXh-w0XAPTPU RT \;Ot>EPG0} POdXBPSÉ+ y; ~hja\L\;Ot}>t LuEPjjSËURjjS؋ + y  ; ~hjxa= tPMQh<h|*k1([^_%2d: %2d @(%d %d %d) (%d-%d) UWVSuE `uE `Ud1[du 1G ;E u1v,;V,1v8lj1v,J;V,rF,(UB d]C`1v8Ӊ1v,]Cʃ? ‰% f= t7C`DPRQCPWCP5hhh|*00hUB``R d)щʉd;E t.tVjjEPE] `Ed UdE ]dEe[^_r/etc/fbtab /dev/%o(null)%s: bad entry: %s:UWVSht hv >&h.j#VeBÃth VGrÉ߃jh Snufh jrÃtN;0uIPh Stt-t#%9uh jqÃu#؅u Phv h jYEPGPnuAh S(EPE PShv h jIqÃũPhVuP{[^_/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...UWVS} ӍCN"U |trEPRlt =p#tM QEPhQ"j訖URMQE Pl=p#U RMQhc">hE PVX@DVgà uU RMQhu"j%Dž)rr"1t tSֿ"t@QR*P?MQEPURQEP0SuƒxSj[^_RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s/dev/%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labelU WVS]PS}} Sh$%蚑%%= t =`t^hSS=E߰ъL ‰߰рaT ߰эAv^CPh'%h-%hS ߰ъL T‰߰рaT !} Sh3%tjV聿Ã}d=p#uCъ DjVLÃ}/} teVh$%'U} tNVh$%> WhedASod}$} tVhI%܏Sd1VSd 8v} tӃVh|%}Ð81Ҁ8t‰Ѝ[^_r/dev/%s%s%s%c%s%s%sUWVS]}tp#E(EtE(j/S:EtE PSƃlEtcmaPSEPh(h(hh  =w%E Ph 褽ƃt p#?}ubu]=p#uTSEPh(h"(hh 艞 =wE Ph 6ƅt p#?e[^_$Id: logwtmp.c,v 1.4 1999/08/17 09:13:13 millert Exp $/var/log/wtmpUVSjj h)谼ƃ|PVGugju]S9ju EP9juEP9EP1j$SV9a$tEURPVqVah[^$Id: logout.c,v 1.4 1998/07/13 02:11:13 millert Exp $/var/run/utmpU,WVSjjh*費ƃ} 11]e}t^jEPSduHjEPNjEP@EP8jjjVDaj$SV4`j$SV\`$tV`e[^_$Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $US]Aajhat S%`t4jS jS jS ~ S;`1]UEE@EjjURURjPc|EUEE@EjjURURjPCc|ETERMCAP/usr/share/misc/termcapTERMPATHHOME.termcap /usr/share/misc/termcap%s/%sUWVSE h,)Xx^thh,xtx:/h,Wt hPph,Wƒt2װэA =wh,Rh,So4hh,mhxRSa؉t6< t<:u"Bt< t<:tt9sB:uxt+xth|URj:EPxt2xt,@&| |t PTtCX[^_UEPu5 t EÐUj:u5 %ÐUVSUu EBEEEPEP5 MÃ|u6CE1e[^U WVS]1p,DtϐtBCDu4;.uCDtt0АCDu;*uCu PCEЃ;utO#fHf w@#EVƉљƅ~H#PEЃNe[^_OOPSUWVSuE E]u 0 <%t} sۋUBU PFMw$L1411111l311r3111221111111111X3111 41D41111111111111111111111111111111211113111121113u `u` ~jc~9} ZQ)ˆр0E@E)Á} !gfff)€0MAM} gfff))À0UBU+EE]} ] F9~FFt t u]}u =D#tN у [}tL#u 0D#Ph C t} >EEE ECS} MAM8gfff))Éڅ}S))F] װэD >xRUR e[^_UPС8uÐUSu1=t@:uÅt Kuh4]ÐU=0 u0 ULWVSEEU EUUMUM}} EE؉ËMمtIΉ]u}}$UE؉EMمtIMEUEUu}UU]u=9v Љ}u 1Ɖ؉ӋE9v1u׃u9w9ur됐ZE )U܉}ȉM }ȉߋMEEċMm ]ĉe؉uȉlj9wu;]vO1ɉ}ԉM؋UԋM؃}t؉ẺڅtJUЋŰMЉЉ[^_U\WVSE]u EUEU} E؉EڅtJU]u}}!E؉E܋UڅtJUU܋MUMMM؋}EEԉ]ЉuuN9v ؉#}u 1NjEUUEUЃ} EЉEEE9Ev]ȉE̋UȋM̉UM]ԃu;M9Mw9}rUE)UԉUEЃ}EЉEȋUU )މeԉ EԉUeEЉ EeЋEuԉUE;Uw uE9Ev M)UԉM}t3ME+EщMʉ ‰UȋEE̋EȋŰM؉Q}t%EUىM؅tHEċEUĉEUEU[^_U,WVSEU u}EUu99v }u 1ƋEUE;}v1x߃u9}w9ur琐ZE )]}M }}MEUM ЉEeulj9wu;]vO1ɉ}MEU[^_UE EEPhvtu OUEPhwt@uO|EUE tt -t%E/E#Ep#EPhtuNUjh^t uhNUUE B(1UUE B$1UE `` gPPUE@(UE@$$OpenBSD: swab.S,v 1.2 1996/08/19 08:13:24 tholo Exp $VWt$ |$L$tfffIutEffffffffffffffffffffffffIu_^$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $UWVS}@M Awt 8tAu)[^_$OpenBSD: strsignal.c,v 1.2 1996/08/19 08:34:25 tholo Exp $Uh8 uR$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $UE Mʁ`t[! tI tgu@t,jt@ t.Tt4tc6b.-&lspw?@tr-@}w-@ʁ@@t' t3t@t-xSs@ tr-@tw-@ʁt' t3tt-xSs@tr-@tw-@ʁt' t3tt-xTt@ @$OpenBSD: strlcat.c,v 1.2 1999/06/17 16:28:58 millert Exp $UWVS} EM€9trA9ts+u)uэD!?ttAJC;u)3[^_$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $Uu uDN$OpenBSD: system.c,v 1.3 1996/09/15 09:31:52 tholo Exp $sh-c/bin/shU,WVSEEBEBEEu Eh(HEmMÃttDEPGEPG5h#EPhBEjMjjpGǃjjbGƃjEPSÃEPoGWj8GVj-GtEe[^_$OpenBSD: realpath.c,v 1.4 1998/05/18 09:55:19 deraadt Exp $./U|WVS] 1jhDD}DfhuSGƃj/St7x9uDH9v8/t@؃P3K\߃EPWݡuiE%f=uhSWFXf=@uWJDWVhS 1Ҁ;/u {Ѐtd߰щыD@=vp#?VuhDSVS􋅜PI}p#,􋍜Q1F0p#􋽜WSI􋅜PFp#1x[^_$OpenBSD: rand.c,v 1.6 1998/12/07 21:47:22 millert Exp $UUimNA90%ÐUh ÐUE $OpenBSD: radixsort.c,v 1.3 1996/08/19 08:33:44 tholo Exp $U WVSMUu>19sߐ 8@9r0@=򐐈@=~1% ˅ttp#RSju u1[^_ÐU WVSU]u>19s @9r0@=򐐈@=~1%ׅttp#]} SWjE PMQ2>E P:ƃu!SWjE PVMQV:;1[^_ÐU<WVS] EU 9EZru}WEPVSURd ]u4=8 < u;sJ}U 8 z8 u;Mt; < } < 8 뮡8 @9v#uV}WEPSUR Dž}u8 uƉu< 8 8 ËE@9t~1;~ 2BB ʁ8 Ƌ4K8 BBGBGBGG};szËUu 009r8 ǂ8 ;r;M[^_ÐU<WVSuEU 97uwGEURMQPVuVx U=@ D U\9rUMU @ B@ u;Mt; D } D @ ;]s@ @9v%MQEPURVM QuV Dž}u @ ]É@ ]؉< D @ @ ~uƋE@:t ~%;~ OG -@ N5@ FFBFBFBB] U;] v;] wM \9r1Uu0r4B;] s׍9i[^_ÐUWVSUE HHEGE;}vtMWE4EÉEEUU9Ut&U:uAFU;Et:tU:sEUW;}wUEm[^_$OpenBSD: heapsort.c,v 1.2 1996/08/19 08:33:32 tholo Exp $U,WVS} }up#EP3Eu U+UUE EIM]EMAMGKuuu;u wJE};u sE8SWU҃}FMMEȉEPWU҃Ex}  ]ME ËU‹E HEBAKu]U ӋMыUڊBAKuMM E9wYE};usE8SWU҃}FMMM]MM<6BAKuu;uvuEE}NjEEEEtPEPU҃}]UBAKu]UBAKu뙐}MQ621e[^_$OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c U WVSu} ]= #u 88uS #49})88-uxt,H 8x-uB48Q8#8:tPSuK#-u 88u4=0;:R58hQjx:t#88uzr88uY4P49B8Q;:u:I=0t5#58hQh|*谸?#8Q4#e[^_$OpenBSD: bsearch.c,v 1.2 1996/08/19 08:33:26 tholo Exp $U WVS} ut4E8SEPU҃u~E<Nu1e[^_$OpenBSD: atol.c,v 1.2 1996/08/19 08:33:26 tholo Exp $Uj ju{$OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $U d#uH /y~.hM.u&Ad# d#QED A1Uu uh$*gUU u%PRu&Ujjju U$WUװщUAEEpUEMEEEEPh$* tЋ}UEPu uUVSu] C t{u"S1tp# 3CPSЅ} ;C| t  SVe[^UUBHJȅ|  RE$OpenBSD: auth_unix.c,v 1.11 1998/12/20 23:45:41 millert Exp $authunix_create: out of memory UWVSuj(,ǃh+ÃG _$x# x#K PS@CO WGCj8P78EEEE EEEuEEjhX4P@VEPVzu-DV@ЉƉsV)+C t/V4RP.6CGCGWMhVh|*ʳ1[^_ÐUWVShSt4E|6xVj=6Ã}1?~1҉ِIuWSxP|PPX[^_ÐUÐUEU @$JPRA ÐU,WVSE 8UZ$jppuVDCtP5*C{ WVbtC UCBCB/EWV3CUCBCBEPe[^_ÐULWVSEx$GU9Bu 1GEEjww]SnuVSEă t\jEPYEȉEEEjS@ЃVSȾEătUGBGBREVS莾Eԃxt S@ЋEče[^_ÐUVSu^$s(Ct P(v$(Ft P(Vs(e[^Ðauth_none.c - Fatal marshalling problemU,WVSu]~$jhGPSVS? tF PS+uh`[CS@ЉCxt S@Ѝe[^_U\WVS]̋EP BUȋH$M@tEut} }EE}URUM MϰыUL MM9Ms 8uv 5G7&UB9Eu RMAtB]S9Usu܀~ uGu(9EMA]Dy_9UuUD>_MA9EuAt69E]܊ uGuuMDa_Xu܋];sIFUDuG~_tA0EMuEP]M%=uEE}u(]9]@}uu9uE6MEBM%U=Xw,=H)w=8tH=P-=piw=h=xe]]CMÃ| u | E \)ˋE)9EE܋u~ ωىEPE @Mً]9t Eu9uʋE@EPURE@PMQuVEP U܋MD ]CU܋uTU܋E@FuwMAU܋u;uE@NuYu܋M4QEPE)@PURVMQ aU܋E@MMAu\3EPSQURMQuV P%=CK%Ë%=uK룐UBLUMU܋M+Q TEPURE@PMQuVEP<UBUML1mMATL UMU܋M+Q TT EPURE@PMQuVEPuUBUMTL 1e[^_UWVSE EEU;BtHMEMeEPhPURQM1*EEE uEUE;Pt  ME9EuUU11ۃ u M@uuE@u UX,} u M@u}u%E@uuNjUX0t+~)MQWQEPURM1YE Kځt"ҡp,Du)_t$}tUp,Du}_ut@%p,Du_u't}tEDu }_t{w!EPWPURMQE0E EMu4U9Ut,EMQURPMQEPU2WEE/UMQu1E@e[^_UWVSE@0EU UEM;QtBEEMeEPhPURQM1EE ]EUE;Pt M11 u U@uuMAu Up,} u M@u}u%E@uuNjUp0t)~'MQWQEPURM1E Nځtt|ӡp,Du)_t$}tUp,Du}_ut<Ëp,Du_u't}tEDu }_t{w!EPWPURMQE0\E UMsEEU9Ut1M9Mt)ERURPMQEPU2EEAEe[^_ÐUWVS]E EEeE9GURU𐐋MEсPw}(w/  8w0N@HxwB`fwX\hDp8<$wt`tp9EE}t }EE~E}E}Eq}kE\сUJ}FE"A4E%#E Éց}#U ӨM)uEMe#E É#E#E É#E#uEEMTсt&}UEEсuދM >#E ÉсEȋU%=t#E #E EMɉME9E[^_ÐU\WVS]ȋEP BUċH$M@tEut} }EE}URUM MϰыUL MM9Ms uv 5G7&UB9Eu RMAtB]S9Usu܀~ uGu(9EMA]Dy_9UuUD>_MA9EuAt69E]܊ uGuuMDa_Xu܋];sIFUDuG~_tA0EMuEP]M%=uEE}u(]9]@}uu9uE6MEBM%U=Xw,=H)w=8tH=P-=piw=h=xe]]CMÃ| u | E \)ˋE)9EE܋u~ ωىEPE @Mً]9t Eu9uʋE@EPURE@PMQuVEP U܋MD ]CU܋uTU܋E@FuwMAU܋u;uE@NuYu܋M4QEPE)@PURVMQ aU܋E@MMAu\3EPSQURMQuV P%=CK%Ë%=uK룐UBLUMU܋M+Q TEPURE@PMQuVEP<UBUML1mMATL UMU܋M+Q TT EPURE@PMQuVEPuUBUMTL 1e[^_U,WVSEX(P,U@0EU UEE;PtRUUpjSEShSURPE0ËU,pSEP EUUEUE;PtEEދ}J1t uEE11} uBu}uE@ur,} uBu}u E@uur0t'~%SWSUREPU2à Nށt#}Up,Du*}_t$}tUp,Du}_u}t>Ep,Du}_u't}tEDu }_t{wSWSEPURE0à U<u_E9EtWUpSEP& UpEPS SUREPUREPU2E UEPE<u1E@e[^_U,WVSEX(P4U@0EU UEE;PtRUUpjS EShSURPE0E0uEEU;BtUE1U u@uuUBu Ex,} u@u}u'E@u}uEUx0t*~(SEPSUREPU2]à Oہ}t"ҡp,Du+_t&}tUp,Du}_uEtC%p,Du_u*}t}tEDu }_tEE{w SEPSUREPU2à E<tUUUދ}Ht[U9UtSpSEP UpEPSv SUREPUREPU2E Ee[^_ÐUWVSuE EËU9}WE %=Pwx=(mw/=== r=8w=0<R=@=H24=xw;=`tw=Xs =h=p=w=P==tU=tf9E_}t }EzE~j&}ZEK}BUT3})EUJ}E"AE3Dρ) 2 22M)}]3T3T03EtyELϋE %=uU0B3EDEȋ}W%=tU0 3DECU9U%[^_ÐU WVSE} u]UH 8eu9EuA(t1y w%uRSVWQRSVWQ3e[^_*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%xU?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNULUWVSuE$EtU tMA;E s +} } эyhSÃu D@FPF FuS ^U ׉~FFMCPEUUe~ VH1 IyCCCC MKC(C,C0C<C@CDC4EC8}1@CHjhVOFHC }thV*Ut V_hhV jhVNIK$SVSVJSVSVCLECDUBZ eC(tjV~t MQ2Fh[^_UWVS]EsS;Cs<|t;E u9sujS;Csy8|ut@}t"VC)@PhxSDuEC+EPhSCPU)PWS{jhSG}u%C)PWSC+EPhSye[^_ÐU WVSu1FECX$ttttttttttttttttttttttttttttttttttttttttttttttttt$0tttttttttttttttttttttttttttttPܗF9rjVFF@DFXD  V FShhV;Fs8)tj)V  VHFShpVd;Fs <)jVjhV,FH(F@,jh VFH(F@0jVaj VQF@t Vqjh(V_VsRF9rjV';Fsp,Dtj VPVN9uC<v-?t({^B9SRp,D?tj Vp+ *t?{URF)@PhHVF+EPhPV EPF+E@PhXVF+EPh`URF)@PhHVF+EPhPkEPF+E@PhxVqF+EPhVF+EPURVjhVjFHPVjhV VNj;FsG8,uBPPp,Dt%VÃ9~j V SWEPV;Fs 8}u@FV9s8}tыB9s z}uF9rj Vj VN9s5C<v!?t{u"B9sRp,Dt j VBe[^_ÐUS]C9rjSPS C9r]U WVS]CE1;Cs98^u4@jhSDCH(C@,VSj1K9sB9s;E uB;Eu΅t#Kjh SCH(C@0E9Cu jSDe[^_UWVSuFE8\u"F9rjV 8)h..te*[t({tt91!}F@tV jh(VvVej V9SF@DFXD  V FShhVN9s"B9s :\uz)tj)j\V  VHFShpVDN9sB9s:\uz)u jV jV} ЉEFHE<t:]]UWVSEP EMB;As&jhRujh4EBM;As4jhRujhuVU;BsI8^u @EM;As0]u@WP]G]-u@MWP-G-MIWuVN9sB]tB9sـ-uԀz]u΀-uBEWP-G-M;As<]tjuVG Ex'@@t_XKxCӋ"Gt3p,Dt'Sȃ9tщUWuOKy tWEP }tjUBpNx.ۋ Gt ˆ (O ˆ GNyӋUB@tG B G tWMQ> WuVF uWV PVAWV  WEP Ph0UR e[^_U WVS]} s19s-t[uA9sQj #:t=;CrjS-t]ujSyWSlC9rjSWK9sB9s::u z]j;CrjS-t]ujSWSC9rjSK9sB9s:=uz]u jSSEK9s<8-u7P9s0x]t*x-uE-S{E EEE:E~ j S+Mu9ы_OA9~e[^_ÐUWVSE0X]9s. p,DtЍZ};Us @Du}) tSVP<u<u݅ujEPs^_щUu Ruu N Cu݋_;t*S} WEPc߰ˀ;u׍e[^_ÐUVS] j=uƉҋK Ce[^ÐUS]C9rjSC9sB;Cs:[uz.u Fj.S=EK9sB9s:.uz]u jSEE]U WVSE0x9sAF9s;E u~]t(MB9sB9sB;E uy]u9rjMQH) = t%WV3\u<t!;u݃tjEP1 Ce[^_ÐUMѡp,Dt u lDPU WVS]E 3{UUSEE]ES]3{e[^_U WVSu] Fx8@t1ӡp,Dt"SU9tSVy'PhV<;u FP4;@4e[^_U WVS]3{EUSE^@ @]@S3{e[^_ÐU WVS]u {{}~}uU}~B}uB M$|̩ةةة44444?PԪ444444)){iVC)@PhxS)EPjFPSC)PhSC)PVSjhSjCHPSjhVC)@PhxSC)PhSUC)PVSEjhS5jCHPS%jhSGPFPS‹EHPjWVC)@PhHS-C)PhPSBWVSe‹EHPWVSQ‹MQEHPRS jS e[^_ÐUUzuE B B 1ÐUWVSUBH M@ RBEMA9EA}zuPsPr9‹MAPUBxuW>‹MAPNWp‹MAP1Ƀ;M}+1EPZȅ}AEB3A;M|؋UBxt@tMQj)PbEj EPMQurE}MJ)EMFFFF e[^_ÐU WVSu UBP UPUx19sˋF (^C9rE9u UBH [^_ÐUWVSu FEUBP HʉU@E9szE8CuT9tP1;}sD"C‹"F1Шu*G;}s!ҋ"C"F1Ȩt;}t;]r;]sVURދUB+pe[^_ÐUVSE] @H19s3[„0t B9r1[^ÐUWVSE} @@E119s7GEŠM 0tCB;Ur[^_ÐU WVS] uCEыU CS u Pt PR>u+C t PC j uP!C VUDPXMSC De[^_ÐUÐUÐUVS]S B}Bu 1ҋC9}<t  BC9|1[^ÐUWVS}W B}BE EEE1ɋW9}uu8t1AW9|[^_ÐUWVSEU z8xusFE<>uWVU RtCE @4EU B4>])<;uSVE P0tU;C~ًu~e[^_ÐU WVS]{u+u t;CPSZS ECЋM MQRPse[^_US]{u1C9C|@@PSSC M M C]ÐUWVS}_uu WG ]G E_HUUE]u;E|@uu;E|@IyكG+EPW MPD PG Uue[^_UEM xuP % EÐUVS]u 9s}/Ps uj S C se[^ÐUVS]u CFCPs Fuj SC Fe[^U WVSE} x1ۋO%=XtAw=t,=Htpa=ptdw =ht[L=xtAuqCA %=`t=t=uI=u;_@~u_@1ہ[G@ta@PG=W+=hh|*{N#}QURQ}QURQ}QURQcjSP t+5p#腃PU2hh|*M ot;jSQ6uFjSj u+􋅠Pi􋕤RYtM1^t􋅤P􋕘R1􋍠Qh[^_0U,WVSu}1EEEPEPh.u\*tKuJ1>]܅t&VEPM Qss  tʋ[uۃu`Je[^_ÐUEEEEEEEuuu jEPr/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than ownerU|WVSDž}uhh*1ۅt>EPURE PURS uS%1]S==$u }*DžEP2@rV:h!V uǃ􋅜phVFÃW1URV$}*dE%f=t ?NPCP蜯} X)Et;Bt mEt=#Sx[^_ÐUE EEEEEEuujEPuÐUWVSDžhS6Fي<#8< t[< tW< tS9p,D(t DPA< t< t< t 9r9< t< ukA4A tǀ u9r9ϊ< t6< t2< t.5p,DA< t< t < t 9r9GU?t߰эA=<+uuCt<@t\uURE P_1RjPCPVCP<-Ct <@t WuURE P1tQRjPCP.V/CPURE PLSURE P3ƃ<+uRBt<@t5PURjPUƒ@Pm<-u\BtH<@u'PURjPgUڃF@PEP1҅u' REPƒЅtt~3~.~ ~1'REP赁Ã[^_U,WVSuƅj!jjhSu V  }FEEDžPEPh.u"t} CitLƅj!jjhWss uWPdt[uB1[^_Ðrcmd: address %s not listed for host %sU,WVSu}  ƅjjjhSWV (j!jjhSWV FDžDžDžPPh.h 4!trA tLƅj!jjhWss uWPt[u@u PQhjx@1[^_%x.0.%x%02xUWVSEffE] }EffPhLh 9h ƍFE } u9s C;u9r9uf}hOVY9HPChRS>tF>uPhVV!99rփEP:ƃf}tEPhRV8FP e[^_ÐUVS11ۋM9 B5$zzzzzzzzzuuuuuuppppppA9t uHA[^ULWVS}j1u ]SEj#S茗ƃ tE#=j.EPnƃj:EP^ tt9s E:E.tF    BCBCjSEPt<EPVt@jh P}jh Vj CGCGe[^_%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dULWVSuEEEEE̍UU]MMčEEȀ>-tGRSQPURhQǃ ~%EPU RWMQhhsEEPURSMQEPURhMQǃ -EPURSMQEPURhMQuǃ ~'EPU RWMQhhEPURMQhEP'ǃ ~QEf%EEf%EEf%EURM QWEPhhvUBM9xFKZ$EN0EEN>}tEEM/M}u<0uEEEEքt E؊Fu}uE}~EMIVUUU)zUM؍tE̍\9vSURV;]wSMQEPtURM QWEPhUR e[^_ÐUWVS}U~;111r;M}E~C} A;M|M ~19}EA9|[^_UWVS}] U ‰UE1HPE @PoE @B< w ƒЉELJw E8B<w ɉE%uu<vw G w$HxdjPHGCXC*E U BEECUU1EEEECEUC ;]U BD(ˆЋU B)Ӊ]ve[^_UWVS}( WtGEEtRSGPlGÀt:C;usI}t E.CF~ЃC   C;ur( e[^_UWVS}i E1ۃjhh mB< w ƒЉE7B<w E%B<w ɉEuGwK$ .<(Pt``EFUU-EEE1ۊEF] UF } @ȉ(ˆh h e[^_ÐUWVSE X<A9s7'C.A~Ѓ0A2 2A9r [^_%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%uUEf%PEPEPEPEPE PE PEffPhhs-sULWVS}j1u ]SEj#S贍ƃ tE#=j.EP薍ƃj:EP膍 tt9s E:E.tF BCBCjSEPt<EPVt@jh P}jh Vj CGCGe[^_%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dULWVSuEEEEE̍UU]MMčEEȀ>-tGRSQPURhQǃ ~%EPU RWMQhhsEEPURSMQEPURhMQʾǃ -EPURSMQEPURhMQ蝾ǃ ~'EPU RWMQhhEPURMQhEPOǃ ~QEf%EEf%EEf%EURM QWEPhhvUBM9xFKZ$EN0EEN>}tEEM/M}u<0uEEEEքt E؊Fu}uE}~EMIVUUU)zUM؍tE̍\9vSURV辻;]wSMQEP蜻URM QWEPhUR e[^_ÐUWVS}U~;111r;M}E~C} A;M|M ~19}EA9|[^_UEU w =w =w ffUEff|%t%%U WVS}5$#j#^;tW3Ѵt%;uƅtW6謴u=$#uSe[^_UVSu5$#[Åt9su=$#u؍e[^U,WVSƅME AfЉAf ˃ u4At#QS@X\ODž  DžƅhVPBƅ C C ƒus unhVSRMQUǃ V0 x?;s7hVSRMQTǃ |V>&}t }t"   ƅ11ۊN.tGC?.uu0u tnƅڅtSR…tPRP蠄t D SQsaGRPs   t#1[^_bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpaU,WVS`#uHuE PURIjSh#^ujhSJDžVE PURu'<1[^_ÐUWVS`#u"FuEPjSh#\ujhSb1Ή};7u%WtGt9Su9tEEE8}ȋCtt UUuI}uu{uC} WSEߋu󥐋}E=!ߋuuK9tFC}W9tGtC uV9tFtu}C{u UBtC{ u MAtC }uEPu VSEP} WEPSE}j}tUBtEt@uEM9Eu}u EE=ߋuuu9Cs}O9tGtC }W9t}}GtjtubutK{ u UBtC EPM QuVSE}}}tUBtEt@uMM9'EtE}ut u1%EEt P%}Ex[^_fbfUWVS}E1EPWt1`#u9ujh](j]Sh#P}ujhSu1ۅuhE}t[u I߰щ9~ SR)}u't}E9tavAR蔓PMQ臓Pj蕓PEPhj%e0.t QPIt1RQhj%ututu.ǰыʉ)}u]u E EuuJRPSAuJtt@txu牍 蛊u~9s tIuMQuEPRuMQt#Et#1x[^_ÐUlWVS] 1󫍽󫍽󫍽Ct tDžDžDžDžDžDžDDžDžDžDžDžƃPuv}1tSVL tGttut)SPtG[^_r/etc/hostsUuhThVI PÐUtP茠# U< WVS=u8hThVIu1P 5h P艙t8#t΃hPAÃthRAÃtCtt< t< uC2ރhVAÃtCVMQbDtDu9}u EPEPjPt-U tMQSR[uԋ[^_ÐU,WVSu }1]Ct[t{uVEP"uEe[^_ÐU\WVSEEE}EEEj URdcƒt BU EhMQ@ƒu}1}]Bt80< t'< t#}uUhR?ƒt Btűu ESEPjEP"u/]t/U tMQSR[u EEtUBtMIMtyu}t EEEe[^_hosts.bynameipnodes.bynameU\WVS1}EE= uh 6u1* t P" U Bt ]]Sh }эAPURh5 ; uL}u EEP5 tUBtMIMtyuSh }эAPURh,5 y; u5M Q5 tt}uE PjWP=}tUt#'}tt#}t t#e[^_%s.%sUWVS]u `#u!u t#uL߰эywZt'y<.uWSQ\Ƅ/VN߰҉эD =vt#(VSh9P%uQ[^_no errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid errorUE $l               8nAf\^VNF8>P6x.&  : UVS]ދ[Ft PsyVgyu؍e[^LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGCU WVS2u,=X uh hzX t X 8u X }} u}eE8 XP VS 9~E 8E4y߅t8u5yt8uh yt8u jP] PW }E E4Byt8u jPVWƃ  E}~B}t*jE P] P?Wƃ j/E PVƃu9 P jE PSVƆ  9~E~/u F~/t~E +] ~SE PW EVEƀ Eu >/u E E 8/tE Ft%G}?~E  ]Ȉ3_ }G}7~E ] \E}/~EE}}؋EEe BU !]!}p!P!EU1ۋMEtG@  X    XE E C~EEE}dEUԉU]؉]E"E!E!E!}}uu1ۋM` Et't 8   8 T AC~Ƌ}}uu1ۋE؉EU)UMٍCÅUt- t<   < T ~EEEEE}]܉]E8 }\G}~1Ex} EЋE@!1ۉGUЁ Et X BC~}~E~[^_ÐUVSu;54 t754 0 1۹t Iy0 [^ÐU\WVSE}u %}~E E!]E@!E!EmUUP! T!X! %E\! MM M`! UU d! ME %h! }e M M܋l! }M䋹p! t! x!u |!M ! ! !u !m)0 EĐUUMMEuNu% % % % % ‰% ‰ ‰ ‰1#]ĉ؋u31uE31ڃE !!@! D!  ! H!0! L!3]}߃m}]UUEE؋MMme!u !MmeE !eMM ! ! ! !}ȋE !}؋!} !U !} ! ! ! !UM !1[^_ÐUWVSu} =uuDE]VSMffffuEPEPRQQEffEEffCUGȍe[^_ÐU\WVS]=uF ffSff t; "u ;" ""EMme!E !Mmeu䋶! ɁM! UmEE؋! ˉ! %! ҁ! ]}싟!} !u䋶! }! u؋! ! ˋ! Ë! Ӊ]EEU:EMMԋMeԺ)ʋE Eԋ]]ЋMeЉ؉ Eи+EE̋]]ȋ]uԉum e!} !umeU !eMMľ! 1}Љ}me!M   ! !euu! >uȿ 7@!}̉7"u "} ""u "] ; " ""} 7Uȹ!!ủE}1[^_UWVSM]11ҍ~$At B~~ՃSe[^_U,WVS=ujwU1EE1D=1ۉ$Bt X D)C~F~у} tPEPEPpuWE1}}1ۍFE}4 ؉#X‹}8C~u~ȋEe[^_U\WVSD%#@%#"""4"DE1ۋEƍ"ڃ ؃ ‰ :AC?~E}~1EPU EM@"E1ۋ}}EU"E NJE @"BC?~AE@E}?~E~E"""$}Ȉ>%G}?~E "dX"]Ȉ3"}G}7~EX"] \E}/~EE}}؋EEe BU @"]@"}@"@e"EU1ۋMEtG" $   "$E E C~EEE}dEUԉU]؉]E@#E@#E@"E@"}}uu1ۋM"Et't "  "T AC~Ƌ}}uu1ۋE؉EU)UMٍCÅUt-X"t"  "T ~EEEEE}]܉]E"}\G}~1Ex} EЋE@U"1ۉGUЁ"Et $ BC~}~E~[^_ÐUVSu;5"t75""1۹t Iy"[^ÐU\WVS]=u. ffSff t; @%#u ;D%# @%#D%#EMme@"E @"Mmeu䋶@" ɁM@" UmEE؋@" ˉ@" %@" ҁ@" ]}싟@"} @"u䋶@" }@" u؋@" @" ˋ@# Ë@# Ӊ]EEU:EMMԋMeԺ)ʋE Eԋ]]ЋMeЉ؉ Eи+EE̋]]ȋ]uԉum e@#} @#umeU @ #eMMľ@ # 1}Љ}me@ #M   @# @#euu@# >uȿ@"7"}̉7@#u @#} @#@#u @#] ; @# @!#@##} 7Uȹ""ủE}1[^_U\WVSE}u %}~E@"E"]E"E"EmUU@e" @i"@m" %E@q" MM M@u" UU @y" ME %@}" }e M M܋@" }M䋹@" @" @"u @"M @" @" @"u @"m)"EĐUUMMEuNu% % % % % ‰% ‰ ‰ ‰1#]ĉ؋u31uE31ڃE @"@%"@U" @Y" @5" @]"@E" @a"3]}߃m}]UUEE؋MMme@"u @"MmeE @"eMM @" @" @" @"}ȋE @"}؋@"} @"U @"} @" @" @" @"UM @"1[^_ÐUWVSu} =uu`E]VSMffffuEPEPRQQEffEEffCUGȍe[^_ÐU,WVS]E 8$u,x1uPS4YU RSkD=u.}BtC)ȃvWE _qEUE1EM DNLP] ޿ftfuBRhPLu^FCF $<tr <t<tCCCCF uCfCCTT~ t 8aLP)\t2\@v@SVEPAF9XQhP4FT8[^_ÐU WVS}u 1CwVW8Ѓte[^_UVSjju腠Ã|u SƃS%Fe[^Up#jjlHu =p#uEPjjFUWVS}U uuFuFЀF EFF]t. 9siWt_f9sRBuH 9s5Wt+\uBu\J@f9sBufuVPzVP [^_ÐU WVSu} f>{u,f~}u%f~u0E4EPWVS0tj{SZ ÃuكWVe[^_ÐUWVSM] 9tf9uDžqf>tgf[u/f]tftf]tfuf>u*&f{u f}utf>uuf>uEPR U Dž9[t ,ti{tC}tFكf]tftf]tfuf;{tjtf;,tX~9sf9rFf ffuEPRUK9E1[^_HOMEU WVS} Ef8~E@ EtG]9s%UBA9sftf/u?u6AuhI;u.PtWuEBH9s9tffA9s9u9sffufe[^_UWVSE PhSURƋE ߃?*[!uf>tj]VRuf[!f[!uf!شff>-u^]tf-شf]uNjE H f]8U J f?)E H 9tf*tf*شffE PRunU ;u0B u %=uE PUR5<2U B u&hLj+PBBP51[^_UUE 02CÐUEf8tu PPP 1UlWVSu M}EffW]SEP.t1G tIf~/tBE%f=@t)f=u.WSEPEuE%f=@u f/fFGWEPwf/t(f}Efftf/uڃ}u,މf/#ff/t WRQVEPe[^_UWVSu }fp#WEPuEt7SUR5p#SGЅuG t 1DžDžܙG @Gvz.u Ef8.udfBf ^ftffBfuUREPVsuf WURSEPuR҉ƒnG @tPGR?[^_U WVS} GWtPR44 PO3ÅuGt P3Eu W~J|Iy_‹Ef8t fu+UR2ƃtVEPG4G1ue[^_U WVSu] ;]=?tX=*t=[tQ;]tEPSVt fu1fuꐐ1ftf;!%t,'f;-uf9w f;Kw f9uf]u9 놐f9tf>%e[^_U WVS}Wt6G4Ktt P1sw1e[^_.UVSEu f8uRfSPF @u P 8 PF Ѝ[^ÐU WVS} uSuF @uWS WSF$Ѝ[^_ÐU WVS} uSuXF @uWSm WSF(Ѝ[^_ÐUUM 9tfu1UMU BuUVSuxWÅt3VB=u؍e[^offonsecurelocalrtsctssoftcarmdmbufwindowUVS=d.#uu 1+-#5d.#hSCtуj S8u9d.#BHJȅ}RG tu뙐-#p,Dt CDuo<#g`.#-#SyÉ-#;u-#-#9SGÉ-#;u-#SÃ-#-#;jhSS:uSp,Dt %-#_jhSS:uSp,Dt -#+jhSST:uSp,Dt -#jhSS :uSp,Dt -#jhSS9uSp,Dt -#jhSS9uSp,Dt -#^jhSS9uSp,Dt -# .jhSSX9u.{=u(S-#SaÃ;W=`.##t;#uC t t-#;u -#j SN Åt-#e[^ÐUVSM1G t t u5`.#A t t uWA t t tAAt6"uu 9\uy"uACtу#u`.##C[^Uj=u t@1r/etc/ttysUd.#u!hWhWd.#u1P苫Ud.#u  PE%d.#/dev/tty ULWVSjh`XEĉEuEEEEuVPjc4]SEP u(Et!$ESjEP71}эAPEPEP[2h.#] .#sGjSEPn2uE< ujhiXEP 2tMEPjEP$7jEPj3}t EP2h.#e[^_US] =.#jjj75.#|1.#t2SP5.#5.#} .#1.#a.#t Pn).#BR.#P(.#tS5.#P4‰.#|R9.#v.#E.#]USjj h/#h趠Ãj S)p#u;tp#1]ÐUWS]u hG=uhX6#t*P6#}tƃEP$E뮐P6#tdT6#trEPEPEPEP5\6#Rh^5X6#Ã5T6##tT6#P6#EܣT6#E\6#EPEPh\6#hT6#h^5X6#Oà P6#d}EPEP}аэAPURh^5X6#(P6#MQ"Etu"cuVu-u" P6#1E0u5/#hVl6u 1u؃j VuC/#BHJȅ}R: u>+F<:tt< j,}uP6#X=X6#uhX6#7}t9EPEP}эAPURh^5X6#à HM Qh_]SˠEPEP߰эAPSh_5X6#AÃ0uVuuu E0u؃h_]SUh_SMAh_SÃ?}t=j EPSUԃ:9 UB8E MA'jt[h_EPRÃ}t}tURS -P6#CP?EЃh_]SM}t}tURP,Ch_SMAh_EPà j EPSUԃ9:UB}t}u ;E 1ۃ}E̋MA U̍9tNM؊<,ut/1#t< t< ut!uE؋E9ue[^_BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksUWVSEeheǃ?j EPW6uMtyu}MtXGt)t_iKt/akt' gt Rmt+IEe@UEeAEe-@ Wh!eP@9~jh7eP؃ށ*WhPePEe؃ ؃URPhmejh`6#`UvE `6#e[^_.UWVS] tp# j(ƃ EF U V$tV$MQ =vEPPVjhgVE\f@2EEU:MװэAPRVfC2USK@KF$PSVz fC4 fufC4}t EC]C}u]UZ]EEM9\}t}~EPURVs EjhgVt>MHf@4 F$ujjh g}F}N$>p#EPRUR vVt1e[^_ÐU WVSu F&fF$ǃGP^@SEp0)j/Sƒ t+9u{t!BװэyQRS(f~&UBFFF,B e[^_ÐU WVSut7f{2|"ڋCuCÃRf{2}߃SFt P? Ft PtvfF$u(v%1t=p#v!F$utV"=p# V 1e[^_..U WVS}G% wV8fF8ujVW fF4lN4ucAfwZjVW fF4fG$jjh g:{F }p#FfF4]N6TftG$@tCG 9C,t;C6ts GtP GfC4GtatW$P Gt=jSW tRp#CK6wt?F@Fvu*jWiGuG% o1wGvP6f~2uLG$tvI#t uw"VWF8ftfuVjVWfF4fu7G$u1jjh gpyF }p#FfF4N6fF8OFP$@|/uT /BF&@PF@PR;%pP4f~2uV!p#V$Gf~2u*G$t vxw!fF6tDG$u.v !tp#v /p#.v 'u G$uhj!t O% ~tfF47e[^_UUw E fP81p#ÐU WVS}] ttp#7p#G% F4f uFfGt P^u O%f~2uF8/tG$tSW\GMjjh g#wƃ|.SW0GV uVG1e[^_ÐUE$Ft>эQ9vӃ>uC[^_ÐUlWVSEu ]]@$t 1} jjvmÃ}lEPSt3E9F,uE9F(tp#S3ǃ5p#}} S5p#e[^_ : xxswufsswap ,rwrqroUWVS5x:#hhx6#u1htyPXhwyVQ:#t8#thwyj1:#hwyj‰:# zyC:#ֿ}y1t yty:#hwyj&j SP0;:=:#hwyjKj SV9:=:#:#6hyP:#8#hyj:#hyj:#hyj:#:#:#hyjMj SV9:=:#hyjtBj SPn;=:4,=!:#h5:#SEhySl pyǹ}yǹzyǹhyjtPuʸyǹtyǹ=:#1t jO[^_ÐU=x:#u t u1:#ÐUVSut-"V:#5:#tu 3u1e[^ÐUS]It.#S5:#-u :#u1]/etc/fstabrUhx:#tPȄuEPh~oguLE EtE%f=tp#O*h~h~x:#t 5p#:1ÐUx:#tPx:#fstab: : U4WE؈EE~E EEulj}IMEEjEPj] }UEPu usRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdxUWVSEE uEPEPן}1xhh:#蚿:#E܋M:#:#]܉D]؍uԉHuЉLủPuĉTuXu\u`uduhuluputuxu|u@uu9s=:#t1<|t-<:t)֐U܍BEA9sBt E܊<|t<:u܋EWhuEh:#hu0DPhu~uܿ" u :# u܅t, u :#j:h6uÝt :#Sh9u|tU؉:#HSh<uOEԣ:#LVh?u0EУ:#PPhBuẸ:#DShEu ~hP u'f:#(EPhEu輬1҃tUf:#TVhHu葬u:#:#Eģ:#XPhKuYu:#:#E:#\ShNu!tUf:#`VhQutUf:#dPhTuū1҃tUf:#hShWu蚫1҃tUf:#lVhZuo1҃tU:#pPh]uE1҃tU:#tSh`u tU,;#xVhcu tU0;#ffEhEifEkElfEnEofEqErfEtEE`4;#EaEEEEEE|V@Pu9u EEPEPu EC EPEPu1҃tUSt+EPEPu̩u E1sC C EPuVu衩tUS u0DPVu袥~h uC EEE}pfEf*;#ufEwE:#E0EEuV@Pu1҃tUE}4~:#WEV$;#WEVu:#([^_ÐU WVSu] ߃;t3Vźt;up,Du1) Ve[^_UWVS}E]Cjj}WjjS }t} tyu4ƃupjjWVjSǃ up#Vzp#9EHPVE PZUE DVFE@ p#1e[^_./UWS]t;u8<#A߰эT B9vz/u H9v8/t9u8/u8<#f8<#GJ9vz/u)ЍXwSRh8<#8<#p#?1e[_U(EUBEBB EPRj} }tEE$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $USU ]tEBEB4ES1tEPuuts]ÐUEPEPjuEÐUEPEPjuEÐUEP$OpenBSD: killpg.c,v 1.3 1997/07/25 20:29:58 mickey Exp $UEtu P p#$OpenBSD: creat.c,v 1.3 1997/07/25 20:29:57 mickey Exp $UE PhuAZ2̀ø1̀̀r̀r̀r<̀rt$̀r`9̀rL̀r8̀r$̀r̀r`̀rR̀rS̀r̀r̀r̀r̀rp8̀r\̀rH7̀r4̀r ̀r ̀r̀r̀r̀rj̀r ̀r̀rùrld̀rX'̀rDQ̀r0Òr/̀r̀r+̀r{̀r|̀r#̀r ̀r)̀r|̀rh̀rT"̀r@ ̀r,̀r$OpenBSD: sigsuspend.S,v 1.3 1998/11/20 11:18:30 d Exp $D$D$òr1$OpenBSD: Ovfork.S,v 1.3 1998/11/20 11:18:29 d Exp $YB̀rJ!p#U@WVUE ut} Mu$tt 6t-Vht,Vht, Vht,Rp#e^_$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $UWVS} Ep@A8t u됐)[^_$OpenBSD: __strsignal.c,v 1.5 1996/09/25 13:19:01 deraadt Exp $UVSM<@# ~(gfffK))0 у ޺gfff))0 [^libcUnknown signal: U WVS] jh;Eƃ}w2hE4PjVPSƃ^hh@hjVPSƃ߰Ѹ)PEPPS" V؍e[^_$OpenBSD: strtok.c,v 1.3 1999/11/09 11:19:46 art Exp $UhH@#u uÐUWVSE}u u1Z@M 9tAuu 12p@M A9uu1@ u֐[^_$OpenBSD: setenv.c,v 1.3 1998/02/02 22:44:53 millert Exp $UWVSu] ;=uC߰IMEPVpEtB}UװэA;EUCBUuO=h#EP@#?tE?ut)MPR!ǃ=h#EP@#}PǃtrEPW5h#=h#h#UDUu EMt<=u)u}UD:P‹E h#u[EEMFS E}Ft<=uE=@EMAMt}CG}u1e[^_ÐUVSu]Uh#BuSVuӍe[^U1ÐUdW}fE}}эAEEEDEEEPu EP)}UWVSEu }EލEX]EEEPutt +]1e[^_UVSu~(up#tVF ujjjvF(Ѓu uGFPVTN t!N)ڃ~0t&N<)tt +Nڍe[^ÐUuKU WVSu ,1@)U)ZSWEPiU~EENEUZE89vSj W迦uU)ZSWEP])ރt&UZuR;tE9E\UEe[^_USE8eupX ti;EuaCt PCt PCt PC$5p#XPSh h|*ohvjWEe[^_$OpenBSD: rresvport.c,v 1.5 2000/01/26 03:43:20 deraadt Exp $UjuÐU WVShV8} t } t#ƅ%ƅp#.E FjjU RNÃ} yUff:PVS}K=p#0ufE FVSƃuSMf%U؍[^_UE| uHEUB=whP#RVSƋE>#tj#VÃt5pT#hVɚÃhC}C< t< thS藚ƃtFj WS6U9: =xT#T#tT#Džt@;t9< t+< t'U#shSÃt Ct;upT#e[^_r/etc/networksUU#uhPhR臠U# P]E \#UU#tPU#\# UWVS=U#uhPhRU#tEP5U#Eu1mEU| uHEUB=wU#R}WSEEE8#tj#PÃtU Y#װэA=vƂhʦEP肘Ã9C0Y#C< t< thʦSOEtES,Y#(Y#5$Y#}tW]R< tJ< tFY#s$߰эA=vƃhʦSΗÃtCtu Y#e[^_UlWVSEEEEfEEEEEEEjjuVjj]S 0uEԃjjVEPjS } URMԉMЋE‰E9xEUxPA tf<AtKA fEE˃TyTtAT$U܍TUECM؍LM؋EUfEf}E‹Mf9A tf}UBփEEu1RG1%t>t Xuʉ]u1U%Et.t Xuu EE]G~UUЋEE9EEEE؃uMEP-E+EU܍EPEuMQpEEȉډUU܉USjQkEȉEfEUԉUЃ^MЀy@A *AA fE‰˃TUĉŰMJUЋBMĉAC\PREP]CUCDEEMĉA UBTPSMQ) EЀxTtBT$EEMAȃxfErf}fU‹Ef9P tf}FMA9ŰBMĉABAAuЃEu1MG5%UЅBt>t XuƉ]u1%UЅB>t XttktKcEMĉA SVPFMUĉJ>uEPjQGUU&SVMQUEĉPSVR]GJEMĉEċU‰UЋEE9MQEE9ErUMEUR{1e[^_ÐUu_gethostby*.getanswer: asked for "%s", got "%s"-_/UVSu?C<v5C<v.C< v'Ph蚴u.u>.u1 Fue[^Ðgethostby*.getanswer: asked for "%s %s %s", got type "%s"ULWVSDžEZ#UM } t }t}UBfȉBf[#u ftt#RQVPURڂà |ut#wt}t}u1ӋZ#)EDž[#[# Z#DžXZ#XZ#[#DžDž;VRMQ؁à *}ރVφVЉV諆؃}t }[#hQVPURà gQMދӋډ)؉;PR JZ#؉} hRVQEPà iROދ;-PYIډ)[;}tCWfPMQYPjgPEPhj%7ރ0} t"}}RgtMQVPUR~à |udރu Z#-[#s)5Z#|t%5Z#hTj%ރ;Z#usu(Z#װʉ)P)‰=_#r ]Z#ruA=SRVĉ)ރu~;s #t&~}uQhXZ#Z#=Z#uG};\EP*FZ#؉)a# tPPVt# t#1[^_ÐUVSuhD`#u_qujV )a# tjV4ÃujV ÃhnD؍e[^bfUWVSu`#upuE PVm } t } t*DžGDž3t#p#/1Jt#18U Z#Z#j.VuVtp,D>~.h_#VE PohVh[#`\#Dž\#DžZ#Z#[#Z#[#[#XZ#_#\Z#[#XZ#a# tPPSY t#Du9.uA9uy.!DDtj:VGu >:>~.h_#VU RWhVh[#H\#Dž\#DžZ#Z#[#Z#[#[#XZ#_#\Z#[#XZ#t#"p,DDu <:t<.uA9uy.;jSh#ujhS聩1%PЃPhS}FÃNy١  @CjRh#AujhP蟦DžDžT#tj#VwÃth%VAÃdCh_#Vj~EWh_#Vja# t$h_#h_#rE E9Z#Z#;EXZ#_#\Z#[#XZ#Z#[#C< t< tZ#Z#փh%SEÃt@Ct:2< t+< t'[#sh%SÃt Ctua# t}EEPEPhZ#t#Z#e[^_ÐUS]a# tjSu jS]ÐU WVS}j#^;tW31t-;u%ƅtE 9FuW6ue[^_ÐU WVS} u=Z#5Z#jcÅt9suWEPC0fun؍e[^_ UWVSuZ#[#XZ#Z#Z#EXZ#EY#[#Z#Eh%VA}Ãu=Z#1CUEERUVbuC< t< tރhV|Ãt; uECZ#u 5Z#!VP6t [#s7ރ}48< t3< t/< "[#sh%S]|ÃtCtuEZ#e[^_%u.%u.%u.%uhosts.byaddrUWVS]1=Z#uhZ#su 1CPCPCPPh]S> LZ#t PLZ#EPhLZ#߰эAPSh5Z# y u5LZ#ƅu t#e[^_hosts.bynameU WVS]1߰эA=w=Z#uhZ#ru1vPZ#t PBPZ#EPhPZ#߰эAPSh5Z#6x u5PZ#ƅu t#e[^_ÐUVSu j]Su8yع FIyFFjVPye[^ÐU WVSEu }xucx u]@@ X;tGȃ)B9} *щ)63N;ue[^_ÐUqÐUlWVSEU1E 9E1#؍?EMGEBE9s/##9#t]Ӻ#F;us #B9uEf4}u~ Dy9}}}U;} |}t_} 9}}WuNE@E|;uL+f9A~%yfAf9}T__D__NyҋEE} 9|[^_./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345UWVSMuE <l$0ˆA9~|F(tq$<ÈA9s^~| F(|(~| F(t \[^_%2.2u$U WVS]} uE$C2CaC$PhijCPVWSe[^_ÐU VSEE11ۍu𐐐u*È0fCfv}wEEPjVh0`#_0`#e[^OrpheanBeholderScryDoubtUWVS] C;2RC<$tw'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? GyUPWV}^_ÐUWVSu 1ɋEf9r1‹}8 fBvEf[^_U,WVSEfE1UUMMUUMMˉǐEPWU Rw1fFfvfEEE1]쐐MQEPUR`ƋUUTffv11Ffu MQuVEP׍ Eu1TE2ffvufve[^_ÐU}эAPUR8Q8P0R޽}эy~(~P0RV˼EEEE}эYt-tj0R jMQViuփ5hH`#  `# `#UE E ƒjRQ `# `#UE E ƒjRQ`#`#UjRP`#P`#@EEEE4[^_%s: US] 58h8h|*tuSh|*h=h|*u貛Ujuu uCUjjujC92(#|gTJ@3 xbLUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0UVSu>u1FjΌÃt.VtC1Se[^ÐUVSut&V3u  [u1e[^UVS5t!^6裌V蚌 ޅue[^U WVS`#8e#`e#`#tI:tDce#װQSRG=`#˃VtB:t=װQSRVGX~˃ @FBF B FBB0VtB:t=װQSRFX~˃ @VtE:t@װQSRFX~˃@V t1:t,װQSR5FX @ V$P$a#0a#e[^_: UWVS}M EMEE9tUZ]<:uEzuMh1EPXJh1]]SBJGh1S1Jƃ&j ]SVKU9 :Gh1EPIƃj SV4KU9:G } h1EPIGh1EPvIƃ toj SVyIU9tY:uT=M=~FGh1EP0Iƃt)j SV3IU9t:u== G$G0GG$h1]SHGh1]SHGh1SHG th=t @tG0a#u @G0a#u @ G @tG@tG@ tG 1e[^_master.passwd.bynamepasswd.bynameU$a#EPEPEPEP5,a#R tR5(a#CÃ5$a#܆t5$a# a#Et P豆EE$a#E,a#oEPEPh,a#h$a#rtR5(a#T;à + a#EPEPEPtu Uc:ZEPEPװэAPRtR5(a#?à u|7EPEPװэAPRtR5(a#? a#5KtEP&|uh8a#u@uE 8a#ERh`#^-`#3a#E2j]EPha#$@]ԍE@P> =t`#+u^Pt@t$ a#9 a#P a#`#@P{o-8PZ@uOPsu}]Et8t P[VWS u@P21e[^___YP!+U0VSE&uFE1j]EPh,>]]Ca#jEPVRB Ѓta#jURSP@ Ѕt1e[^U VS66ơt9`#u 95`#=(a#u'h(a#7u`#`#aEPEPEPEPh5(a#m7 u*u[`#5`#`#5`#1e[^ÐU,WVS=a#u5 u 1hsEa#I`#+t-_=(a#uh(a#5`#@t <@tN-$a#tPj$a#h,a#h$a#}эAPMQ-$a#tP"$a#}u`#PEPEPEP7E܃uE:Ut:th,a#h$a#װэAPRtR5(a#: $a#t Pd$a#$a#tP>$a#`#BUh,a#h$a#װэAPRtR5(a#: t%$a#t P$a#+5,a#h8a#5$a##;8a#,a#Rh`# 5`#ftpPtb@uPP}u]Et8t PWVSeu@PMQ`#5`#u==a#ua#P@a# }^a#=a#t;E2j]EPha#9]E@P t=a#ua#P@a#[1E1}֍F~11P]EPEPX9]EpPsÃ=a#ua#P@a#1t`#e[^_%umaster.passwd.byuidpasswd.byuidULWVS=a#u}u 1pEEPh&]Sa#Q`#+t-w=(a#uh(a#*1 F`#@t <@tfE$a#tP|$a#h,a#h$a#}эAPEPh=K)A$a#tP:|$a#}u`#PEPEPEPOEȃuE*U܅t:th,a#h$a#װэAPRtR5(a#5 $a#t P|{$a#$a#tPV{$a#`#BU܃h,a#h$a#װэAPRtR5(a#05 t%$a#t Pz$a#5,a#h8a#5$a#;68a#,a#Rh`## 5`#~tpPtb@uPPu}܍]E܅t8t PVWS}u@PE9`#u@=a#ua#P@a#`#}na#=a#t;E2j]EPha#5]ЍE@P+ l=a#ua#P@a#1gE3EẼj]EPEP4]ЍE@Pà =a#ua#P@a#1t`#e[^_ÐUEa#a# a#$a#t Px$a#ÐUjÐUa#a#tP@a# a#$a#t Px$a#;/etc/pwd.db/etc/spwd.db%s: %mUS a#+ t jjjjSa# t '=`#uSh j[`#1]ÐUWVSa#j]SuP@ Ѓ߅t 1BuG;`#vK`#P5`#Qwu&`#t Pv`#1`#`#`#FCu`#FCujh`#V2jh`#V1jh`#V1`#FCua#FCua#FCua#FCujh a#V1+E9Gvjha#Vr1 a#e[^_$OpenBSD: getnetgrent.c,v 1.8 1998/08/14 21:39:28 deraadt Exp $*netgroup: %mUSj tÃuhj(CCjPtuhj(؋]ÐUS]SB9CuEBCP3Suu(t PthjE(KE C]ÐUVSu} t1;^s4tC;^r6|tVste[^U WVSu} 1;^s$W4^uC;^r1e[^_U WVSE8t.ӡp,Du uGtDu tt<;E t4ӡp,Du# tFt;E tDu uEt=;E tKp,Du} uCt;E t%Du t;E tE1YCE)Fu ~;VrÃuhj&E PWS}E D1ۋEe[^_UVSujOrÃuhj/&Sj,V~tXCPj,Vht0CPj)VRt3Ct P\rt PJrS>r1e[^netgroup: db getnetgroupnetgroup.byusernetgroup.byhostU,WVSE=8i#} ֍^S>qNJEGVU RPF|}MY 8i#jEPQRB Ѓt Nt9GWkquM hj$h{W'q}tv}2t  }1t )}3tEE EEPEP} эAPU RMQEP*u 1e[^_netgroup: Syntax error `%s'U WVS]} 8#t)PHtѡp,Du tދ3(u=S4Uu3h譣t*PHtѡp,Du uދ9tD)XS"ouhj#SVPzD>1e[^_netgroup: Cycle in group `%s'UWVS]SE PtSoShW豢SE Pj1EPSEP txEE}u]WVS=ttO吃t/t؃un3EP E벐uE PEP-똍e[^_U WVSUu }]ttRPG{u5tCtVP+{utCtWP{t1e[^_ÐU,WVS]}uSE PQtSmShWO)SE Pgj1EPSEP EEEEEEEEEPEPEP ԃtsuuVWEPËEt PlE@t PlE@t Plul`&VWEPuE PEP 8uluql1e[^_%s.%sU WVS}u EPkÃuhjЅt>tPЅt?tPhIEPS؍e[^_(%s,%s,%s)UUBuPBuPuPhu u覯U WVS] Ut߰эqtװ)FPRSuEPWu@ÃW-k1tEe[^_ ,U WVS]}t-WSEPEPVƃuKWSjEP@ƃ1u0WjEPEP"ƃuWjjEP ƃtq} эy<9t{,u<tPhJuCVSj!E PS_ÃuV-j1e[^_ÐUaB t Pi@t Pi@t Pi5iu8i#tP@8i#/etc/netgroup.db+USE=t5=8i#u!jjjjh%臄8i# tj1EPh6j!uEPV uhuFuhjPPSujS]ÐUt8EPE PE@ 1UWVS} ]uE=8i#u2jjjjh%聃8i# uEPi3j1EPh6j uEP?ug t u1j3VW t$j2VSEPu t Au8ƃjSWEPPVuÃjV1e[^_/UWVSE E}t$Eup#EEEPfEuWME/)xxPEPEPR"pPfEyp#"#ExxHEx@EEPeptpE.p@]ShPEEEEp#EEPpPd}]9]u 9}E;tr5EEPpPfpEEtE.@.@EpP=lEEPE0fSE/@EDž|9]u&EPL{ƃk9>uEP({ƃG~.u~ tۋF%=.t̃F@PEPFP> EPpP t$|u p#|p#y9]o9}fF]+]}t @9~ f9\}x+}EEPEP}dEÉ]ExW)SEPw]}u ME/F)EPEPFPJEP:oE E=p#u|p#u p#}tEPtcptpPYc}t EPn1X[^_UWS]u-Di#t PcDi#@i#1V߰эA@i#QYbDi#tHi#SPq1p# e[_ÐUVSu ]Ut!B<:uAB:uu9uߊ<@u1&:ut<:ulj9uB1:@t[^ÐUjjuju EPu %s.dbtcUlWVS]} ~ jDž}Di#twURPuc@i#P$aƃ5Di#V@Dž@i#Hh`ƃDž;EDž}|(jjjURiDž#1h!hSƤjjjjS{0EPPR}QAЃrVO`Ӎ{S_ƃSVjP@Ѓ sU :M1ojj0EDž+B u*9y\IB9ri))ˁSVk_u8t V^p# :EPig)9-hQEPfÃtURgEDžAuR<#EPV6o} tVU R QDžuB9u#V]-@'DžoÍPMAt C:uC)jQPMQPRWNj tZ})tURteV\Ru DžuC:CDž+tC<:u+){:t :+9)񉍬))򉕨)񉍤SVY\uBt V[p# tEP[d.񉍴+PSRQPR*[Cj=h!PxytMQc)HU 9v1PV![ut VZp# %ƋM1u1VZڐ[^_UWVSu}}эEIHÍ} @EOIKjWSVF Ѓtt &UЀ:t‹E J:%e[^_ÐUVSu M󐐊u<|t<:tu 1(CA8tIt<:u A<|u뽐[^UVSu] SVOe[^ULi#tPsLi#Ti#Hi#Pi#1rUWVS=Ti#uE Ti#=Li#u&h*Ti#0JLi#3Di#t=Hi#uHi#'P5Li#ÃujLi#ta@ @PsTi#PTi#xu1h*pLi#\DuPi#/p,Du<:t <#t =Pi#t|\uPi#| \u%Pi##P;r6Pi#FBt<:t<\u1tg:F򐐃P5Li#Ãu.Li#t%@ @wPqLi#닐Dx΍ABt<|t<:ujjVjU RSEPÍC w7C[^_ÐUWVSj=u uÃu jdUEup# }EdU :^u$\wC :A<w81BEMI|CNt  6 . & :C CBMIMuG+uFdPURTu} EPSTEEd<:tt<^C<:tB+EX}t4PURTTu}EPSEEU؍e[^_ÐU WVSj=u u ǃu jd SÃup# Ed؊:tMtIG@Mu3)ރFdPSSutS*S뱉Edр:tu@)؍p}t*PSNSupSRbËEe[^_ÐUVSj#u uu s90uA:tF>:u^FPu_^e[^UVSUփ}t Azu$)ĉE $ED$tABu5h#Sue[^ÐUVSUփ}t Azu$)ĉE $ED$tABu2Sue[^ÐUVSUփ}t Azu$)ĉE $ED$tABuSue[^ÐU5h#u uPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shU<WVSDž}AE85j/EPr/tEDž,h-33QƒuD3װэA$)ĉRPp:u3װэq}эy7=vRDž3DžDž3DžjPjsVVSR# /WDPEP D 5h#E PPbp#=$h5677777`677776777777677777777777777777777777777777777777777777661ҋM E 8t BE <u$)ĉ$3D$PCPQ5h#Sh3TDžh3P ƒqt p# =p#u p#[^_UEPu uZ̀rZ̀rZ̀rZ̀rZ̀rtZ;̀r`ZZ̀r$OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $US]=@#uEPut@#h@#{t1]$OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callUt:эA@w$} tU :tװэA@v UM]EUUЃMQVt U$]EuUŰM J}UB`@M؋]SQ]Sh0MQhjr`Љǃ t1Eԃ}th8Ep`E@hUuǃEU@PIMu %U2uPTMMEU@PHMu#U2uPSMMSh0@ue[^_$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $US]=@#uhh@#t @#1]$OpenBSD: ypmatch_cache.c,v 1.7 1998/01/20 18:40:27 deraadt Exp $UWVSu]EPXi#Et%EU9B|M Mt 9A}}u@jKGE}}1҉Xi#t}EXi#UBtPGMA}G tPbGG SFUBt+MQF}G uwGG1EXUPSu pQMquq Q }t-VwSt1wFVGVUBzEMAe[^_ÐU WVS=Xi#upS ESE[EPXi#t?E9Cu.EPs-Sus} MuC9E~u1e[^_yp_match: clnt_callUtOэA@w9} t3U :t+װэA@w}t}t }~ 4UMEEЃURVυt Vh@#*REPEPMQEPU Rw thEM@PRDUuu蟋M1uP?OEMuj1X$EEuU UMMEEEEE}G`HE؋URP]ShEPh@jw`Љǃ t.Eԃ}th=Ep`E@hu ǃEU@P6CMu aU2uP/NMMVh@#P u*E0U2MQEPU R* uSh(:u e[^_yp_next: clnt_callULWVSuEtN>tIэA@w3} t-U :t%װэA@w}t }~ U ME$UM؉MȃEPVt Y$UEu܋M MUUMM}}؋G`HEЋURP]Sh0EPh@jw`Љǃ t/Ẽ}th@Ep`E@hOuǃEU@PAMu %U2uPLMMEU$@P@M u#U$2uPKM M$Sh07ue[^_$OpenBSD: fork.S,v 1.2 1996/08/19 08:13:32 tholo Exp $ ÒrJ!$OpenBSD: strrchr.S,v 1.2 1996/08/19 08:13:22 tholo Exp $$OpenBSD: rindex.S,v 1.2 1996/08/19 08:13:10 tholo Exp $ST$L$ 18uBu[$OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $UWVS}u11Ɛ@M A9uu1@ u֐[^_$OpenBSD: strlcpy.c,v 1.4 1999/05/01 18:56:41 millert Exp $UWVS} u]tNtBCtIuutBu)B[^_$OpenBSD: bcmp.S,v 1.2 1996/08/19 08:12:52 tholo Exp $WV|$ t$1L$u L$t@^_$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $U,WVS}]p,E CDu-u EE+u Ctu0utt}uEPUREPU RjWP9}t Et#$}tt#}t t#e[^_%.*s.%.*sU WVS]} `#u u t#uH߰эyt.<.u(w WPSƄ/)#WhShhZP蠧 uuuuV [^_HOSTALIASESrUWVSa#h[^)0zrh[SǃWjWN| uHB=RSV10ـp,DuC;Dt;EPQ;up p,CDu;tus{tCDuʐF>t DthSh`i#q`m#W@`i#+PWÃW@1[^_UlWVS}$u(`#u{u t# j Wf#ffE$WˆW`#$ˆWg_ }Em} }t`}VMEPEEPVSu a *)ƃSEPSEEP fG}}EPEPVSEP ÃSj GSEP7SjASjfG E 9|nG _ SEP_SEP_Sj_SEP_ }tEPSEP]fG )؍e[^_rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%dUUB=$adecececececececccededeeeeeeeeeeede(dee4d@deeeeeeeeeLdeeeXdeddeeeeeeepd|ddeeeeeeededeeeeeeedeeeeeeedeeeedddddeeee eeee ee(ee0ee8ee@eeHeeeeeeeeeePeeeXeeeeeeee`eeeeeeeeeeeeeeeeehepeeeeeeeexe___________~`r`f `Z`N`B`6"`*'`.`5`_:`A`F`M`U`_`h`m`v```y`q`i`a`Y`Q`I`A`9`1`)`!`Rh`hhm#詝hm#icmpigmpggpsttcpuclegpigpnvp-IIpupchaosudpUUB$e0f8f@ffHfPfXf`fhffpfxffffffeqeieaeYeQeIeAe9e1e)e!eRh`hm#虜m#ÐU WVS]##}Eft ttu EP+Nx_=#ttURMQS Ã,PS$\S%\ +E;E 1Ny#t t3t.UBHJȅ| 1EPj 貚؍e[^_Uh$*u;; res options: %sU WVS}u hgV3uX#_tSB%PhgV uߋFPVЅ|  Vj e[^_Ð;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed UWVSu`#u蛾] EE #MQt utdMf%P4DA4hThV FPVЅ|  Vj #tt.FHNȅ};F| ;Vj;ݗ#t hhV莡E@thhVtUBthhVZMAthhV@E@thhV&UBthhV MA@thhVE@ thhVؠUBthhV辠#ttMAf%PhhV莠 UBf%PhhVo MAf%PhhVP UB f%PhhV1#t t&FHNȅ|  Vj )UBfm#tthhVɟOH#tthhV衟;#ttVM QEPSÃ0hPSRMQ qÅg;K#tt&S%PPhhV0; #tt&S%PmPhiV蹞0#tt(FPVЅ|  Vj 譔O;hiVj MAPSE PQà tt;w\hiVj@UBPSM QRà tE;w-h4iVhUB PSM QR|à thLiVҝh^iV[^_ÐUu huÐU WVSU ]hVEPEPRǃ }1Iu/CPSЅ};C| .Sj.Q SV莙E[^_ÐUuhu uS.U WVS]EPSEPEPu lƅ|!߰эQt|.t;M|13ofEe[^_UVShVhu unà tuV赘1[^ %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) UWVS}`#ugut#1hShE PWFǃ tЃURQ膖W(WWÃWЉ$#ttShoMQ螙#ttV-PhoEPv (RPhoMQU (Hen$r|t(uHH(uw(u(u(uHP(upu,~Dy{,~DyypuDy|H4tyH|}HHH}HD}HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH~  t j,PW$u ,/PhouV{ $,/ƃGW%PSVhoEP  P$BUBHJȅ};B| u EPj URM QS $>EPhp 7G 9Phpt5UBHJȅ};B| u\EPj\NGMApq} ;A| t MuVR ~9aUBHJȅ};B|u"EPj"Ƌ9 7GURhp 9Phpt5MApq};A| U\MQj\:GuFHNȅ} ;F| t uEPR ~9aUBHJȅu;BlEPj"踊 (  URhpސh4pMQU uFPVЅ};F| M uVj FEPU RWǃMApq};A|U MQj uVE PW6ǃTURhXp W{ÃSh\pMQtW[ÃSPShmpuVMW4ÃSPShpV)$WÃSnPShpV$WÃSJPShpV0& W裾%PhpEP軒URM QLWs%PhpuV苒VE PWǃUBHJȅ};B|u EPj fURM Q$>EPhp肎7G 9Phpt5UBHJȅ};B| u\EPj\ƇGMApq} ;A| t MuVR苇 ~9aUBHJȅ};B|u"l EPj":S UBHJȅ};B| u EPj $:9 MApq};A| U"MQj"躆7G 9Phpt5uFPVЅ};F| M\uVj\JGMApq} ;A| t MuVR ~9aUBHJȅ};B|u"EPj"…9UBHJȅ};B| u EPj 膅9jW$Rf!PhoMQuVWzA$<WָPhpEP׌ $ j,PWPRP,#%PhpUR}G11ۃ0$ 9 G }quURhp覈MQVP腈UBHJȅ};B|U MQj K  Fk; SUBHJȅ};B|u)EPj)袁UBHJȅ};B| u EPj jW%PhpURPGhqMQPGhquV h`P$)PW'Dž  9 }o ?uh qMQ耊 MAxy} ;A| t M}WRk 9 |hqEP}hqURMQ 5W賵V\ PhgEP,PGhqUR諉7GQ 9tPVh4quV{W_ƃ9tVhqEPTW2PPhXqUR-,WPhPhgMQ ,Wδ%Ph_quVVE PWYh`R$)PW%Dž 9 }q ?uh q}Wh MAxy} ;A| t M}WRS~ 9 |hqEP}hqURMQj (VhdqEP輇$UBHJȅ|  uVj }+;$t$WPhtqEPa1[^_Ð("ANYHESIODHSCHAOSIN}z\Y=7($  ݊؊ Ԋ  rlXUFB=:'! މщȉĉtREA84Ԉ !o"jNI/*чdexft]#WB<"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressAU WVS]} u{t)sWdu t {uׅte[^_ÐUSEU ]xt;ut@, xuRh`hm#wtm#]USEU ]xt;ut@, xuRh`hm#vtm#]Ujuh,0ÐUjuh̄initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?UE w(towtXt[t_tb=tuw@t^=t_=tiw =tXn=t]cތqiaYQ IA9!1()/!9PhChm#um#0 secss%d day%s%d hour%s%d min%s%d sec%sUWVS]u(m#>>m#CfACA55pщ))É]ˉ))É]Ӊ%t֍v)ǻm#t&FuEPVhHStC;ut0t CFuEPWhQSsC;u}t6ut CF}uEPEPh[SsC;u}uu$PPPP)U)‹E)ЍU48+u)U)‹E)Ѝ)1C2$ГU E  U Ap,DuADtDt ADuE[^_ÐU\WVS]EEEEEEEE]߰э| EP]SEEPSƃ UMu-uu UUu }u}u ]]u 1E8-u E@EE8+u@EU p,]]m]m]m]]m]m]mDt"]DBЉEEUDuU:.uGBEB p,Dt0BEEUDtUTЉUE]UE܉ÁÀU p,Du?]m]m9sBEDu9rEp,Dt:U]m]m9$ p,BEDt9r9}UR1EكU p, BEDu9rEp,Dt*U9 p,BEDt9r9}UREۃU p, BEDu9rEp,Dt&U9s3 p,BEDt9r9}sURAEڋE UوPUۈPUڈPUPÜPUԈPUPUPUȈP UЈP UP UP UĈP PXe[^_?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smU0uEF#tj#VEÃt5Xu#hrV ƃgF< t< thuVߘÃ=Cj EPVwU9: =f%`u#du#hu#\u#ƃhrSgÃtBCt<4< t+< t'u#shrS1Ãt CtuXu#e[^ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=U,WVSu1} UFMFEEFE À0 ÀE ÊE? À?vU?vM?vz?viG;E<Ê4MGE䊀4GE4G4G}  } EEE1ҍGE;U sM FB;U rUÀM0 ÀE À?v?vU?vzE9EwPú4]GG} u= EUGM=G;}s ][^_ÐU WVSu11F=ѡp,D =&Qh4膸ƒ!tL ttw} t;}4(ˆU O} t);M-4] 4(ˆD;ϻZO} t);M-4] 4(ˆD;ϻ} t;}sM4(ˆЋU G1Ftѡp,Du==u~Ft~t=p|lgt"p,DtFt Du=uFtp,DtFu} t] <t뙐ue[^_UE@@#Eg@@ܺ@ vT2ÐUWVS}UBREU΃?}EEUEUEUEUMAQ@)9rPD1SU RP*EPMQ E PEP@C?9r11)ߋMT1E ؃WPRe[^_ÐUWVS} GW1OMMY?˃7w 8x)ƒRhHWjSW}t#UGBGBG B 1e[^_ÐU\WVSEEURUMIME@ E}u U#UE#E UExjUЉE#U#E UċM V EM!‰#E UȋM p $EM!‰#E ŰM νEM!‰#E UЋM |EM!‰#E UԋM *ƇG EM!‰#E U؋M F0EM!‰#E U܋M FEM!‰#E UM ؘiEM!‰#E UM D EM!‰#E UM [EM!‰#E UM \EM!‰#E UM "kEM!‰#E UM q EM!‰MUE#E UM CyEM!‰Ӊ#E UM !IEM#EU!U EEċMb%EM!#] E؋U@@ ʉU#UE! UM QZ^&EM#UE#E UM ǶEM#UE#E UԋM ]/EM#UE#E UM SD EM#UE#E UM EM#UE#E UЋM EM#UE#E UM !EM#UE#E UM 7 EM#UE#E ŰM EM#UE#E UM ZEEM#UE#E UM EM#UE#E UȋM EM#UE#E U܋M ogEM#UE#E UM L*EM3E3EEԋUB9ʉU13EEMq щM13EEU"amʉU13EEM 8щM13EEċUD꾤ʉU13EEЋMK щM13EE܋U`KʉU13EEMpщM13EEU~(ʉU13EEM' щM13EE̋U0ʉU13EE؋MщM13EEU9ʉU13EEM щM13EEU|ʉU13EEȋMeVщME 1EUD")ʉUE 1E܋M*C щME 1EU#ʉUE 1EԋM9щME 1EUY[eʉUE 1E̋M щME 1EU}ʉUE 1EċM]щME 1EUO~oʉUE 1EM, щME 1E؋UCʉUE 1EMNщME 1EЋU~SʉUE 1EM5: щME 1EȋU*ʉUE 1EMӆыEUJMJEB }1[^_%s: : %s UVS] 5p#58hضh|*Ut&uSh|*sVhݶh|*T V腊Phh|*TuUE PuUE PuG  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~UUlDPUEPu uXÐsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console U< WVSutVhȹj#i0p#u 5WDžVhRS  ;|)Wk2PhPSt ;| H) t=u8t25hRS ;|H)t3PhPSG ;|H)=t&~:C~  CL<%uRX))߉DžDžjPVV[^_ÐUtPu#/dev/logUWS=u/jjjjjP =tvu#um}fEjEjghǽ]EP`EjjS5à u5 u#x[_UEUtE tutu#ÐU5Du#ÐUUtUE EUBEjjEPujRmt1$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $UVSu] SV~tCPV1e[^$OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $UVSu] SV ~t%C PVttCPV1e[^$OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $UVSu] SV tCPV@1e[^$OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $UVSu] SV~t%CPVtCPV1e[^$OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $UE hPPu5$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $Uj@u u6$OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $UE hPPu}$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $UE wz$h`pXpPH@0,81E >6. & $OpenBSD: yp_bind.c,v 1.10 1999/08/17 09:13:13 millert Exp $/var/run/ypbind.lock/var/yp/binding%s/%s.%dclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDU\WVSDžDžjh"Ãu jSYyu =p##t SΐSfơ(tW9tS8#t:Q`tBR@ЃW蛾u8#5(} t E }tu (8# t!Pu(uUjlzu 1҉߉󫋅@\PhDžzhjuhhhSjSD ÃjSwƃ=p##DžDž jPS2w‹9tStph!SWSG|􋕸R蘼hAh@UDžDžDžƅƅDžDžjjPjhPAà u3h>P􋽸Wf%= ffu1CS@Ѓv􋅸P蒻b$DžCQRRh>MQh?jSЉƒ tTt tuhh|*CCS@ЋGh=CS@ЃQf%= ffu#􋅸P蛺kBHBLBPBTBHBIAfBJQLfAXAhj@uȃP5GD$$DžP`tBR@ЃB\Ѓ\PRPjhHPΞB` u"h.MAhjjw\gu h=9t8#8#} t M 91[^_US]C`PPBC`C\]UjuyÐU WVS}18#tLCPWu0C`PPBЃt8#S耸 ދue[^_$OpenBSD: strftime.c,v 1.6 2000/04/16 16:24:04 d Exp $FB>:62.*&" 6|sjaROL4%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%cU WVSu]EEPE <0WVSEuJPc9u} tE D1)e[^_?%02d%2d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%YU\WVSE8 U:% EMy $0 804\TX\@\DM EPURM Aw P Eu EPURM Aw P EuC EPURM A w Pa Eu EPURM A w P% EuEPURhE HlQ)SEuMQEPURM Q5$~E uFE8QFURMQEPU Rha?E uMQEPhU r EuMQEPhU r EuMQEPhU rEuMQEPhU Z*)R)R9u QtEuNURMQhU B@PJEu$MQEPhU r$EuMQEPhU Z*)R)R9u QEuURMQhE pEuURMQhU B@P~EuXMQEPhEu5URMQE x ~,(PYEuURMQEPU RhE uMQEPURM QhE uEPURhM 1Eu}ԋu EP^$Ph]S.EPURSEu1MQEPURM Qhj+E uEPURh;EuMQEPhU BZ)ù$Iэ )PEuMQEPhU BuPEuhM)ٸ$IӍ)@7M ylAEQUM MuFU9]}Ou>Q)ڍ9u)ٍ9u EnEmu=Q)ڍ9u)ٍ9u EnEmEM)$I)))Y$ImM)Ѝ))щ)ȃ}E9EG4u U ztuM y u5}VuURMQhPK}gu6EURMQhQ)) URMQhWEEPURMQE PhwE uQURMQhU BJtX)˺$I )X$I)QEuMQEPhU rEuMQEPURM Q5E uEEPEPURM Q5 E }uEEċuFU;KDMEPURhE HlQ))QEuURMQhU BlPEuM A(t"URMQPEuU B w%MQUR4EugMQEPhEuDURMQEPU R50>E uM9MtUMAMFu>#Ee[^_UWVS}uuu ]S+)VWSe[^_USMU ]B9s Au[GMTUS]1ɀ;}1Ґ B~[UWVSv#~$T}#B2L#4Iu1ɋv#9}3{#9P}#T}#L#2A9|[^_../etc/localtime/usr/share/zoneinfo/U,#WVS]tRtE;:u'j/Su,hSc u;/tj.Sԇt1ۅu ;:uC;/ЉDž҉эD =PVQ h)VdSVdj.S t DžtjSajS ǃdhSWƃW蛯  PPxPcU POM AP:U B P%M A $ 92@I5)U zr29t 9t ))ƍIBM A 919}.] PIFU ;r|1M ;q}1ʁCM ;A7F;q|1] ;s}jLPCBCBM ;A FE ;p|1M LU ;r } ʐCFE ;p |1U ;2}GӁLQ-PC FU ;2|1] K9}FځLtB Av]B F] K9|19}@U LtBAv 벐BF] ;s|1[^_ÐmnUMAtƒЃ v,t -t+u߉ÐUVS]ut= Ѓ w01ҐTP9C Ѓ v;U| E 1[^ÐUVSu hj]SutUU)9:uCAj;jSQ^t%E+E9:uAjEPVƃtpE PhÃt U >uȃVƉuM)M}v$t+<,t'<;t#EPVƃuHEEЀ>u t<,t<;}F]SVƃtF<,u]SVfƃt>uU BBMىLǂPE@TMى`ǂdǂh׃ցEEEuԍEPURMQuЍEPURMQ 9~FFFEEu<Q])ڍ9Eu)ٍ9EuEMh)EE}1.GE1ۋUBUE H9}]E Pƃ<2uE LډU+C9}&E <0uU L؉EE19}cE E Pƃ<2tE LډU.C9}&E <0tU L؉E19M Mu PEЉEUԉU1M EM PM E M\u)1tE Xu E+EE+EM D9M Lڃ<0tUUCE ;XuMًU LǂPǂTE؉`ǂdMhB>EE @@UډLǀPǀTMAMUE P }tMċUD M A E x ] LURMQSy]C}tEPURSdyM1x[^_US]ShHtjShHu]U=#|5#hv#jpthv#ÐUhhTZUWSh7Ãu i=#~Sh#聥߰эA=%#tSh#;u=v#v#L}#T}#hHhL#?hv#SRt,;:tjhv#Sthv#Vfe[_ÐUhMhCÐU WVSEEv#Ot;G}1ҍuP}#8t<B;W|1/u9};v#|v#B9};}{#LEPW3VSEP CLUB(e[^_UVS]u hqVjS(h[e[^ÐUjj,hȴ#h?tPu1UVSu ]h =Ĵ#uĴ#h#h Sh#Vut C( C(,#e[^ÐUS] Sjul؋]ÐUjj,hȴ#ho tPu1Uhȴ#u uȴ#U,WVSuEEIEPL9|k@Eu[Eu U;T~E}t6LPE~!I:@9;u 2@93t؋MMIy] E.‰<)׍))E +EyOQxGQų )‹]S)))‰S))M O$I)))ȉC}CE)EE}HEU+Uҍ4UJUy]QmE)))ƋMIMy]QmE)))))MMO1]u9Q)ڍ9Eu)ٍ9Eu;EEe؉EȋEE‰ŰEEẺEȋUEUU:BUEЉEԉ%UԊDttOtOɉ;}+}t}~ ]U]} tE}tEHU EUe[^_ULWVSEEp,UЋ5l=pѐUEBUDu-uEEBUE}+u UUE}t}u*}0u$ExtXuURUEE}uE }0uEu}}tdhEUUӉVSEURPY8E܉UU܉UVSEURP5EU}t}~U)UEU]11EEEEءdhEȉU̡lpEUċp,U}}tp9}u9uw;uu+;}u&E9E~Euȋ}p#"EEӋEËEËU։)Ήf;}u;uw;uu';}u"E9E~Eu}p#"/EEӋEËEËU։ߋUEBUEEEUЊDtEtMtMɉME9E} tE}tEHU e[^_UVSu] CCC t{u$Sgtp# QC);S|Sku1KB;St C t u Sjue[^UhUE }uUfEfEUUHEEuuEPh ‹EUhEfEfEEEEEEPu EP ‹EUU h%PRuAUS]jjSc p#]: U,WVS}]ޅt)?t$}IKEE]P5p#ZOlj;IKC)CPVj[^_U|WVS=@#uhE@(Eup#}t"}}URiMA u$jjjqMщÉփuuTEXPpTUB t B)֋EHx0t#@<)UJt t)ș] uE!111EHp#uURHeMA 7uO}u-fy|&EPAPkuE%f=t EH EUBLJ }u E U,EPUBPkE UEUԉEUuYUB t ZPrT(jjjMqMщÉփu fEHș)։ʋMy0t2A<)֋EPx0tЙ֋UBz8))z<MA9))׉E@ ud;u_u;]wX؉;UuH;EvCE)U )ljzR0tE@9t Rp|MA0E` UBL؉É#]#ujVSrMуutnE@@UR0t E@9t R{MA0E` ߋ})P趔uUB9r :)BvMQeEPU MQRMqMуu wEP0t@9t Rc{UB0MAAa 1x[^_ÐUE uRPuU$W}}эQUEPEEEPu -}$OpenBSD: clnt_tcp.c,v 1.16 1998/05/19 06:58:51 deraadt Exp $clnttcp_create: out of memory ULWVSuj yǃtjdyÃu.h h|*(# p#0#f~u9jEPU RVZfuSyWyffFE8}tjjjiUjPzfU |jVP3}+(# p#0#UPC CUC CCFCFCF C jEP'rEEEE E܋UUjjC0PsLViEPVmu{tnE0Q\CPV@ЉCHCPxt V@Ѓh0hSuuV>G_ yg"t SSxt WCx1e[^_ÐULWVSEp~LV0UE~u E U$FV E}u} u ỦU}$t EF0EF$U ffEGvHURW@ ЃtDGU RW@Ѓt-UP WPBЃtEPWU҃u~$uF$jWBdEPWBuF$@}u 10} u}$uF$x#Eܡ|#Eࡀ#EEEzW@]SW%kuF$tU9UuF$PSl~$ufUP ]SPBЃuF$F("uWU҃u ~$uF$}t4SWBi"mrUP PB ЃF$e[^_ÐUEM PB$B(AB,AÐUEM @PL@LuRUÐUSEU ]Ht' t Jt'ASAQ A0AQ S#AACACA C 1[UVSu^{t 3~}SPztCLPBЃStVte[^ÐUlWVS}u 1EB=~AB Ssƃu SjVUUu1uj]S<MAQ EЉUԃEЉEUȉU}MMEу URjjVM@P9dáp#EjUREȋM)ME̋U)‰ЉG} MG@BEMQ)‰UGQ )‰ЋMA} MA@BEUEЉUԋEЅ| u Exu1ۃt'uWUB$;uV's=p# MA$EA(;uVrz;ut VrURu M1zEtu-E@(6@$Ep#UB(B$Ee[^_ÐU WVSu }~;SVE0!zƒup#MA(A$ )օȉe[^_$OpenBSD: clnt_perror.c,v 1.10 1998/12/30 22:26:18 deraadt Exp $U=#uhDq##%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... UWVS]ƅu 1CURS@ЃuPu hhV轴0@E9JE$(CCCppCCCCCCCCCCuM.Ph))PS%uuh,u=EhS))PSà ;]w|}tEPh\ uhl))PS譳3uuh,uuh))PSx ƆhV`,hjPFe[^_U u uPh\h|*|Ðt]N,saH, RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)UEv  ÐUuPh\h|*%s: %s - %s %s: %s UVSuÅu 1(# tuE5,#k50#>*P5(#KPVh'hS P+PVh4hSƃ ƃ؍e[^%sUuCPhh|*Ðz_G,Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKUEv1 $OpenBSD: authunix_prot.c,v 1.3 1996/08/19 08:31:22 tholo Exp $UVSu] SVpbtihCPVgtPCPV;atPh'4CފGt3<;t/|+p,DuCt<;t| Dt PVO t#I#4# 4>#G GJyA}} +E@E? ‹u;ur;u sEE +E9E|FP}}+uuE[^_ÐUWVS]} }EEEE}t@M MECt7MM9tEM9uMMOEC։Å}thEPMQEPCP]|(W;U z 3CN}tE9EsM9MG.t˃\u3Ct;}s(G3Cu܉)ЍHu1>v}t)E 2;}r}t M G+} e[^_ÐUVSu] 𐐐9s!@tʁt t@9w)[^ÐUU|ʡp,DtDHUWVSEEuEEفttZKx4<.tv<\uFPFtEPGd 9EuLKyFu ?uE+E I.t-? Ë} Gx>u E )EEEE9E@e[^_ÐUSM.AtYA.tH.t .tuBv2Bv*BЃ v"1+BvBv BЃ v-uމЉڅu[ÐUE8*uP.u u PSÐUSM1ۀ9uMAt3B߃]w0$1 \uAtB߃]wuރ.u݃.t1 Q]ÐUU ߃]v1 BuÐUEff@ ÐUU B B B UM UfQÐUMU BBJUEPuuEÐU,WVS]EE p,U䐐ѡp,Di1E 0u"C xtXuEC E}䐐|DtEэt0}u.|*DDtщtrr C 뮐.uE9EE0EC @tUDE)E}E@$98:K:99:wdE=wZfwLMwAE=w7 >w E=w]w Mv1*  ƃ} tffU 2[^_%s: US]58hl:h|*tu Sh|*hq:h|*Y]%s: : %s UVS]5p#58h:h|*t&u Sh|*h:h|* VPh:h|*e[^  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~UUDPUS]jEP@} tEE]UE EUB EjjEPujRQt1@Tx̀r,T̀rTb̀rT!̀r$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $Uu u@$OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $UVSu] SVt-tu!CPV4<CPVW1e[^$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $UVSu] jSV?tjCPV?1e[^$OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $Uj@u u~A$OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $UWVSE} " Btp9u Bu@u1[^_$OpenBSD: strcat.S,v 1.2 1996/08/19 08:13:12 tholo Exp $W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_$OpenBSD: bzero.S,v 1.2 1996/08/19 08:12:56 tholo Exp $W|$T$ 1rك)_$OpenBSD: strerror.c,v 1.2 1996/08/19 08:34:17 tholo Exp $UhH#u$OpenBSD: strcasecmp.c,v 1.3 1997/08/20 04:13:57 millert Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~UVSBM] Au1#2C80t0C0)‰[^ÐUWVSut9BU]  8C89t9C8)‰BtNu1[^_$OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $U,WVS}up,EFDu-u EE+uFtu0u_,] )ރ뺐e[^_ÐUS]jEPSt+EffES8%t C41]ÐUVSu] ~.V,F0)uVu19~‰V,)ϐe[^UEcw$$OpenBSD: xdr_array.c,v 1.3 1996/08/19 08:32:02 tholo Exp $xdr_array: out of memory U WVS]E 0ESUR)te;;}vE8uV]ubUt tQu S1ƋE 0uhPh|*s1_SjV=19s&}t VURU҉EuC9suE8uU 21E Ee[^_U WVS}] 19s#SEPU҃u1 ]F9re[^_Ujjuuu u!$OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $Uu uh,$OpenBSD: __strerror.c,v 1.6 1996/09/25 08:17:30 deraadt Exp $UVSML# ~(gfffK))0 у ޺gfff))0 [^libcUnknown error: U WVS] jh{S ƃE;s1h4hYPjVPSƃ`hhShjVPSƃ߰Ѹ)PEPPS V؍e[^_NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGCU WVS}tE8u j/EPrtEP6uh\T>0Ãu|ThT#0ǃuT;O;:D%C(s$U(VpVLVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVpVVpVpVpVpVpVpVpVpVVpVpVpVpVpVpVpVVstZ]9sSBAtG9rAUst5]9s.BAt#9rEs9s Es9sAt<:P)u;tC;[^_ÐUpVSju蓏ƃEPVt V(5jjjVjjuj5ÃV5t3ff=uj+ƒt EЉBuSD4e[^UWVSEuCp# 0EPffMTMDffEE1UBffpU9>RMffM )UB ffMDEE|ffDfft89X>RMffM)yrÐz뻐}r0z(E[^_US]up# ts32S*1]$OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $bbbbvbcbMb6b$bbaaaaaaaanaLaaa``````k`^`H`9`-` `____l_<_+_ _^^^^|^L^+^ ^]]]l];]!]]\\\a\N\,\ \[[[[[[[l[P[>[*[[ZZZZInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: strchr.S,v 1.2 1996/08/19 08:13:14 tholo Exp $$OpenBSD: index.S,v 1.2 1996/08/19 08:12:59 tholo Exp $SD$L$ 8t@u1[$OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $UVSuUt$] CAuJtAJuJu[^$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $UVSuMt%] >t B:uCtBIu[^$OpenBSD: pmap_getport.c,v 1.6 1997/09/22 05:11:08 millert Exp $U VSufEEfFohhEP,0RPjhVà E EEEEEEK48RPEPh@}EPhejSЃ t (#Ch,#S@Ѓf}u (#CS@ЃEt P&fFEe[^$OpenBSD: pmap_prot.c,v 1.3 1996/08/19 08:31:39 tholo Exp $UVSu] SVt9CPVt%CPVtC PV1e[^$OpenBSD: clnt_udp.c,v 1.15 1998/03/01 10:05:33 deraadt Exp $clntudp_create: out of memory ULWVS} u$j oEt"D7dPLÃu/hfh|*(# p#0#D3`CXjEPEfxu*jURE PURWfCfUfBE@DXUCBC BCB CCEUCS C$C({Ts\QeEEEE E܋UUjWsXs8V EPV Cu_SVtNCPVat:CPVt&C PVytCPVe1e[^ÐUUE wR$Dyy\ydylyty|y8 0 ( @PÐUUE tt @PÐUVSu] Ftt,Fu aSPSv FCtwt ( t!FCFFC FCF Ce[^$OpenBSD: xdr.c,v 1.5 1998/03/19 00:27:27 millert Exp $U(UEu EPÐUÐUSM] t$r t5;EQEPQB#AURQЅt E1]ÐUSM] t$r t5;EQEPQB#AURQЅt E1]ÐUUM trt"(BQR@BQR 1UUM trt"(BQR@BQR 1USM] t$r t5;EQEPQB#AURQЅt E1]ÐUSM] t$r t5;EQEPQB#AURQЅt E1]ÐUSM] t$r t6;EQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;EQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;EQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;EQEPQB"AURQЅt Ef1]ÐUS] EEPuQt E1]ÐUS] EEPuyt E1]ÐUSM] t,r tFK;ƒUQEPQB*AURQЅt}ƒ1]ÐUu u<ÐUVSuM UӃt )؉Ëu0FRQV@ЃtTtWFSh`#V@Hu0FRQV@ Ѓt t#FShV@ t1e[^xdr_bytes: out of memory U WVS}uE VW6;uvuut rFtQgu[u,VËE uhh|*{)VSWtSE 1e[^_ÐUE hPPu-ÐU WVSu} ]WV,t{t9t{u}u1EPVCURVUҍe[^_xdr_string: out of memory U WVSuE t u߰IMEPVqE;Ew~Pt rEtQktZu,R7ËE uhah|*5EuSV( SsE 1e[^_ÐUju u $OpenBSD: qsort.c,v 1.5 1997/06/20 11:19:38 deraadt Exp $U\WVSEE܋UuMuЉU EE} }}EE U‰E9_}}}[}uMD}&u]Nu]CAN}E9EvUR+]SMу߅}ċEE9fE E}NjE HE} %U܉UEЉE} (M MmEEEÍ4BSRMу},VSU҃|GVMQU҃U܅}2.VSMуVEPU҃}UډU+]M49WSU҃}+VWMу|FVSU҃‰؅}3/VWMуVSU҃‰}NjEu)Ƌ]+]SVMу}/EPSU҃|KMQVU҃}7U2MQSU҃MQVU҃U}ډUWMQU҃}7MQWU҃|[MQEPU҃‹E}AEuSWEup#jj&}t)EPWVOƃp#}t UBu,% hVÃV tu+>au#FHwj h؟ Ѓ;F@t OVF(љdžPV F V T0DJNRj8P}tUB t P hV0M01t%4dž$j$up#V]p@Ȣ@T@ @ @ܧ@@D&tVp#1e[^_ÐUVS]tsFƃSe[^UEu @u p#ÐUlWVS]U uEC8CC C CCCC4,% {D1 󫍻t-EPRBEC P*Ctmt.P}*KC =~ p#PFtC4Ft FtEFt=t=uCEPSu1e[^_ÐU WVS]E H{4@}P)SDAK C$jP APS  tMVS0S(uC,K@C<Й{@Pc);C~CPS e[^_U WVSuE4jV-tp#EtO0Pt#PuɃVt}up#E1;}$8t PC;|䋆t P,V}u1Up#e[^_ÐUSE} tp#@tX4t+jjSo,u҃Suǃ01]ÐU WVSu4aFj h؟ ЉF@SV jjjWmut2hSWMt=tp#Odž,O:1ۍ8t jjXPRV  uC~1[^_ÐUE@}uuu jPp#ǀ,ÐUEM@t!tp#ǀ,Aup#ǀ,uu uRP`ÐUE@}vp#ǀ,,tju jPp#ǀ,ÐU,WVSEp URUM MjjRQP-PEP\&EuUU%MMIEXE9UCfv4)9uuuMyNjMsE뼐fu#jEPPUR%E}fwEPURMQEPURE MMEPEP}f ju%PURA%EsXEMq } w2} r,URMQEPURE`:Ub(} r,} t} MaEXUf|SwjMQRPEPUDS؋MCDK)‹MQEPURMQuEPURMQEPtXUbSMQEPURt02+MaE` Ub1e[^_ÐU WVSEUpt*t%t p#dž,$|udž$dž(dž 1 u^$ Cdž(;^(w#jjSV"ƒt zf?t͉$;^(~dž$9z(f|Gu>jR(GPV" ƒ!zdž(ftf?udž $+f?!(f|Ow#jEPM QRVO BU OfvDO)ЋM A N )ыE HTG QMGDG)‰Qff;vdž $dž( É(1e[^_ÐUWVS]C(PS(ЉEEC0!EKu;|eS9|)<WPPt"{js]‹u VC(@PC 9~ SDK C,9Ev C0 EC,UREPS}e[^_ÐU WVS} ]Slƃt2WE0V)Sj7PE0E0e[^_ÐUS]uu #C,;C(~#C0]ÐU WVSujv\tjNE Ps\ǃup#Vp#+1;] } NC;] |1e[^_ÐUS]M CCACAACACACACAC AC A C A CA CA CA C AC ACACACACACACACACACACACACACACACACAC#A C"A!C!A"C A#C'A$C&A%C%A&C$A'C+A(C*A)C)A*C(A+C/A,C.A-C-A.C,A/C3A0C2A1C1A2C0A3C7A4C6A5C5A6C4A7C;A8C:A9C9A:C8A;C?AA=C=A>CUP?P@UMQP@QPAQPBUPC]PG}BECBCBCBEAfEGAENy[^_UWVSu1Lhhxt=sjtt W Džt|uDž|}uE}uNLECDž|DžlDžhLUDžtEDžxE=t =h$Ã1ǃEǃ|Eǃj$mƉs[1 󫋅L9t ^FxFXF TF FFF}tXE  tt uU RMQ 0,e } ~ jj[EPߺ>E EjEP}b1u  EddBEBEBEdEE``BEBEBE`EE\\BEBEBE\EEXXBEBEBEXEETTBEBEBETEEPPBEBEBEPE}b1}U=E_x EEgxu0Ex=w Džxxv Džxhu  ǃǃ xltxIt!ȍDlx9lsllJ1HG1tffw fǃHQjJtz uShhp3KStKE t!@U@t!}}"Pp# p#Ot3Ct Pnt PSK1([^_ÐU WVS}jj7RLÃt9f{u&;u!f{uS7Kp# j=p#p#j]S7JƃtxjS7JÃtb}u\CCfCfCC jVjV7vMjS7iM1e[^_TMPDIR/tmp%s/bt.XXXXXXUWVS1QuhÃ؅uPhhS DžWPjS2 ƃt So jWj[^_ÐUÐUSEX{tjs3fLC u p#]U WVSEX{tjs3LC}tp#~EPu S>ƃu[}uj63K@jPujjVSAǃ !@tj63~KCe[^_UWVSE] "} uSEUBBCBCECCEUBCBCBCECCEUBCBC BC EC C EUBC BC BCECCfEECECCfEECECCfEC 1f;u;CEUUMME܉E}ؐ֍ EfEEDSEDSUEMAABABEBEMAABABEBt?BE܋MAABABE܈BE؊GGBGBE؈BfFf;uC[P1f;uDCEUЉUM̉MEȉEUĉUMM}֍ EfE֊E׈DSEֈDSUEЋMAABABEЈBE̋MAABABËB BtMEȋE@E@BE@BEȈBEċE@E@BE@BEĈBtAEMAABABEBEGGBGBEBfFf;uh[^_UWVSEu } uVFfEF 8fEẺtUȉxMĉ|]]EEUUMf9M^]EEUUMM}UM 0EE@E@AE@AEAEE@E@AE@AEAtEAEE@E@AE@AEAEGGAGAEAM fEEDVEDVfE]f9]+ỦtMȉx]ĉ|UUMM]]ZfEEf9EGVUMM]]EEU܉UM؉M}U]S 0E]CCACAEAE]CCACAEAAtMEE@E@AE@AEAE܋E@E@AE@AE܈AtAE؋]CCACAE؈AEԊGGAGAEԈAMQfEҊEӈDVE҈DVfE]f9]E̋tBBFBFËFFEȋxAFAFAFEȈFFEċ|CFCF CF EĈF F EUBF BF BFEFFfEMAFEFFfE]CFEFH[^_U$SMEUBBABAEAYAEUBABCBCECYAEUBABCBCECY A EUBA BCBCECYAEUBABCBCECYAEUBABCBCEC[U WVS}w~tjv6@CFjW65CFtPͽF Ft P詽dždžt PdždžVYWPS1҅tЍe[^_ÐUSEX{tjs3:BC} tp#@ Ѓt1+tS"t3dBu ]U VSujj6?ÃtZEb1EEEE %EjEPS4jS6_A1e[^ ̀rt\̀rUdSE] }UfEfEEEt CEEEERuEPE…tEЋ]Uu jEPutUÐUjjEPuvtUÐUS]jjjSN1҅tډЋ]ÐUS]jjjS&1҅tډЋ]ÐUuÐU|WVSu} t}tp#;tC;u+]K9sp#E;XuttkgfffmE))EE0KM;Xu@u5ɸONR)MEGEAK;XtǍCE} u }tMK9vC;/uEPV/E%f=@tp#} tRhh VcU |# ʐAÐa뻐=p#tW}t"hV$t=p#t,jEPVt=p#%E] t6Zu 9t-aC됐p,DizX9H1x[^_/dev/arandomUWVSj]SjhKƃ t!jxEPVfV]XDžxx@%1Nj]Fw-DžtjjtPDPjW u͋E1ދU 0sZssD*]CC02C 0G~CX[^_ÐU=T#u+#HIy##T#h#ÐUWVS}u =T#u #1ې###M#EؙE:#######C~##[^_ÐUS=T#u### ########### ######## ### ######## ### ######## É[UM19s @9rUSE 1ҋMX$3& AAAAAAAAKu[UWVSuEE}t$EXtU 9S t1ۃ}uNEE~O#} NE 苖EÃEEu 0uEu\EPU RVÃt'jEP}%PU RsVOt1D}u9U ڋE,CBSCC؍e[^_ÐUWVS}fEuFtyj藲ƃt.jhV&w sF uV1w hvwHkFBV~ u FINf9t DAfEFtjPv QW oFEt@_KF !ËO苗0tUut  FFCE;C Kf9t DBfECtjjs QW6 C CCBS@CXCStCBu E;B hE F F}t EpFFFF0e[^_ÐUSUB E HJ}[U WVSuuÍ9C …uCt(}t!CtjPRsV u} tKCtv jPZs' CBSS ri1e[^_ÐUS]E @@ @PQHRPBP[ULWVSExtjw74G tp#}t r }u G($<tp#АEE HȋUB99vZ]SM QW-ڃ=EE]CjRP赽jE PEP蠽M] UBM A9vr]SEPW.-ڃEE܍]CjRPDjEPEP/M] CU B9}u+jw741ƃOfM]؃tSEPU RW5EԃuSM QW%EԃPEԋ0PfU҃}u }tVjV72}t6  t-EPVM QW ÃujV7j2UB M AXFN)ȍS9s.EPSEPURM QVW 'FAU҉Uf9Es%)PDVPP諻fFVF)fFMfJ^U BMAËCr2S_U ZMq1SHG($ <u9GuGf;Er@fGuU~u'FH9Eu@LJEf!~u"f}uLJfLJjV70} uUBP0W9# 1e[^_U WVS]j3.ƃuǃsf{ E@ U B$VN)ʃ9u`~׍AH9{WE PS@'ƒ|mtC Ffs @fBC f3~u>fu9{WE PS&ƒfǃ‹EӃǃjV3/1e[^_UVSEuX{tjs3^/C tp#t tu SxsFt js3,Et@uVEPSsFPujSƋUBuuRSt17%Pu3`.p# u e[^U,WVS}jE 07.]SEPW '0U9VU^G,E萃jV7-EGj37+ƃSFH9jV7~-E싇;Et P1ۅumrYUFP\0f@jV7-jS7+ƃ t2fEmsjV7,jEP7*ƃ u9#[Cf]fXEU9VU9jV7l,EPEPW x0U9iFE[W,U萐jV7,E>j37*ƃCfjV7+E싇;EtP1ۅumrgEVB\0jV7+jS7)ƃ FHfEUfPmsjV78+jEP7,)ƃ u3EHfEUfP=U9tFEjV7*jU27(U %e[^_UWVSEEEEPE PEPÃu1}}uj3E0=*uEE;SE PEP3!CPWE PEPeE  t>GuWEP.jWE0)ESG9`SG9uEC/CPWE PEPƃtsCfuEfKftSE PEP= tGtKjWE0(}d1GjWE0(.jWE0(WEPe[^_ÐUWVS^j6E0{&ÃvfuESU4FtF PEP"ǃCCu];u fCUfCC SMQSEP"> C؃)VPPgf{UM4уEf9sffHf=uCf+EQf9sffHufCjSE02'+E,M9t B1zU :u.jRM1&1NjSE0&51ۃU RMQuE PUR!t؍e[^_UWVS}UB($ <u09Bu)B;Eu EPWu Rt EO:EMCtC PUR Ct  PEPs C pG)SPP萯fwUEыEf9sffHf=uG+EQf9sffHufGUB($ <u9Bu B;EvfJ1e[^_UWVS}gEE  } u@UUEUfPjjj]SSPEPU E] }t2UU]EHfCSU REPu O8UBH9Es2U]E@fCSU REPu O}uqUBtgjPE0<"ƃu]FHfCSU REP&u OjVU2#UBH9EBjPE0!ƃu u]fCSU REPu(OjVU2d#ECfGLjVE0@#UUUEfB}ujjjGPPRUR{uO1e[^_ÐUVSu] Ct,jP6 ƒt3CBjR6"Ct3jP6 ƒu CBjR6"1e[^鴫̀r頫̀r錫̀rx̀rdt̀rULWVSE fEE 8u UR}WuV]SPMQ'!]S}WuV]SE PURL E؃}/MU؃]C+EfCfJCËE }&UBM Cr2S'FUBMAECr2SUZMq1Sߪ ] ;uWE },uuSP0jURM1 uu] SEPyU,UMMԋEEЃj3U2E؃SBfUMЋA tBw t]C؉E8 MAȉE܋8 EtgMAu^E؃xufvOUBDBЋMQ EU܋UBE܃ ERQӉẼ $9sE CMQK)ʍG9sZ] ;uWEPURMQSEPWURMQ]SE PUR E؅=EDAf9Es*%U)PЋM؍DAPЍDAP袨]fCEUЋB tjw tzMU؃]C)fCfJEBÃWEPS)UЋCMU؃]C)fCfJEBÃ}u U܋M̉ UЋE܊H CE̅uU܋PE܃ PS詧MA=q ]SB f}tEU؃DB]ÉEPTPu؃EP. UԋCUMA)fAfVEFÃEP UЋC f}tEU؃DB]ÉEPTPu؃MACU]C)fCfVEFËUBC [}M 9u9] }uuQSauuE PUR tqjMQ]36jEP3& U;Et H1ۅZju]3ju31ajEPU2jMQ]3 juE0juU2MqEe[^_U WVSEPEPǃu 1MfGUfG] CGGC G {u:]] C9u$KfGEfU];EƃujWU21]hV腠U FBFfFfFZ ^ Bt?jPE0GÃuV1lCjSU2u]SWVE PURÃEVU R諣9u] V褔U EE8؍e[^_ÐUWVS}EPWƃtEPWÃu1jEEFCCFfCfFfCfFU B C F uuSVRW‹E0EЍe[^_ÐU WVS] }UfCfCC4G t G WFCfCfCC4E@ tBEPDUFfCC $ C jSE0S1e[^_ÐU WVSu UMfFfFF0CF tuUBNj $N)fFfFF0C7G PSvGtaw EPuJjMQʋ F)fFfFF0QRS#UC fFF $ F jVM1$1e[^_ÐUBtB tBHfG1e[^_ÐU WVS}_CtEPE PGPW jw7m}t} tXCuPsFA9YjQ7tUjS7t]1sCt$CU CfB_sfuKYjQ7u9jS7 u ApNE fp1e[^_UWVS]SE PURE; M  wEp8؋M9tjSE0Ur MAfƋEfxu}]9tjWU2jwM1 ǃu'U9jSM1E8GUfBMfIQE PURo ؋9tjWM1,EpyMQ A9uQϋ_jWE0 u @jSU2 Džu MfA9MQMQ1e[^_ÐUS]CtPVC CC($U SUfS C(]UWVSU,EjSE0, ǃu1\UzfEGft_UfuƋEfp URE PURuG EE~FfuKfuG U  u[f}utEPU RWEP@u-UG9u$tURE PWURtEpEEUfB ЃUuftNEUfp֍GP\8jWE0 e[^_UVS]u jv3 Eu1XEf@PuStju3\ 1'jV3K EUCS Ee[^ÐUVS]u jv3 Eu1`@UHfBRuStju3 1'jV3 EUCS Ee[^U WVSE }uPAPCt,FPVGPC PEP t} u U!@tV;Fv/u Pd PR.F3C P6訓G GK }Ct:EPEPEP PUR uQMU} u M!@tnC@U;Bv6u P裃 PRnuLMC@As PU2ؒCMAUCMA É1e[^_UWVS}EfxuyuA u 1A t@QB@u@QB@t p ]P UEPÅt5PPCPVW t ESu Ѝe[^_UWVSu} WF9v‹r8t)‰ACsGv)Ɖ[^_ÐUWVS}E PG9v‹E r8tCAFsGU ;Bs@[^_UWVS} ]ujWEPjGPEPE U9 s6uQq PR:u~EUEU> ߋFEjuE0ƃt]E9vÃSFPWkjVU2E)؉E u1e[^_ÐUWVSE UMEUxMM EE]URMQÃu ECCC fCfCu9vVEPCP蠏}tUBjRM1 U)]jSM11e[^_ÐUVSu] jSEP/jSEPju6Jƒu [B tjR6!Bju6ƒt)]BERV9]w1e[^UMU BB jR1ÐUVS]u t4jP3wƒtB jV3e[^UlWVSEPE PmuE%f=tp#1lh(jÃt[u1C@IyE WVEЋURP1UE ؐe[^_USEU M] $[Ðmpool_new: page allocation overflow. UVS]u uhh|*GSu1m}uAAAATQ9RuJH YCA 9u CHKAe[^ÐU WVS}u NF\V9u FCFBQQ9uA GA B Q 9uAABQ|1e[^_ÐU WVSE PURgÃCMT 9uCBCAK9tS9RuZXS;Uu C UBC B S ;Ut2CBMKAC 9 u UBXMYK-CUʐ|MQÃtcE U1jWV苄9u<9u8Ms螃M9t'~p#1Rjs莆E CEuCKCMTS9RuZXEC@C U9u MAXEXtssU$ЋCe[^_UM QQEtˆQ1US]>P9u @ C @ B P 9u @@BQmz 9uS[z1]UVSu9t"CtSVHt"[9u1҅tЍe[^ÐUVSu 99CtSVCL9u CA CBS9t7S9uC FC B S 9tCBCgCǐ[9iPxÃt.PhS2CCC1e[^ÐU WVS} tU rr$ЃU B1jVSg9u49u0E p>;uU b1e[^_ÐUM AU9t9Hu@u9u1鄆_̀r$OpenBSD: calloc.c,v 1.5 1999/11/10 20:12:31 millert Exp $UVSu uV4wÃt VjSǂ؍e[^UEPu ud$OpenBSD: vfprintf.c,v 1.9 1999/08/22 17:06:35 millert Exp $US] {tSu)CC C1]ÐUlWVS}G $fEGfEGEċG,EԍEEEEEuu uVÃ|V`tE@tO @؍[^_InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.ULWVS`E@ txu(UR\tp# uMA f u fy|}WE PQGU Dž DžM}}EEDž$jQW[Ã~$%u+tZpuEHMȃ~'EP}W{#EDžDžDžDžƅ  XB$ $h0tD7^ƅ RC1ۋBЋ w\BBЃ v⋅8$us u)0 PQ} W t MEE@B&t MEE@TBƅ+3 *1ۋBЋ w!\BBЃ v⋅8$uo u)0 PQ} W t MEEXB"t MEEX,Dž1ۋ & \BЋ ȃЃ vԃ $u; 0 PPU RDžs1ې \AЋ Ѓ vփ $uA )0 PQ} W@8lu@ P t EE}GPƅ  tE}_wt* t EEMA`@t. t EEMY- t EEUBÉ}ۃƅ- uDž( gt Guu Džt0 t EE Ehݝ. t EEMAݝ't-ܝEuƅ-DžF 4p't1DžJ $P RPPQW gt Gu;~;~E gue Dž g e=B QPEPƃVJ fu3~#փu tDt18,9|֋tFp)pᄈƅ- t: t EEMA8xt5 t EEUB^@t6 t EEMAf8 t EEMA8 tEUZrt) t EEEX[@t) t EE}_& t EEMY11 t EEEX1DžN Dž xB t EEMIu Dž_ |=WjP#t+9װэq tE}_wt* t EEMY\@t* t EEMY' t EEEX1Džf  DžN  tEMYqt* t EEMY\@t* t EEMY' t EEEX1t t ƅ|E u*$t}r-$$P0 uޅ0O0℈0jj VS0jj VSÉօwu w0℈؃ uEDžw װэq℈b+pR 7 P Pƅᄈ9}t t+~p'BEEx}~%EPEPm U'_]EPUЃ~'EPMQ[ }t[@EEHMȃEP}W Ettiƅ0 GEEPUЃ~$EPMQ( }%=+~]'@EEPUЃ~$EPMQ }'X]EPUЃ~%EPMQM })~_'@EEPUЃ~$EPMQ8 }'X]EPUЃ~%EPMQ }u% ru e݅D@O @EEPUЃ~$EPMQ8}9| BEEx}~'EPEPoUK~\'AEEx}~$EPEP\U'Y] AEEx}~'EPEPU9AEEPUЃ~'EPMQ+}ۅ~_'@EEPUЃ~$EPMQ}'X]EPUЃ~%EPMQe}AE;\9AEEPUЃ~'EPMQ})Å~]'@EEPUЃ~$EPMQT}'X]EPUЃ~%EPMQU} BE BEEx}~'EPEPkU GEEPUЃ~%EPMQa })Njy)‰EEHMȃpEP}WEGA@.GEEPUЃ~%EPMQU}݅E@t4IHEHEK~\'AEEx}~$EPEPLU'Y]Ex}EPEPHUZ9AEEPUЃ~'EPMQ}UHMEx}~$EPEP@U+~\'GEEPUЃ~$EPMQ}'X]EPUЃ~EPMQuz;}}tEP}Wu@EEo}tEPUR^u E t09t RhWMA @u[^_ÐU,WVSEEEEEEE@M EE%uE1MAMBX$,,33,333333L.,3,.3,/////////3333333333/0303333/33133333l23323333333333//000//33/301$2/3H23o23321ҋ]ЋM wTPCЃ v;$u9|EPEPEF;u~uurE@E*1҉ЋM wTPCЃ v;$u9u9|EPEPxEF;u~uuC]9|EPEPDEF;uwuoBЃ mMAMBЃ vV1ɐLBЋE@EBЃ v$/@  ;u|EPEPE t%;u|EPEPpE xt$;u|EPEPCEK@t$;u|EPEPE;u|EPEPEt$;u|EPEPE;u|EPEPE  t$;u|EPEPwE t$;u|EPEPKE S@t$;u|EPEPE';u|EPEPE t%;u|EPEPE t$;u|EPEPE@|;u|EPEPoEw;u|EPEPKES;u|EPEP'E/ t%;u|EPEPE t$;u|EPEPE@;u|EPEPE t$;u|EPEPoE zt$;u|EPEPCEN@t$;u|EPEPE";u|EPEPEF;uu}~UP_OM;MUU Ewa$4X4X4X4X4X4X4X4X4X4X4H4H4X4H4P4X4X4E E E A;M~EtM9t P7Oe[^_ÐU WVSu} Eu"SN7PEPt SV:O)PjRY1e[^_U,WVSE]M}u fuetEuCEu -EPEPWSR$}%mgtGuEtF fu90uE@tCD@u U0EE9r؋E$U)ʉȍe[^_ÐU<WVS}M E} G-G+w ~>Kgfff))0 у K0 9sCF9r 0F0F)[^_UWVS}E xG tuW3tp# U ]rUG teWO,uEE]s]tvPEPRщÃy])ދU B)؉Bu\8G Ou]]]s]t%Bf=BuL9sHG)‰U_򐐍X9rPQLƒ+GGW_U_G t 9sSEP7V)_s;Wv-9v)SEPRoVW5 C_9r!SURwG,ЉÃXSEPRV)_])ދU B)؉BEEu E]]EpEt}u3Vj UR7ƒtEH)‰U ^]EM9vG_;Wv'9~#SEPRaUW4 uw=9|SURwG,ЉÃ~U˃SEPRU)_)]uWZ4u#E])ދU B)؉B1 O @e[^_UEPEURPEU RP EUU|WVS]u UM u1 (1MԉM؃}Ur9wu9v}tMq11}EEЍE܉Ẻ]ԉufEEfGEfGEfGufwUԉM؋UEfPE؋MfAEfAufqEfM}u{EHG1fEG ‰1G ‰1G ‰1}t E@U ‰U؉ ‰UEUfzjEM)MfuMft]Ӄx uf^Ky+EU̍BUEuNwEɁv}~,EPEEPWUREHPEЃPEMIfMʋuvfuȋEEMODOtOfuf;UuEuAM<% uʉ1EĉӋMAMUUĉE 9v Mv1ɋ]~FuwEEEu^E))ʉыEf)ʉɃEKɋuw)ȉf wtBM1ɋ]~/wuƐEUZEEEfKڋUf WEċMufNUUM9}ti}t5]9~&+u_MD_ f_K;]f_EU ЉEEU ЉEԋEԋU؋MQEU ЉEEU ЉEԋEԋU؍x[^_ÐU WVS]uEE 9E}5)MKMDK ‹MfKAME 9|ՋUSfS[^_U1Ef%=uE u}tÐU1ҋE %=u }Љ$OpenBSD: memchr.S,v 1.2 1996/08/19 08:13:01 tholo Exp $W|$D$ L$t uG_Ð1_$OpenBSD: bcopy.S,v 1.2 1996/08/19 08:12:54 tholo Exp $VWt$ |$L$9sL$_^ONL$_^$OpenBSD: strtod.c,v 1.13 2000/04/30 04:58:22 bjc Exp $UVSu #t $PCC‰rZBB Ѝe[^US]tK#[ÐUWVS}uGE_EM E Љ ȉEU9U|ȅtF;W|4G@PËGK W PRQMWIߍGU4BWe[^_U WVS]} M98)1ɸ~A9Q‹EBB  ~$ PCj RƒF9|C ;u}#E)ƐPCj RƒNuЍe[^_ÐUU1uuuu|@@u ÐUMt't1`t NB1fuuuuu @u US]j0X@]ÐULWVS]u F9C}]uC{VUU;S~@PEEEU‰Eԃ]Ѝ^M9Usuu9rEЉE]ىM܋EE؉E9 U2uUċE؃E̅tgUЉU}EuU%‹E4umMMEMmfOf7U9Uru7EPUt^uЉu}EUEWЋU4fwfUBE EMmu9urEĉEỦU؋u9}}M}~?tUEPEe[^_ÐU WVS} tj4(EPEtsP#uuM;uv>t]UZE PUR]C]EE}E܉Eu]]%] ]m%)EE})UU}fWfE9Evu>uM;uv>t]UZEe[^_InfinityNaN0?aCoc?`(?yPD?$@@@?UWVS]EU EU#t) #JBR#}} eE%=uKU'EZ}u]uEZ} tMEUztЃ] 2ED@u'EEZ} t U ZE EPEPuuE}t#UM?ElEE썸2 ~@)U⍈E )U1҉EUmEݝpptpt݅p%Z}E ZZ Z}fEf fEmUmEuEE@tME}w!EEŬJEuMEE)X| E] ۉ]E}|EEȉEEU)UU]E} vE}~E1E}w}]$]^^ ^@^'^G^EEԉE̿E@E}E}}̉} EEEȍx}ԉE̅ #v1ҐBۍC9v #5 #|#‰U},$1UM]ȉ]ċEԉEE~R؃ŬJtE5KE]tdKtE GuE]@ut9E ŬJ]t dKt EE ]Gu}t4]Eu(}~"}6]̉]ME ZE]EM[]E}uBE% [EEU]EE]E}][4ݤJe]E}fEf fEm]umuEm|0]C]E]Epe]E-;}*ZE]EU}f]f f]m]umuEm0]]C]E]Ee]EG;}|]E ݤJ]ZE}fEf fEm]umuEm0]]C];}u@[E]E%e]Eu%MU:0tBU.GE]v؋|]UMEĉEȋUЉUԋE&}]ݬJ}}8}2EE}| []juE}fUf fUm]umuEmE0]@E;}ubEUEtD@;/ؐME89u|9uE0]C]E Z]EE@G5UUuEE}tf}}t 3<6+}/]K9]|u) +]]]1}ԅ} ]])}1}}jE}~}~};}~})})})}}~e}tI~3VEPEURSÃEP]])t!SUR ]SEPXEj@E}~URS-E}0}u#EutEEE E}t']SJ؃4} )}Gt )ǃ~ }}}}~EPUR5E}~]SEPE}tOUR]S}8Mȃjj SE}tjj EPEỦUԃ}\}~V}|( jj]SEPEP ؋U҉U|1C]E}}~EPUR0E܃EPSSÃUREPEx uPUR(EPu }uEu}9tp~E܊U{|uR}uLEuF~;jEPEURSƃ  uEܨt E܃}:tU#~(}9uE9@EU‹]E܋UBU;}wGjj ]SHEGEPUR0E܋]C];}|ƒjEPEURSà  uKEܨtDMU:9u|9]tME89tUBU&Eȋ|1C]ME80t@EURe}t2}t]9]tEPBUR3؃]S|9Eu0@EEUE@]} t] |X[^_$OpenBSD: multibyte.c,v 1.2 1996/08/19 08:33:39 tholo Exp $UEt8u1} t ÐUMU u1'}u t:%ÐUUtE 1UVS]M U1tAtFJu[^ÐUVS]M U1tCtFJu[^US]=@#u(C uEust1S0tC@9t RC0c CCK {u S0C tCC؉C1ҨuSS1]UVS]C u)EPEPSjƃu uK CCCC:#tm΀CEC}tCPtf s e[^UlWVS]u }f{|EPCP} E%f= ƒEu0C uCLE%f=u{(uЍe[^_U WVS]CPu1/PXPKx׾X#XKye[^_ÐUS=@#u*CKIxfx t)XIy;uj Xtː1Qf@ @@@@@f@@0@4@D@H]ÐUSp*+C~)=*t+C~;u~ P]ÐUhmyÐU#tm@#UEuhm>#@ tPp# ÐU WVS}G tPwtI)7uGG3O @+GSVwG,Ѓ~)ƅ1e[^_$OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $U= ++#P#P#P #P#P#P#P#P#P#P#P #P!#P"#@## +=$+t'l+#B#B#$+#Åooo.ooooooo$OpenBSD: flt_rounds.S,v 1.2 1996/08/19 08:12:20 tholo Exp $<$$ oU@VSujjVu)EPV؃jVy1ۉ؍e[^ ((((( AAAAAABBBBBB $OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $Uj\ ̀rUu ht,@u error: U0WS]q=8}IM=#}IMUIM]IMjEPj## warning: U,WVS]}r=#tSM =#uf=8}IM=#}IMuIM]IMjEPjEe[^_ÐUVS]j S5 u/ +#P##;Ⱦ#rRu1e[^ÐU WVSE p=Ⱦ#jjjhj Pjqà t?Ⱦ#P5ľ#SS 5Ⱦ#ľ#ľ#WP1e[^_/etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits. U\WVSp#EE}u2j?uVh.tÃEb3?}u*E=h?t1ǃ}u=`#E@E >$dutv w`v w wv w w w w w w w wv w w wv w w wv w w w w wv ww w w w w w wv w w w w w w w wv w w wv w w wv w w w w wv ww,,-,#####z#n#b#V#J#>#2#&##hltK#Gt EEb=#t #jjjhjhjľ# uhtMj #Ⱦ##=,u ,%, j]#Ep#e[^_U WVS1]1 о# t4A9ruqtABQq3Q)؉A uSƃtQ +# ľ#9sDB9r=#t ShVt=#u =# We[^_ÐU,WVSEwEHľ#tEuE<dhǃ@MEU9v(]SÃuWB1MfCfK MfC fC{CE1 }vS E)w;u} { F;u|;[uD1}~$|$H`0 8Phȉ  4H\l̈؈pEEPj UdEE@;EE@fEPj랐EE@BEE@*EE@EE@EEE@!EE@EE@EE@EE@vEE@^EE@FEE@.EE@ EE@ EE@ EE@ EE@ vEE@bEE@NEE@:EE@&EE@EE@$jjEPEPjEP1tMEuF?p#,jjEPEPjEPtUU(UE EEEJvp##uEEPEPRA|Eỳr̀r.̀r:̀rl̀rXÌrD%̀r06̀r̀r̀r̀r̀rUEU RPjuuuu ujhU WVS}jjW't ,uE URPjWjhÉփjW؉e[^_$OpenBSD: sigprocmask.S,v 1.4 1998/11/20 11:18:30 d Exp $L$u D$ L$0̀r L$ t1$OpenBSD: brk.S,v 1.3 1997/09/17 17:23:38 weingart Exp $L$9 X.r X.L$̀r 1 .dU1ÐU1ÐUÐU$OpenBSD: memcpy.S,v 1.2 1996/08/19 08:13:05 tholo Exp $$OpenBSD: bcopy.S,v 1.2 1996/08/19 08:12:54 tholo Exp $VW|$ t$L$9sL$D$ _^ONL$D$ _^$OpenBSD: memset.S,v 1.2 1996/08/19 08:13:09 tholo Exp $WS|$ D$L$W~$ĉ Љڃ)ӉكX[_$OpenBSD: exit.c,v 1.4 2000/01/06 08:45:50 d Exp $U WVS5d#t^Kx~Ky6u#tЃu/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/binUVS]u EUM;tuQRPVShJtp#/{u%t:;v%<t0jjjjDщƒ F$E؍E@UU!tVj]SPWGЃsu;CjEPURWGЃt_EEj]S3E܉ECEjEPp‹C@9u_jEPURWGЃtU؉V$tBjjjHut$RPu !1e[^_U WVSu]}tnw?ujjPUdžjEPCE PAPCt'PPGPCPV8]uAn!@to@;v?uP PRu@@3CPG G1e[^_U,WVS}G,EEjUR7aA tOE +EfG G[AfEQUAU䋇EUƋUBFf;ut E;E v݋UEJfP[]}t%r }t5@ƋUDB j ƋUDBjjQ7bp#E}tsw,7}uSAP SAPjQ7b9tP1ۅtj37t`uEp#1e[^_U WVSuU >B\N)Ãr2PGfFEf+Xp0PGfFf>E)fLFf\Fe[^_ÐUWVSE pUMf|NwP]S}t UDVMA Nj]f+|^EHUfU9ts\FڋM QщMMDN)PR]SM;M8NBfufBfBfZfB;M~DFUfVf|Vf|VMf]K8E H1e[^_ÐUfEEEGp9UOfEBOEDOA9~1e[^_UWVS}G EuW9Utn}t7w ~^]U ECCBCBEBIu1] p19"U] KfEBKEDKA9~}t%]_<}tME@P\\@7M G<\utR%\@jؙO t1RPEPut,UR] SEPt;Eu1p#Oe[^_ÐU WVSEp eǃttUuNFSjWMA )PhSeMDUE MfJE8<1e[^_ÐUM1t@vÐHASH: Out of overflow pages. Increase page size U,WVSEx DJ]KU}C H!ЉEs$u;uE8EuVEPuE;uuM UB H;uu#]C XE#X$yC11EE&B 9~F;uhMD ]C$ X U΅t+\~AG~j1hjLEx  2 0 2EUB H9Eu`E}MQj PEPxU2C~PGrMy 0 01,EM})UMM }EPÉyC)M UB \3;Z$|KJ$19}E;XD~ DF9};tU+\@ %1e[^_ÐU WVSU B f ft ‹UL@QM;Q$}Q$EH@ X!ӋE8uǃ $}jU RDFPS @f8uN$ǃ EU 9B u(EPFBP}URsp#e[^_ÐUWVSujEP]SVEP u`suUR;EЉUEPEPU fB ft*juB PEP{ U BuE @E }tEHpX|CLC3F֋EfSFfCf3f|CfLCEU E BEXHfvGsLC|CfƒfLCf|CuURu P PRƿs32S)PPRCEUB ESEP} E$(XX (XX8X(F(tR~$aU 8uUEGU 8t%7U 8t;w-'p#;! uWVЃ@9!t>pEt]CPPu.EE@jSPVrEP9w!turEPURGPV1u"} u~$!jE PWjVe[^_U,WVSuUM9AvFEPQR;UUMAEE]CBEMEU E;w tu PM Q]Su 2xtItEU E;s7PSMQƃujS]3[AGEPUCK)ȃ9s7PMQEPURjSMQ]Af9s%)PDsPPfCSC+EfCfrC؋MQU@q1PYM jS1t@1e[^_$OpenBSD: crt0.c,v 1.3 1997/06/24 17:15:49 tholo Exp $t1#((.Btg{8h>DiZ|wrmjga0[\U0H>2(&;4? C0P` 6 6 0= pI d  t | P| ܇  l7 l7 l 4 4 4 P L@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.9 2000/01/22 20:24:45 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.7 1997/11/08 23:26:39 todd Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. (@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.14 2000/02/20 23:03:55 ericj Exp $.$OpenBSD: utils.c,v 1.14 1999/05/06 17:19:47 millert Exp $$OpenBSD: args.c,v 1.8 1998/07/09 18:39:23 deraadt Exp $$OpenBSD: conv.c,v 1.5 1997/02/14 07:05:19 millert Exp $$OpenBSD: conv_tab.c,v 1.3 1996/06/23 14:19:46 deraadt Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.8 1998/04/30 05:55:02 deraadt Exp $$OpenBSD: misc.c,v 1.7 1997/09/12 04:33:24 millert Exp $$OpenBSD: position.c,v 1.3 1997/02/14 07:05:22 millert Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.26 2000/03/24 19:07:49 millert Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.68 1999/08/17 09:13:14 millert Exp $b|^|Y|Q|L|G|A|;|5|.|'|#||||||||||||||b||||z|v|q|j|#||||||||||||||||||j||/tmp/EdDk.aXXXXXXXXXXb$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: editor.c,v 1.70 2000/05/05 19:10:35 millert Exp $~wsoid*% sKKKKKKKGA=KK6K1KKKDISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--nn] [--ccdd | --rr] [--tt] [--vv] _d_i_s_k ddiisskkllaabbeell --ww [--nn] [--ccdd | --rr] [--vv] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --EE [--ff _t_e_m_p_f_i_l_e] [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --RR [--rr] [--nn] [--vv] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell [--NNWW] [--nn] [--vv] _d_i_s_k ddiisskkllaabbeell --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --ww --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --RR --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN The ddiisskkllaabbeell utility can be used to install, examine, or modify the la- bel on a disk drive or pack. The disk label contains information about disk characteristics (size, type, etc.) and the partition layout, stored on the disk itself. It is used by the operating system to optimize disk I/O and locate the filesystems resident on the disk. The options are as follows: --nn Make no permanent changes to the disklabel (useful for debugging purposes). --vv Print additional information during operation (verbose mode). --rr Causes the label to be read from or written to the disk direct- ly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk without kernel support for a label, such as when labels are first installed on a system. This flag does not work on a num- ber of architectures, thus it is not considered the right way to put a new label on a disk. Its use is discouraged. --BB Install bootstrap code. The --rr flag is implied by --BB and never needs to be specified. --bb Specify the single level boot program, or the primary boot pro- gram, depending on the system boot architecture (single or two- level). --ss On machines with a two-level bootstrap (such as i386-based sys- tems), specify the secondary boot program. --dd Use the _d_e_f_a_u_l_t label. This ignores any existing OpenBSD parti- tions on the disk. Note that this option will only work for disks that are capable of reporting their geometry, such as SC- SI, IDE, and ESDI. May not be used in conjunction with the --rr flag. --cc Clear the system's in-core copy of the label and update it based on the on-disk label. May not be used in conjunction with the --rr flag. --ff _t_e_m_p_f_i_l_e Write entries to _t_e_m_p_f_i_l_e in fstab(5) format for any partitions for which mount point information has been specified. The --ff flag is only valid when used in conjunction with the --EE flag. If _t_e_m_p_f_i_l_e already exists, it will be overwritten. --tt Format the label as a disktab(5) entry. --ww Write a standard label on the designated drive. --ee Edit an existing disk label using the editor specified in the EDITOR environment variable, or vi(1) if none is specified. --EE Use a simple initial label editor, using the command-driven built-in editor described below. --RR Restore a disk label that was formatted in a prior operation and saved in an ASCII file. --NN Disallow writing of the pack label area on the selected disk. --WW Allow writing of the pack label area on the selected disk. The first form of the command (read) is used to examine the label on the named disk drive (e.g., sd0 or _/_d_e_v_/_r_s_d_0_c). It will display all of the parameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is dis- played; if the disk has no label, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. The second form of the command (write) is used to write a standard label on the designated drive. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab en- tries describing each, or to edit the label after installation as de- scribed below. The optional argument is a pack identification string, up to 16 characters long. The pack ID must be quoted if it contains blanks. If the --rr flag is given, the disk sectors containing the label and boot- strap will be written directly. A side-effect of this is that any exist- ing bootstrap code will be overwritten and the disk rendered unbootable. If --rr is not specified, the existing label will be updated via the in- core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In either case, the kernel's in-core label is replaced. In the third form of the command (edit), the label is read from the in- core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an editor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. The initial label editor mode is only intended for new disks as it will move partitions around as necessary to maintain a contiguous pool of free blocks. Some commands or prompts take an optional unit. Available units are `b' for bytes, `c' for cylinders, `k' for kilobytes, `m' for megabytes, and `g' for gigabytes. Quantities will be rounded to the nearest cylinder when units are specified for sizes (or offsets). Com- mands may be aborted by entering `^D' (Control-D). Entering `^D' at the main `>' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The edi- tor commands are as follows: ? [command] Display help message with all available commands. You may specify a _c_o_m_m_a_n_d for which to get more detailed help. There is also (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Entering _u once will undo your last change. Entering it again will restore the change. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: sectors/track, tracks/cylinder, sectors/cylin- der, number of cylinders on the disk, total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. r Recalculate free space. This option should really not be nec- essary under normal circumstances. a [part] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. c [part] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. d [part] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. You may not delete the `c' partition. g [d|b|u] Set disk geometry based on what the _d_i_s_k, _B_I_O_S, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). m [part] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). n [part] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. s [path] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the on-disk label. q Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. X Toggle ``expert mode''. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). In the restore form of the command, the prototype file used to create the label should be in the same format as that produced when reading or edit- ing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. When installting bootstrap code with the --BB flag, if the names are not explicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. EEXXAAMMPPLLEESS disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x SSEEEE AALLSSOO disklabel(5), disktab(5) DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. NNOOTTEESS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 2.7 October 27, 1997 5 $Id: dhclient.c,v 1.7 1999/12/04 00:15:09 angelos Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. Q899$Id: clparse.c,v 1.5 1999/12/04 00:15:08 angelos Exp $ Copyright (c) 1997 The Internet Software Consortium. All rights reserved. $Id: raw.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: parse.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. ;Zx0N$Id: nit.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1996 The Internet Software Consortium. All rights reserved. $Id: icmp.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1997 The Internet Software Consortium. All rights reserved. $Id: dispatch.c,v 1.2 2000/02/09 11:55:47 niklas Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: conflex.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996, 1997 The Internet Software Consortium. All rights reserved. $Id: upf.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: bpf.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. ( 0(EHC$Id: socket.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: packet.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1996 The Internet Software Consortium. All rights reserved. $Id: memory.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: print.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: options.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: convert.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: sysconf.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: tree.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996, 1997 The Internet Software Consortium. All rights reserved. $Id: tables.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. >=`1/`#!`` `````` ` ` ` zx` m`a`U/`K`;`-+`+``x````x`+`u/`^+`P+`?+`#/` `!+`"`#+`$`%`&+`'`(`)u`*YW`+B`,0`-`.`/`0`1/`2`3`4`5/`6pm`7``8Jx`98`:$`;`<W`=W`>W`?W`@W`AW`BW`CW`DW`EW`FW`GW`HW`IuW`JkW`KaW`LF`M<W`N2W`O(W`PW`QW`R W`SW`T`UW`VW`WW`XW`YW`ZW`[W`\W`]W`^W`_W``vW`alW`bbW`cWW`dLW`eAW`f6W`g+W`h W`iW`j W`kW`lW`mW`nW`oW`pW`qW`rW`sW`tW`uW`vW`w{W`xpW`yeW`zZW`{OW`|DW`}9W`~.W`#W`W` W`W`W`W`W`W`W`W`W`W`W`W`W`~W`sW`hW`]W`RW`GW`<W`1W`&W`W`W`W`W`W`W`W`W`W`W`W`W`W`W`W`vW`kW``W`UW`JW`?W`4W`)W`W`W`W`W`W`W`W`W`W`W`W`W`W`W`W`yW`nW`cW`XW`MW`BW`7W`,W`!W`W` W`W`W`W`W`W`W`W`W`W`W`W`W`|W`qW`fW`[W`PW`EW`:W`/W`$W`W`W`W`W`W`W`W`W`W`W`W`W`W`W`W`tW`iW`^W`SW`HW`=W`2W`'W`W`W`W` W` W` W` W` W` W` W`  `249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%%%%%%%z%p%e%Z%O%D%9%.%#%% %%$$$$$$$$$$$~$s$h$]$R$G$<$1$&$$$$############v#k#`#U#J#?#4#)####""""""""""""y"n"c"X"M"B"7","!"" ""!!!!!!!!!!!z!n!b!V!J!>!2!&!!!!          ~ r f Z N B 6 *    vj^RF:." znbVJ>2&~rfZNB6*vj^RF:." znbVJ>2&~rfZNB$Id: hash.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: alloc.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: errwarn.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1996 The Internet Software Consortium. All rights reserved. $Id: inet_addr.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1983, 1990, 1993 The Regents of the University of California. All rights reserved. $Id: dns.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1997 The Internet Software Consortium. All rights reserved. $Id: resolv.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. /etc/resolv.conf$OpenBSD: buf.c,v 1.10 2000/04/01 17:19:09 deraadt Exp $i$OpenBSD: cbc.c,v 1.5 1997/06/18 19:22:35 kstailey Exp $@ $OpenBSD: glbl.c,v 1.7 1998/04/30 05:55:05 deraadt Exp $$OpenBSD: io.c,v 1.7 1997/02/01 12:03:07 tholo Exp $i$OpenBSD: main.c,v 1.19 2000/05/01 18:30:52 deraadt Exp $\ipiH$OpenBSD: re.c,v 1.7 1998/01/21 03:51:50 millert Exp $$OpenBSD: sub.c,v 1.6 1997/09/01 18:29:31 deraadt Exp $$OpenBSD: undo.c,v 1.4 1996/10/12 19:38:43 millert Exp $$OpenBSD: dir.c,v 1.7 1997/10/06 20:22:31 deraadt Exp $ ... ...$OpenBSD: inode.c,v 1.14 1999/08/06 20:41:06 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.16 2000/01/22 20:24:56 deraadt Exp $$OpenBSD: pass1.c,v 1.7 1999/03/01 07:45:17 d Exp $$OpenBSD: pass1b.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass2.c,v 1.7 1999/03/01 07:45:18 d Exp $$OpenBSD: pass3.c,v 1.3 1999/03/01 07:45:18 d Exp $$OpenBSD: pass4.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass5.c,v 1.7 1999/03/01 07:45:18 d Exp $$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.7 1999/08/17 09:13:14 millert Exp $444444444444{4u4p46515(55555444444444444W5W5W5W5W5W5W5S5M5I5W5W5B5W5=5W5W54W5$OpenBSD: utilities.c,v 1.7 1999/03/01 07:45:18 d Exp $b?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@OOOP$OpenBSD: cmds.c,v 1.32 1999/12/08 12:57:06 itojun Exp $`iii{iyisiyilijidibi\MlLl$OpenBSD: cmdtab.c,v 1.13 1999/12/08 12:57:06 itojun Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macroset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose modeijZ\³T8RR8nRxlRpSTlZHSSSS(THT({wTtTpTeT`Z[TDmWT;SZuNU؅IHUXDUP?Uh-:U(4STl0(V+Xh&GV#hVV̫VXV VXyWTHWuWlWXhWpWpݲWײ(XҲhXģ˲XXƲT;XhY8YYY<(ZL\8nhZZZ0Zu|[tuM[oY[@g[a1[x[[TS[K(\FL\8n=HY؄8\3\<,]H~%]mH]tn]]l ]]j]М^H!^Uh-R$OpenBSD: domacro.c,v 1.7 1997/07/25 21:56:19 millert Exp $$OpenBSD: fetch.c,v 1.30 2000/05/03 19:50:41 deraadt Exp $$OpenBSD: ftp.c,v 1.35 2000/05/03 19:50:41 deraadt Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.45 2000/03/22 15:38:23 markus Exp $$OpenBSD: ruserpass.c,v 1.11 1998/03/30 06:59:35 deraadt Exp $//v/o/g/_/ X/$OpenBSD: util.c,v 1.23 2000/02/01 20:53:06 espie Exp $bbb`b{bTb1bbbȄaaaaXa~aDTa5aaal````ԉt`a`4`yyyyyvyiySyFy*yyyyxxxxx xhx ?x%x xw wwFywiwQwDw?w2ww@wwPvvQvvRvvTvvVvvavvcvhvd[vGve:v&vuvvvuuuuuuuu|uouXuKu-u uu uuttttttttthtvvvvvv[tLtvv?t,tvvttFDISK(8) OpenBSD System Manager's Manual FDISK(8) NNAAMMEE ffddiisskk - DOS partition maintenance program SSYYNNOOPPSSIISS ffddiisskk [--iiee] [--ff _m_b_r_n_a_m_e] [--cc _c_y_l_i_n_d_e_r_s] [--hh _h_e_a_d_s] [--ss _s_e_c_t_o_r_s] _d_e_v_i_c_e DDEESSCCRRIIPPTTIIOONN In order for the BIOS to boot the kernel, certain conventions must be ad- hered to. Sector 0 of a bootable hard disk must contain boot code, an MBR partition table, and a magic number. These MBR partitions (also known as BIOS partitions) can be used to break the disk up into several pieces. The BIOS loads sector 0 of the boot disk into memory, verifies the magic number, and begins executing the code at the first byte. The normal DOS MBR boot code searches the MBR partition table for an ``active'' parti- tion (indicated by a `*' in the first column), and if one is found, the boot block from that partition is loaded and executed in place of the original (MBR) boot block. The options are as follows: --ii Initialize the MBR sector. --ee Edit existing MBR sectors. --ff _m_b_r_n_a_m_e Specifies an alternate MBR template file. --cc _c_y_l_i_n_d_e_r_s, --hh _h_e_a_d_s, --ss _s_e_c_t_o_r_s Specifies an alternate BIOS geometry for ffddiisskk to use. The DOS ffddiisskk program can be used to divide space on the disk into parti- tions and set one active. This ffddiisskk program serves a similar purpose to the DOS program. When called with no special flags, it prints the MBR partition table of the specified device, i.e., # fdisk fd0 Disk: fd0 geometry: 80/2/18 [2880 sectors] Offset: 0 Signatures: 0xAA55,0x0 Starting Ending #: id cyl hd sec - cyl hd sec [ start - size] ---------------------------------------------------------------------- *0: A6 0 0 1 - 79 1 18 [ 0 - 2880] OpenBSD 1: 00 0 0 0 - 0 0 0 [ 0 - 0] unused 2: A7 0 0 2 - 79 1 18 [ 1 - 2879] NEXTSTEP 3: 00 0 0 0 - 0 0 0 [ 0 - 0] unused The geometry displayed is the BIOS geometry unless another geometry has been selected using the --cc, --hh, and --ss options. This disk is divided into two partitions that happen to fill the disk. The first partition overlaps the third partition. (Used for debugging purposes.) _# Number of partition table entry. A ``*'' denotes the bootable partition. _i_d System identifier. OpenBSD reserves the magic number 166 decimal (A6 in hex). If no 166 partition is found, it will use an older FreeBSD partition (with a magic number of 165 or A5 in hex). _c_y_l_/_h_d_/_s_e_c These fields provide the starting and ending address of the partition in BIOS geometry _s_t_a_r_t_/_s_i_z_e These fields provide the starting sector and size in sectors of the partition in linear block addresses. _N_O_T_E: The sectors field is ``1 based'', and the start field is ``0 based''. The CHS values will need to be in the BIOS's geometry for the system to be able to boot and use the drive correctly. The --ii flag is used to indicate that the partition data is to be initial- ized. In this mode, ffddiisskk will completely overwrite the primary MBR, and start with a fresh one using a default template, or one given by the --ff flag. It will set up partition number 3 to be an OpenBSD partition, that will start at cylinder 0, head 1, sector 1, and extend to the end of the disk. This mode is designed to initialize an MBR the very first time, or when it has been corrupted beyond repair. It is almost equivalent to the DOS command ``FDISK /MBR''. The flag --ee is used to modify a partition table using a interactive edit mode of the ffddiisskk program. This mode is designed to allow you to change any partition on the drive you choose, including extended partitions. It is a very powerful mode, but is safe as long as you do not execute the _w_r_i_t_e command, or answer in the negative (the default) when ffddiisskk asks you about writing out changes. CCOOMMMMAANNDD MMOODDEE When you first enter this mode, you are presented with a prompt, that looks like so: _f_d_i_s_k_: _0_>. This prompt has two important pieces of infor- mation for you. It will tell you if the in-memory copy of the boot block has been modified or not. If it has been modified, the prompt will change to look like: _f_d_i_s_k_:_*_0_>. The second piece of information pertains to the number given in the prompt. This number specifies the disk offset of the currently selected boot block you are editing. This number could be something different that zero when you are editing extended parti- tions. The list of commands and their explanations are given below. _h_e_l_p Display a list of commands that ffddiisskk understands in the interac- tive edit mode. _m_a_n_u_a_l Display this manual page. _r_e_i_n_i_t Initialize the currently selected, in-memory copy of the boot block. _d_i_s_k Display the current drive geometry that ffddiisskk has probed. You are given a chance to edit it if you wish. _e_d_i_t Edit a given table entry in the memory copy of the current boot block. You may edit either in BIOS geometry mode, or in sector offsets and sizes. _f_l_a_g Make the given partition table entry bootable. Only one entry can be marked bootable. If you wish to boot from an extended partition, you will need to mark the partition table entry for the extended partition as bootable. _u_p_d_a_t_e Update the machine code in the memory copy of the currently se- lected boot block. _s_e_l_e_c_t Select and load into memory the boot block pointed to by the ex- tended partition table entry in the current boot block. _p_r_i_n_t Print the currently selected in-memory copy of the boot block and its MBR table to the terminal. _w_r_i_t_e Write the in-memory copy of the boot block to disk. You will be asked to confirm this operation. _e_x_i_t Exit the current level of ffddiisskk, either returning to the previ- ously selected in-memory copy of a boot block, or exiting the program if there is none. _q_u_i_t Exit the current level of ffddiisskk, either returning to the previ- ously selected in-memory copy of a boot block, or exiting the program if there is none. Unlike _e_x_i_t it does write the modified block out. _a_b_o_r_t Quit program without saving current changes. NNOOTTEESS The automatic calculation of starting cylinder etc. uses a set of figures that represent what the BIOS thinks is the geometry of the drive. These figures are by default taken from the in-core disklabel, or values that _/_b_o_o_t has passed to the kernel, but ffddiisskk gives you an opportunity to change them if there is a need to. This allows the user to create a bootblock that can work with drives that use geometry translation under a potentially different BIOS. If you hand craft your disk layout, please make sure that the OpenBSD partition starts on a cylinder boundary. (This restriction may be changed in the future.) Editing an existing partition is risky, and may cause you to lose all the data in that partition. You should run this program interactively once or twice to see how it works. This is completely safe as long as you answer the ``write'' ques- tions in the negative. FFIILLEESS /usr/mdec/mbr default MBR template SSEEEE AALLSSOO boot_i386(8), disklabel(8) BBUUGGSS There are subtleties ffddiisskk detects that are not explained in this manual page. As well, chances are that some of the subtleties it should detect are being steamrolled. Caveat Emptor. OpenBSD 2.7 April 4, 1993 3 @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.36 2000/04/28 04:44:58 chris Exp $74$4$4$T,lL@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.18 2000/01/22 20:24:58 deraadt Exp $@$$$s$o$[$T$@$;$$$((((<<<< e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular file((ab |qBL c@̞ldP:eL  f4ǝgL h8̜HA\ilT,jkHlHmΛn"loHO=pH̍P4q< ̚r!Ls!%S!tЌTp֙u"xVw!L x$tјXApyhmLz,+ ? (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tp290@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.4 1996/12/14 12:18:01 mickey Exp $$OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $$OpenBSD: stat_flags.c,v 1.4 1999/09/08 07:21:29 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.13 1999/05/01 23:54:47 deraadt Exp $P.$OpenBSD: print.c,v 1.15 2000/01/06 21:32:40 espie Exp $$OpenBSD: util.c,v 1.6 1999/05/05 07:06:01 deraadt Exp $@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.9 2000/02/02 05:09:01 ericj Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.8 2000/02/28 17:03:26 millert Exp $@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.20 1999/05/31 17:34:42 millert Exp $@ w@fZR L$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.10 1999/07/01 02:20:22 d Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.9 2000/01/22 20:25:01 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.12 1999/04/20 23:06:47 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $  @(#)getmntopts.c 8.3 (Berkeley) 3/29/95@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_kernfs.c,v 1.7 1998/12/21 16:14:40 mickey Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ext2fs.c,v 1.7 2000/01/22 20:25:00 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.15 1999/12/24 22:38:06 angelos Exp $$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.22 2000/04/30 05:07:46 bjc Exp $QQQQQQQQQQQQ Q@Q @%s: can't read disk label; disk type must be specified$OpenBSD: mkfs.c,v 1.13 1999/12/03 19:24:17 art Exp $......$OpenBSD: ar_io.c,v 1.19 1999/08/04 17:13:24 espie Exp $$OpenBSD: ar_subs.c,v 1.14 1998/09/20 02:22:21 millert Exp $$OpenBSD: buf_subs.c,v 1.7 1997/09/01 18:29:46 deraadt Exp $ $OpenBSD: cache.c,v 1.7 1999/04/08 03:50:58 deraadt Exp $$OpenBSD: cpio.c,v 1.5 1997/07/25 18:58:28 mickey Exp $$OpenBSD: file_subs.c,v 1.13 1997/09/01 18:29:48 deraadt Exp $$OpenBSD: ftree.c,v 1.9 1998/06/09 07:28:41 deraadt Exp $$OpenBSD: gen_subs.c,v 1.8 1997/09/01 18:29:51 deraadt Exp $$OpenBSD: getoldopt.c,v 1.4 2000/01/22 20:24:51 deraadt Exp $$OpenBSD: options.c,v 1.41 2000/01/22 20:24:52 deraadt Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZ@, h [@L    h [@n h [@nh [@(0_hĜ0_TМ@(ЧĜМ[$OpenBSD: pat_rep.c,v 1.11 1997/09/01 18:29:56 deraadt Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.14 1998/09/20 02:22:22 millert Exp $|*$OpenBSD: sel_subs.c,v 1.7 1997/08/17 23:05:09 millert Exp $$OpenBSD: tables.c,v 1.11 1999/04/29 12:59:03 aaron Exp $$OpenBSD: tar.c,v 1.15 2000/01/21 05:11:36 tholo Exp $$OpenBSD: tty_subs.c,v 1.6 1999/08/09 22:22:52 pjanzen Exp $ / P    z v b ] R M G C : 6     ݏ ؏ ̏ Ǐ    | w o j ` [ N I 5 0     Ў Ɏ   } x d _ I D . *   _@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.41 2000/01/22 20:25:04 deraadt Exp $8.? ɚ;@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.18 2000/04/30 17:30:34 millert Exp $@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.9 1999/01/02 08:38:58 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.37 2000/04/20 12:26:35 itojun Exp $0123456789abcdefQZ )x x w w w Lw w v v v lv ,v u u pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRDȃ I ? 8 0 ) %       ܎ ؎ ӎ ͎ Ɏ Ŏ           !w "p #i $` %Y &U 'N (K )B *= +4 ,- -) .% / 0 {}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. ̪ ++Բ @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.9 2000/01/05 01:58:03 pjanzen Exp $$OpenBSD: cchar.c,v 1.8 1998/11/18 23:26:13 deraadt Exp $$OpenBSD: gfmt.c,v 1.4 1997/09/01 18:30:33 deraadt Exp $$OpenBSD: key.c,v 1.8 1997/08/24 06:49:30 deraadt Exp $  $  $  | L q x i b \  X U L Q J x C = , 9 4 / * T $ | $OpenBSD: modes.c,v 1.5 1999/10/26 22:53:52 deraadt Exp $$OpenBSD: print.c,v 1.8 1999/10/26 22:53:52 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.6 1997/09/01 18:30:35 deraadt Exp $$OpenBSD: acu.c,v 1.5 2000/04/20 06:19:33 deraadt Exp $$OpenBSD: acutab.c,v 1.2 1996/06/26 05:40:41 deraadt Exp $ w @y Xy XZ 8\ |\ |K 4M M (b c 0d p r |s p r |s $OpenBSD: cmds.c,v 1.8 2000/04/20 06:19:33 deraadt Exp $<< $OpenBSD: cmdtab.c,v 1.2 1996/06/26 05:40:42 deraadt Exp $!  < > @ t d p{  |j | $H  C( c  .        s  ? P3 # H $OpenBSD: cu.c,v 1.4 1997/09/01 23:24:24 deraadt Exp $$OpenBSD: hunt.c,v 1.6 1997/09/01 23:24:24 deraadt Exp $$OpenBSD: log.c,v 1.3 1997/09/01 23:24:25 deraadt Exp $$OpenBSD: partab.c,v 1.3 1997/04/02 01:47:02 millert Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: remote.c,v 1.7 1997/09/07 12:23:59 provos Exp $9999:9999 :99:999= : 7 4 1 . + ( % "       @ @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: tip.c,v 1.11 2000/04/20 06:19:33 deraadt Exp $2Kn,X` %K$OpenBSD: tipout.c,v 1.6 1997/09/01 23:24:27 deraadt Exp $$OpenBSD: uucplock.c,v 1.6 1998/07/13 02:11:44 millert Exp $$OpenBSD: value.c,v 1.6 1999/02/04 17:59:38 deraadt Exp $$OpenBSD: vars.c,v 1.2 1996/06/26 05:40:50 deraadt Exp $F F F d$F 9F $F <F aF 9F aF 9F a:yF vF ~kF ahF 9bF _F UF dRF 9MF aJF 9FF A`6F /F a9(F %F F F F F F aF 9E a9E E E E E E E QE E E E E aE :E E E dE 9E d~E 9uE drE 9kE gE \E XE NE KE DE a@E 9$OpenBSD: biz22.c,v 1.4 1997/04/02 01:47:05 millert Exp $$OpenBSD: courier.c,v 1.6 1997/09/01 23:24:28 deraadt Exp $N ,N N ` N %N %2$OpenBSD: df.c,v 1.3 1996/06/26 05:40:52 deraadt Exp $$OpenBSD: dn11.c,v 1.3 1996/06/26 05:40:53 deraadt Exp $$OpenBSD: hayes.c,v 1.6 1997/04/02 01:47:06 millert Exp $$OpenBSD: t3000.c,v 1.5 1997/04/02 01:47:07 millert Exp $e ,e e ` e e %e K%}e K%ve %oe %ie %ce ` ]e %Ve K%2$OpenBSD: v3451.c,v 1.4 1997/04/02 01:47:07 millert Exp $$OpenBSD: v831.c,v 1.4 1997/04/02 01:47:08 millert Exp $t 40t 41$OpenBSD: ventel.c,v 1.5 1997/04/02 01:47:08 millert Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.10 2000/04/11 18:38:32 millert Exp $@(#) Copyright (c) 1983, 1990 The Regents of the University of California. All rights reserved. $OpenBSD: rsh.c,v 1.19 2000/02/01 03:23:37 deraadt Exp $@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $NetBSD: main.c,v 1.11 1996/03/15 22:39:39 scottr Exp $$OpenBSD: interactive.c,v 1.10 2000/01/10 03:08:05 deraadt Exp $$OpenBSD: restore.c,v 1.5 1997/07/05 23:10:21 deraadt Exp $$OpenBSD: dirs.c,v 1.17 1999/08/17 09:13:15 millert Exp $##.$OpenBSD: symtab.c,v 1.5 1997/07/05 20:51:25 millert Exp $$NetBSD: tape.c,v 1.22 1996/11/30 18:31:29 cgd Exp $$OpenBSD: utilities.c,v 1.5 1997/08/24 08:07:25 downsj Exp $$NetBSD: dumprmt.c,v 1.10 1996/03/15 22:39:26 scottr Exp $: : (: 9 9 9 h9 9 8 h8 9 8 7 7 ; a; c; c; d; d; f|; hw; lo; Lg; nb; N\; qU; qK; rD; S?; t7; T/; v'; V"; 1; 9; Z; bp @ L@ @ ? ? H? > > H> > = = h= (= < < H< | B HU CU >U :U 7U 4U | B HU 7U >V {c uc oc ic 9 9 9 9 cc       wT0T           #+3;CScscc !1Aa  0@` ?? 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-$OpenBSD: append.c,v 1.5 1999/05/24 17:57:17 millert Exp $$OpenBSD: fields.c,v 1.4 1999/05/24 17:57:17 millert Exp $$OpenBSD: files.c,v 1.5 1997/06/30 05:36:16 millert Exp $$OpenBSD: fsort.c,v 1.7 1999/05/24 17:57:18 millert Exp $$OpenBSD: init.c,v 1.3 1999/05/24 17:57:18 millert Exp $$OpenBSD: msort.c,v 1.7 1999/05/24 17:57:18 millert Exp $@(#) Copyright (c) 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sort.c,v 1.13 1999/11/30 16:41:41 espie Exp $ /dev/stdind $OpenBSD: tmp.c,v 1.2 1997/06/16 02:21:57 millert Exp $)             4  L  d  |     Y AY GY BY Y bY CY cY dvY EqY f^Y lJY L=Y F/Y F*Y  Y iY nY xY  X hX sX ZX zX qX rX eX vX qX aX UX uX V{X HoX w?  Nm<h<b^X@  y l $$$y$t$o$i$c$]$V$O$K$G$A$<$%$$$$$$$$$$$$$$$$$K$#%#%#%#%#%#%#%%%%#%#%%#% %#%#%$#%l)p*t+$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $$OpenBSD: termcap.c,v 1.4 1998/11/19 17:07:14 millert Exp $$OpenBSD: tputs.c,v 1.1 1998/07/23 21:10:28 millert Exp $5MS7) $OpenBSD: tgoto.c,v 1.1 1998/07/23 21:10:28 millert Exp $$OpenBSD: tcsetpgrp.c,v 1.3 1997/07/25 20:30:15 mickey Exp $$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: tcflush.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: tcdrain.c,v 1.2 1996/08/19 08:34:38 tholo Exp $$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.3 1998/08/20 19:45:57 deraadt Exp $$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $> ?`?A4BBCPFFOQQS,T|T$OpenBSD: vprintf.c,v 1.2 1996/08/19 08:33:13 tholo Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: puts.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: fscanf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $$OpenBSD: fputc.c,v 1.3 1996/10/28 05:32:54 tholo Exp $$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $V YY:730ƌ !"#$%&֐'Ő()*+,--.u.o/g/b0^1Z2T3O4J5F6@7:859/:%;< =>?܏@ȏ[\\]^|^q_h_[`P{={/|#}} ~($OpenBSD: ns_ntoa.c,v 1.7 1997/08/24 21:25:48 millert Exp $$OpenBSD: ns_addr.c,v 1.4 1997/07/21 20:31:05 deraadt Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdef$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: ipx_addr.c,v 1.3 1997/07/09 01:08:39 millert Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: getprotoname.c,v 1.3 1997/07/09 01:08:32 millert Exp $$OpenBSD: getproto.c,v 1.3 1997/07/09 01:08:31 millert Exp $$OpenBSD: getnetnamadr.c,v 1.13 1999/06/04 06:38:10 niklas Exp $$OpenBSD: getnetbyname.c,v 1.5 1997/07/09 01:08:29 millert Exp $$OpenBSD: getnetbyaddr.c,v 1.5 1997/07/09 01:08:28 millert Exp $$OpenBSD: setlocale.c,v 1.6 1997/07/09 01:08:21 millert Exp $   w l d X CCCCCCC$OpenBSD: morecrypt.c,v 1.9 1998/03/22 19:01:20 niklas Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ $OpenBSD: crypt.c,v 1.13 1998/03/22 19:01:18 niklas Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: setmode.c,v 1.9 1998/11/18 23:28:34 deraadt Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $$OpenBSD: pwcache.c,v 1.3 1997/07/09 00:28:23 millert Exp $$OpenBSD: popen.c,v 1.9 1997/09/11 18:51:04 deraadt Exp $$OpenBSD: nlist.c,v 1.33 1999/08/17 09:13:12 millert Exp $:`B$OpenBSD: nice.c,v 1.3 1998/05/06 23:11:43 deraadt Exp $$OpenBSD: glob.c,v 1.8 1998/08/14 21:39:30 deraadt Exp $$OpenBSD: getttyent.c,v 1.4 1997/07/09 00:28:22 millert Exp $$OpenBSD: getpass.c,v 1.7 2000/01/13 19:36:21 millert Exp $$OpenBSD: getmntinfo.c,v 1.4 1999/06/01 15:31:13 millert Exp $$OpenBSD: getlogin.c,v 1.5 2000/01/06 08:24:16 d Exp $$OpenBSD: getgrent.c,v 1.12 2000/01/08 08:07:24 d Exp $$OpenBSD: getbsize.c,v 1.6 1998/06/23 22:40:25 millert Exp $$OpenBSD: fts.c,v 1.23 1999/10/03 20:39:53 millert Exp $$OpenBSD: fstab.c,v 1.8 1999/09/03 16:23:18 millert Exp $$OpenBSD: errx.c,v 1.3 1997/07/25 20:30:02 mickey Exp $$OpenBSD: disklabel.c,v 1.4 1997/07/23 21:04:04 kstailey Exp $rnia\WQKE>73/)$܀ӀˀĀrz3            z $OpenBSD: confstr.c,v 1.3 1996/09/15 09:30:55 tholo Exp $$OpenBSD: basename.c,v 1.4 1999/05/30 17:10:30 espie Exp $$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $x$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $0$OpenBSD: sscanf.c,v 1.3 1997/07/25 20:30:12 mickey Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: ftell.c,v 1.3 2000/02/21 22:11:22 millert Exp $$OpenBSD: fgets.c,v 1.2 1996/08/19 08:32:33 tholo Exp $$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $$OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $ӡơx$OpenBSD: getservbyport.c,v 1.3 1997/07/09 01:08:35 millert Exp $$OpenBSD: getservbyname.c,v 1.5 2000/01/06 08:24:17 d Exp $$OpenBSD: getprotoent.c,v 1.4 1999/09/03 16:23:18 millert Exp $$OpenBSD: getnetent.c,v 1.8 1998/03/16 05:06:57 millert Exp $$OpenBSD: gethostnamadr.c,v 1.41 2000/01/06 08:24:17 d Exp $:$OpenBSD: md5crypt.c,v 1.9 1997/07/23 20:58:27 kstailey Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$OpenBSD: verrx.c,v 1.2 1996/08/19 08:27:32 tholo Exp $$OpenBSD: waitpid.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $$OpenBSD: getpwent.c,v 1.19 2000/04/25 19:11:48 deraadt Exp $ $OpenBSD: getcwd.c,v 1.5 1998/08/14 21:39:26 deraadt Exp $$OpenBSD: getcap.c,v 1.16 1999/02/25 21:40:17 millert Exp $$OpenBSD: exec.c,v 1.10 2000/01/29 19:52:26 deraadt Exp $$OpenBSD: err.c,v 1.4 1997/07/25 20:30:01 mickey Exp $7\8:H;C(D ExF$OpenBSD: vfscanf.c,v 1.6 1998/01/20 21:25:39 millert Exp $  $OpenBSD: ungetc.c,v 1.2 1996/08/19 08:33:11 tholo Exp $$OpenBSD: fread.c,v 1.2 1996/08/19 08:32:44 tholo Exp $$OpenBSD: res_query.c,v 1.13 1999/09/27 23:58:26 alex Exp $$OpenBSD: res_mkquery.c,v 1.8 1997/04/13 22:37:21 provos Exp $$OpenBSD: res_debug.c,v 1.9 1998/03/19 00:30:06 millert Exp $ d'@Bʚ;$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $ ڜҜɜbZQHA9741.+($OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: inet_pton.c,v 1.3 1999/12/08 09:31:15 itojun Exp $$OpenBSD: inet_ntop.c,v 1.1 1997/03/13 19:07:32 downsj Exp $$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: inet_network.c,v 1.7 1997/07/09 01:08:37 millert Exp $$OpenBSD: getservent.c,v 1.5 1999/09/03 16:23:19 millert Exp $$OpenBSD: md5c.c,v 1.12 2000/03/28 17:35:09 millert Exp $$OpenBSD: verr.c,v 1.2 1996/08/19 08:27:30 tholo Exp $$OpenBSD: warnx.c,v 1.2 1996/08/19 08:27:50 tholo Exp $$OpenBSD: warn.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: toupper_.c,v 1.2 1996/08/19 08:26:56 tholo Exp $$OpenBSD: syslog.c,v 1.9 2000/01/02 23:35:58 hugh Exp $$OpenBSD: getdomainname.c,v 1.3 1998/05/13 08:50:55 deraadt Exp $hHx @(#)strftime.c 7.58D@(#)localtime.c 7.70$OpenBSD: localtime.c,v 1.19 2000/04/16 16:24:03 d Exp $WILDABBR@(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.7 2000/01/06 08:24:17 d Exp $$OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $$OpenBSD: wbuf.c,v 1.4 1997/05/31 22:41:32 tholo Exp $$OpenBSD: vsnprintf.c,v 1.5 1998/07/27 02:28:28 millert Exp $$OpenBSD: sprintf.c,v 1.4 1998/01/12 06:14:31 millert Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: perror.c,v 1.3 1998/09/10 06:44:53 deraadt Exp $$OpenBSD: fseek.c,v 1.3 2000/02/21 22:11:22 millert Exp $$OpenBSD: fputs.c,v 1.3 1999/08/07 17:35:58 millert Exp $x ( 0$OpenBSD: res_send.c,v 1.8 1998/03/19 00:30:08 millert Exp $$OpenBSD: res_init.c,v 1.18 1999/09/03 21:14:51 deraadt Exp $$OpenBSD: res_comp.c,v 1.8 1997/07/09 01:08:49 millert Exp $$OpenBSD: inet_addr.c,v 1.6 1999/05/03 22:31:14 yanick Exp $$OpenBSD: vwarnx.c,v 1.2 1996/08/19 08:27:39 tholo Exp $$OpenBSD: vwarn.c,v 1.2 1996/08/19 08:27:38 tholo Exp $$OpenBSD: tolower_.c,v 1.2 1996/08/19 08:26:52 tholo Exp $L;$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $$OpenBSD: gethostname.c,v 1.3 1998/05/13 08:50:58 deraadt Exp $(>>??@AAC$OpenBSD: setvbuf.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: printf.c,v 1.3 1997/07/25 20:30:10 mickey Exp $$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $GhIJKxKK\LL@MMP$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $|RR$OpenBSD: catopen.c,v 1.8 1996/09/15 09:31:23 tholo Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $,YPtccdd<eHfhDoo ooLo4prs|ssssltt uuvHv\vvtXuuuvHv\vvtvLwwlzt$OpenBSD: opendir.c,v 1.6 1998/08/15 08:10:14 deraadt Exp $$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $$OpenBSD: closedir.c,v 1.3 1998/11/20 11:18:37 d Exp $@$OpenBSD: seekdir.c,v 1.3 1997/09/22 05:09:39 millert Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.4 1999/09/01 23:19:41 deraadt Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: ftruncate.c,v 1.7 1998/11/20 11:18:52 d Exp $$OpenBSD: rget.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: refill.c,v 1.4 1999/08/07 17:35:58 millert Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: db.c,v 1.3 1999/02/15 05:11:23 millert Exp $$OpenBSD: hash.c,v 1.8 1999/04/18 17:08:07 millert Exp $$OpenBSD: bt_open.c,v 1.6 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_get.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_conv.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_close.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: snprintf.c,v 1.6 1998/01/12 06:20:56 millert Exp $$OpenBSD: mktemp.c,v 1.13 1998/06/30 23:03:13 deraadt Exp $$OpenBSD: hash_log2.c,v 1.4 1999/02/15 05:11:24 millert Exp $$OpenBSD: hash_func.c,v 1.5 1999/02/15 05:11:24 millert Exp $$OpenBSD: hash_buf.c,v 1.7 1999/02/15 05:11:24 millert Exp $$OpenBSD: bt_put.c,v 1.6 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_delete.c,v 1.5 1999/02/15 05:11:22 millert Exp $@(#)bt_split.c 8.10 (Berkeley) 1/9/95$OpenBSD: bt_seq.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_search.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_utils.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_overflow.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_page.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: mpool.c,v 1.6 1999/02/15 05:11:25 millert Exp $ $OpenBSD: fprintf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $8  0000000000000000$OpenBSD: fvwrite.c,v 1.10 1999/08/07 17:42:48 millert Exp $$OpenBSD: umoddi3.c,v 1.2 1996/08/19 08:30:48 tholo Exp $$OpenBSD: qdivrem.c,v 1.2 1996/08/19 08:30:42 tholo Exp $$OpenBSD: isinf.c,v 1.3 1996/08/19 08:12:31 tholo Exp $t?}4i$OpenBSD: wsetup.c,v 1.2 1996/08/19 08:33:16 tholo Exp $$OpenBSD: makebuf.c,v 1.3 1998/11/25 05:18:49 millert Exp $$OpenBSD: findfp.c,v 1.2 1996/08/19 08:32:36 tholo Exp $#)$`$*$` |*$`))$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $\n$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $xo$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $o$OpenBSD: infinity.c,v 1.3 1996/09/15 09:30:42 tholo Exp $$OpenBSD: isatty.c,v 1.3 1998/11/20 11:18:39 d Exp $$OpenBSD: ctype_.c,v 1.3 1996/09/15 09:30:56 tholo Exp $dphq$OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: malloc.c,v 1.40 2000/04/10 19:36:29 deraadt Exp $l$OpenBSD: stdio.c,v 1.3 1997/11/09 23:40:41 flipk Exp $$OpenBSD: fwalk.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: sysconf.c,v 1.4 1998/06/02 06:10:26 deraadt Exp $$OpenBSD: signal.c,v 1.4 1998/06/26 02:12:49 deraadt Exp $$OpenBSD: mmap.c,v 1.8 1998/01/02 05:32:50 deraadt Exp $$OpenBSD: lseek.c,v 1.6 1998/11/20 11:18:53 d Exp $#$OpenBSD: sysctl.c,v 1.3 1997/08/24 21:25:46 millert Exp $#$OpenBSD: scandir.c,v 1.4 1998/08/14 21:39:32 deraadt Exp $$OpenBSD: rec_open.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_seq.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_get.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_delete.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_close.c,v 1.6 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: rec_search.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: hash_page.c,v 1.7 1999/02/15 05:11:24 millert Exp $$OpenBSD: hash_bigkey.c,v 1.6 1999/02/15 05:11:24 millert Exp $$OpenBSD: rec_put.c,v 1.5 1999/02/15 05:11:25 millert Exp $ C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??# # Internet (IP) protocols # # $OpenBSD: protocols,v 1.10 2000/01/17 16:39:09 itojun Exp $ # # Updated based on RFC 1340, Assigned Numbers (July 1992). # See also http://www.iana.org/in-notes/iana/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol ucl 7 UCL # UCL egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway bbn-rcc-mon 10 BBN-RCC-MON # BBN RCC Monitoring nvp-ii 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing dcn-meas 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # Packet Radio Measurement xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport il 40 IL # IL Transport Protocol ipv6 41 IPv6 # Internet Protocol version 6 sdrp 42 SDRP # Source Demand Routing Protocol sip-sr 43 SIP-SR # SIP Source Route sip-frag 44 SIP-FRAG # SIP Fragment idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 IPSEC-ESP # Encap Security Payload ah 51 IPSEC-AH # Authentication Header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption nhrp 54 NHRP # NBMA Next Hop Resolution Protocol mobileip 55 MOBILEIP # MobileIP encapsulation skip 57 SKIP # SKIP ipv6-icmp 58 IPv6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPv6-NoNxt # No Next Header for IPv6 ipv6-opts 60 IPv6-Opts # Destination Options for IPv6 any 61 any # host internal protocol cftp 62 CFTP # CFTP any 63 any # local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core any 68 any # distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF igrp 88 IGRP # IGRP ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro# $OpenBSD: services,v 1.23 2000/04/27 15:28:10 millert Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 5.8 (Berkeley) 5/9/91 # tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp ssh 22/tcp ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink #kerberos 88/tcp krb5 # Kerberos v5 #kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. x400 103/tcp # ISO E-mail x400-snd 104/tcp csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp portmap rpcbind sunrpc 111/udp portmap rpcbind auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol loc-srv 135/tcp # NCS local location broker loc-srv 135/udp netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap 143/tcp imap2 # Internet Message Access Proto imap 143/udp imap2 # Internet Message Access Proto bftp 152/tcp # Background File Transfer Proto snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp nnsp 433/tcp usenet # Network News Transfer https 443/tcp # secure http (SSL) photuris 468/tcp # Photuris Key Management photuris 468/udp isakmp 500/udp # ISAKMP key management submission 587/tcp msa # mail message submission submission 587/udp msa # mail message submission # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp c ...MAKEDEVconsoledrumkmem memnullxf86zero io tty klog!stdin"stdout#stderr$ksyms% lkm&tty00'cua00(tty01)cua01*tty02+cua02,tty03-cua03.ttyC0/random0srandom1urandom2prandom3arandom4 wt0C st05nwt06rwt07nrwt08fd0a9fd0b:fd0c;rfd0a<rfd0b=rfd0c>rd0a?rd0c@rrd0aArrd0cBwd0aCwd0bDwd0cEwd0dFwd0eGwd0fHwd0gIwd0hJwd0iKwd0jLwd0kMwd0lNwd0mOwd0nPwd0oQwd0pRrwd0aSrwd0bTrwd0cUrwd0dVrwd0eWrwd0fXrwd0gYrwd0hZrwd0i[rwd0j\rwd0k]rwd0l^rwd0m_rwd0n`rwd0oarwd0pbwd1acwd1bdwd1cewd1dfwd1egwd1fhwd1giwd1hjwd1ikwd1jlwd1kmwd1lnwd1mowd1npwd1oqwd1prrwd1asrwd1btrwd1curwd1dvrwd1ewrwd1fxrwd1gyrwd1hzrwd1i{rwd1j|rwd1k}rwd1l~rwd1mrwd1nrwd1orwd1pwd2awd2bwd2cwd2dwd2ewd2fwd2gwd2hwd2iwd2jwd2kwd2lwd2mwd2nwd2owd2prwd2arwd2brwd2crwd2drwd2erwd2frwd2grwd2hrwd2irwd2jrwd2krwd2lrwd2mrwd2nrwd2orwd2pwd3awd3bwd3cwd3dwd3ewd3fwd3gwd3hwd3iwd3jwd3kwd3lwd3mwd3nwd3owd3prwd3arwd3brwd3crwd3drwd3erwd3frwd3grwd3hrwd3irwd3jrwd3krwd3lrwd3mrwd3nrwd3orwd3pbpf0sd0asd0bsd0csd0dsd0esd0fsd0gsd0hsd0isd0jsd0ksd0lsd0msd0nsd0osd0prsd0arsd0brsd0crsd0drsd0ersd0frsd0grsd0hrsd0irsd0jrsd0krsd0lrsd0mrsd0nrsd0orsd0psd1asd1bsd1csd1dsd1esd1fsd1gsd1hsd1isd1jsd1ksd1lsd1msd1nsd1osd1prsd1arsd1brsd1crsd1drsd1ersd1frsd1grsd1hrsd1irsd1jrsd1krsd1lrsd1mrsd1nrsd1orsd1psd2asd2bsd2csd2dsd2esd2f sd2g sd2h sd2i sd2j sd2ksd2lsd2msd2nsd2osd2prsd2arsd2brsd2crsd2drsd2ersd2frsd2grsd2hrsd2irsd2jrsd2krsd2lrsd2m rsd2n!rsd2o"rsd2p#sd3a$sd3b%sd3c&sd3d'sd3e(sd3f)sd3g*sd3h+sd3i,sd3j-sd3k.sd3l/sd3m0sd3n1sd3o2sd3p3rsd3a4rsd3b5rsd3c6rsd3d7rsd3e8rsd3f9rsd3g:rsd3h;rsd3i<rsd3j=rsd3k>rsd3l?rsd3m@rsd3nArsd3oBrsd3pDnst0Eest0Fenst0Grst0Hnrst0Ierst0Jenrst0K st1Lnst1Mest1Nenst1Orst1Pnrst1Qerst1Renrst1Scd0aTcd0cUrcd0aVrcd0cWcd1aXcd1cYrcd1aZrcd1c[mcd0a\mcd0c]rmcd0a^rmcd0cwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: games:*:13: staff:*:20:root guest:*:31:root utmp:*:45: www:*:67: network:*:69: named:*:70: dialer:*:117: nogroup:*:32766: nobody:*:32767: . etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation any 99 any # private encryption scheme gmtp 100 GMTP # GMTP pim 103 PIM # Protocol Independent Multicast ipcomp 108 IPComp # IP Payload Compression Protocol reserved 255 Reserved # \ :pb#40320:ob#102816:tb=swap: \ :pc#961632:oc#0: \ :ph#656208:oh#143136:bh#4096:fh#512:th=4.2BSD: rdroot|ramdiskroot|RAM-disk root FS image:\ :ty=ramdisk:se#512:nt#2:ns#128:nc#16:\ :pa#3510:oa#0:ta=4.2BSD:ba#4096:fa#512:\ :pb#0:ob#0:tb=swap:\ :pc#3510:oc#0: stallboot ${ROOTDISK} ) populateusrlocal test -x /mnt/upgrade.site && /mnt/usr/sbin/chroot /mnt /upgrade.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 md # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP efs 521/tcp # extended file name server timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp nfsd 2049/udp nfs # NFS server nfsd 2049/tcp nfs # NFS server rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v5 should comment these out and uncomment the v5 entries above. # kerberos-sec 88/udp # Kerberos secondary port UDP kerberos-sec 88/tcp # Kerberos secondary port TCP klogin 543/tcp # Kerberos authenticated rlogin kshell 544/tcp krcmd # and remote shell ekshell 545/tcp # Kerberos encrypted remote shell -kfall ekshell2 2106/tcp # What U of Colorado @ Boulder uses? kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos-iv 750/udp kdc kerberos # Kerberos authentication--udp kerberos-iv 750/tcp kdc kerberos # Kerberos authentication--tdp kerberos_master 751/udp kerberos-master # Kerberos authentication kerberos_master 751/tcp kerberos-master # Kerberos authentication krb_prop 754/tcp # Kerberos slave propagation krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' kpop 1109/tcp # Pop with Kerberos eklogin 2105/tcp # Kerberos encrypted rlogin rkinit 2108/tcp # Kerberos remote kinit kx 2111/tcp # X over kerberos kip 2112/tcp # IP over kerberos kauth 2120/tcp # Remote kauth # # AFS Services # afs3-fileserver 7000/udp # AFS fileserver afs3-callback 7001/udp # AFS callback server afs3-prserver 7002/udp # AFS protection server afs3-vlserver 7003/udp # AFS volumelocation server afs3-kaserver 7004/udp # AFS kerberos authenication server afs3-volser 7005/udp # AFS volume server afs3-errors 7006/udp # AFS error server ? afs3-bos 7007/udp # AFS basic over-see server ? afs3-update 7008/udp # ? afs3-rmtsys 7009/udp # ? # # Unofficial services # supfilesrv 871/tcp # SUP server rsync 873/tcp # rsync server cddb 888/tcp # Audio CD Database supfiledbg 1127/tcp # SUP debugging radius 1645/udp # radius authentication radacct 1646/udp # radius accounting webster 2627/tcp # Network dictionary webster 2627/udp canna 5680/tcp # Kana->Kanji server icb 7326/tcp # Internet Citizen's Band hunt 26740/udp # hunt(6) # # Appletalk # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol   ;_X= t1^ke\/bsd.old/obsd/bsd>> OpenBSD/i386 BOOT %s /etc/boot.confboot> booting %s: failed(%d). will try %s Turning timeout off. U WVS]5L1}0hhpDhHSLYhVhX(=HLPTÃhC[t1ۃhXhC5H5PhXr"G LuE15LƃhVhX(V5h3C }T[=TthCT0  h  @  timesttysetrebootmachinelshelpenvechoboot#UX5ThhTu X,vopen(%s): %s non-secure %s, will not proceed %s: %s UlWVSj5L P8ǃ}2t_tZP'PhXhrA1EPWC.}uEt$hXh,:AWM9tXjVW9Ã~F< u}$5'PhXhM@ F~ +ÅtW8؍e[^_%s: syntax error US1ɻ,]\=XAt< t< t<#]E\`QEPEu\](xut E xu tE-}t4QEPEuE0hr?1cEEXE` `\Qt\Bvӡ\ǀ`X@Ћ]ÐU WVSu} WE1ۃ?tC<;u 8tS0W*Xu8uEe[^_ÐU WVSu}~x1q2EEWu.Mb)ʍ)Gu62;E|Vu4jhV#j SVWVtOT t<tA t0Ntt.@K9vѐjrSK9w뺐CG9vjJSK똉)E H9s C뇐j&SjS h)؍e[^_UE@t' t u8t@ t t8u1 %sUS];t3h9= ;uj R]commands:Uh=h, machine:Uh6<h-h1%s US;\} 4`hd<C;\|j Q1]%s speed is %d %s not a console device US=\u jj+PjuRPN5dRÃu5dh;T=\u jS+P5dh;*1ҋ h TBA< vRS[+1]U=/E=\uEPaPg;1/.stat(%s): %s opendir(%s): %s UlWVS}Wdu P}P}%5/!PhXh :E%f=@tWhXhXƃ}&5 PhXh :X=XtC;u/CFWhX&}#5u PhXh 1: WSRSVe}V1e[^_-fc-d-b---l-s-w-sSx-tT %u,%u %lu %s US] Cf % POCf-trRNCf-twRNC@t9 t6 : t7 PNCf-trRNCf-twRjNCt9 t6 : t7 P4N-CtrPN-CtwPNCt9 t< : t= PMus0ss h? C8]ÐU=u1 %s:%sU=\~1d8-t'uXPIjst112j^uhXhHh hXz7ÐUMʊt<:tBt<:u::uhQhXQhHh hX7XRebooting... Uh 7Q1jd],Y<SlKttimeoutimagettydevicehowtoaddr%d U=\t5Tho6jj5d#T1>> OpenBSD/i386 BOOT %s %s UShh36 = t!3h6CЃ ;u1]%s U=\thHh&5j5dhHw1ÐU=\thXh&5h5dhX41%p U=\t5PhN5jj5d"P1%s not a console device switching console to %s %s console not present US=\tjKPh&4g5d6KÃu5dh495dhy4S L t5dh!V41]ÐU=\=Ht{j-IHt jaIHt jbjIIt jcTIHt js>IH@t jd(Ij I j61howto: bad option: %c boot: illegal argument %s UVS] H5\9`:-B:w|$T\dt||||||||||||||l3+#@PhB:^Rhz2C9 H1e[^empty %s=%s UVS=\u+ttP%2h25th5dK‰=tC;=u)9}ЍP tC; u;tCR5dVJu CFuޅt >uuh:tƃ=\uhP5dhV'11e[^U WVSu ^ S:NjE_VEPG Pu],G=,e[^_ÐU WVSU ,t {[u9slj:,ut,S9s%RSV ]s[t S2+E9re[^_1.23aout8""BIOSU,WVS] CEPUr09E%3KMEPuVEp0Eu1UF!NFM1vx~`EEENdPjsuFЉÃ0u_UB09EtMEM1qx} u EIyEǀUr0MQM9؍e[^_ÐUWVSu ExWU D4U-E;|+0E};0}}u(E1MT9dU}E}tU9S(tj{uEp07CS1EPEPsEp0GHdEPjEpBЃ uKUB09CZEC(K}~ ;EEM\UE1e[^_ÐUWVSEp~8UU!MV_P tE @N9wu;Fw_0]#^@#_LE;EPURMQ uw06}t80EPPSOdEPjMqBЅt]SjoREE U+]M 1ۋFV+V9wu9v v)ƋU21e[^_ÐUWVSE pUREEFEPEPE PX]}9sO;t?F(CC;Eu#CPURu U14C9rEVVF9ou 9Fbe[^_ÐU<WVSDžDžh4hjPPU Jh 4B.M ARRh jjq@ЉÃ0 u#\TuA0==`wP}1Qt@~DžE PjÃ.u> F>/t>B %f=@`1@=F>t/uPE PR\ÉM QQÃB %f=`zV C:= ~ 7BPVPU;(}W4quv0c2PjE PÃ+M QPPv0NdPjM qBЉÃ ugWPRT/t DžE PÃu >1ۃtr0Q2t*h p1hR1؍[^_ÐU WVSEX@tp13tCp031Oy؃tCp0[1h sH1hS:11e[^_UWVS}EpEE E,E9vÃSuEPESV])߃t1VF9w u%9FvEPEPEPEt}tE8Ee[^_UÐUWVSEu }U@tt .t%0x)0x!PH)HP[^_ÐUEM PB fAB|A ABRA0Q41ÐUWVS} EpuFVF9wu9Fw ~EPEPEPu`]U C9s;t))V9sF( CC@PCPW CV1e[^_ÐUWVS}9sЉ9sЉLu LJP,G0EU@04EGtÉEEE‰UEEEUEU04MyGHЉ8<GLЉ@D[^_UtS]EPS} EE%f=@t#jS!Ã| jjjS,"؋]ÐUE)w u  .u u Q@Уu1-ÐUuO"UVSjuc Ã|u SƃS"e[^UE 1ɋtfff=t tttfff=tY tLtfff= t1 t$tffft uÐUS] ACtfff= u = t 1CAC$C0yt AC<ACHCACtfff=t =uC%)‰SACC(A C4AC@ACAC A C,AC8CD1[non-secure file, check permissions! %u+%u+[%u+%u] total=0x%x start=0x%x UWVSjuKǃ0EPW Eth# j 4VW. CtVWЃtjLjT0PEX4T{t0PWC ЃtuO9M `hh#jl1RPWr hE dPWB;htt]Ph#jx1RPW tE pPW;tpuh#0ujE |PD UuE|u EM ERh#jE1RPWh uE EPW4;E}t$jE1RPWEEu Ƌ]}t#u#jVWuvEXtSVW9uUSh#ރF$`\Ph#E Pu0Q uW[^_SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%s %s %d %d:%d:%d %d UWVSE<ؙU)Ӊ)Љ))É]Ӻ*)R)É]ӍK$I)Ɖ))ƹl~`u Q)9u Q)9u Ò ÓAlC1';'v +G;w~Fu Q)9u Q)9uKQUREPURS w ''Pw |''Ph'h'e[^_UVSU] Mփr CBu[^bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %dUUBW$p+ --D-D-4--D-,-D-D-D-D-D-D-D-D-D-D-D-D-D-<-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D-D--D-D-D-D-D-D-D-D-$-D-D-D-,,,,,,**y-*q>*iL*ab*Yl*Q*I*A*9*1+)+!++Rh<+h  USEM @At t8t)‰[-.--- 0memorydiskinfobootU%1Ðmachine boot {fd,hd}<0123>[abcd] Where [0123] is the disk number, and [abcd] is the partition. Booting from %s [%x,%d] [%x] Invalid device! UVS=\th-ch,. d&PR?h0CG;=\Hj=1e[^_entry point at 0x%x UWVS]\E @EUBRjjv?EPVC%CPh1Vu5(5ps jWE PCprobing: Uj6h1F z*? 9h1"QUE)w u  *uu Q@У1-UWVS}MEA߃]w}-uEUE}+uEAtu}0uJGH 8u<u zG +EPEPwH JGH)}Ee[^_UWVS}Uv )uRE URPW4`~Lt+RE URPWpu ^FRt t,VU UF1;Uua;E v\jjjW u V2^DjPjV* j8hv<jV)3^D~@VP F19U 9E v{] u)e uvDžDžPPWo;u';u+uwE U!Y [^_U WVSE} u)w u tP3EPWV PjAУu:E-uURVWQ@Уu +ue[^_UWVSE>tE}~E @FF EEPuV1Ãu ~Et8uEEF EuE; }@EVuЉÃtttEEE; |ͅuFV@ e[^_U WVSE] uU)w u  :tLt%u!+YGWRVSW@Ѝe[^_U WVSE)11w u  WutS@ЉƃuCt S@ Љt 5u1 =e[^_UUttÐUEtEPu hDBtUE PuhZUu uhZÐU WVS}<VEЃE 0@E %u1ۋE 0FE $EFFFGGGGGGGFGGGPGGGFG4GGGhG{w_PCVEP?1IHs;<t,PEЃPEЃC C; Cuj>GP_3CVEЃ3Cuw}j-Eރj VEPdwjVEPGwj VEP+j0EЃjxEC wjVEPKj%EЃjlEЃe[^_0123456789abcdefUWVSE u]1GCȅu됐KPEЃ9we[^_|/-\U=u(pHPpKjARAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs fd%uUVS1hVh11WjRPj6j` tPf}Ut Q111ҐM€< u:C@u+~11Ґ< u\*C@u ~踖QZhNjN N11v WjRPQ6j0uu W jQ[^_Unknown device: Bad unit number Bad partition id %s UWVS} E@{:t{:t CEtYEE;Y}"+PV7 u؋E;Y|EhR;:tPC;:uj S/< vhR?U pC<vhRVE;t E}t.}t}t}u πWÉ\C ֋M ΁% ʁCt5C PW=@ttPh S:W EX1e[^_Ðinvalid function/parameteraddress mark not foundwrite-protectedsector not foundreset faileddisk changeddrive parameter activity failedDMA overrun data boundary error bad sector detected bad track detected invalid mediacontrol data address mark detectedDMA arbitration level out of rangeuncorrectable CRC or ECC error on read controller failure1no media in drive2incorrect drive type in CMOS@seek failedoperation timed outdrive not readyvolume not locked in drivevolume locked in drivevolume not removablevolume in uselock count exceededvalid eject request failedundefined errorwrite faultstatus register errorsense operation failedUMU=UtU9tBu:t9uB  [ [  ] ^12UMu11W=WtW9t:t9uBÐU,WVSU}E E}t:|rLur BEUEulbMΉ1E1EыE+E9r)˃EPSQUREPURE Pa ] ]uU9Ur}t U EPe[^_UE@1ÐU1ZX)ĉqq1Pwdfdwtsdstcdmcdscdhdacdcncompc U WVS}E $M1;8},EPWFЉƒu w1C;8|uwЍe[^_ÐUEU }hfBdB$0BaBUE tn t( t>x t[unjj z jmtSHKj RPШu(P/PÐUSà u  ut S(؋]%s%dUBPBYPho[hhThÐU WVSEEPEp;urz@&N}|MDBBЉE;urQWEVu WEVt u<]5fwVt ]e1 9vЍe[^_USE] UJu1CMt. t(r#8Mu@CMt t r8Mt)‰[UUЀ:t @8u) U=xuxE Pu;h^ exitUh_f4frdPdb1ÐHbn_؎ЎbVb\bbbhbnbtbzbbbbbbbbbPbbbbPbPbPbPbPbPbPbPbPbPbPbPbPbbbbbbbbbbbbbbbbbbbbcc cccccc#c'c+c/c3c9c=cAcEcIcMcQcUcYc]cacecicmcqcuc_' bjj\jjVjjPjj JjjDjj >jj 8jj2jj ,j (jj"jjjjjjjjjij|jxjtjpjljhjdj`j\j Xj Tj Pj Lj HjDj@jt S2C~e[^`PPPPD$<D$<aϐ؎D$0D$,D$(D$$D$ D$D$D$D$h.hhhgggggggvgiguC;U9E ~"9U};U M S)ȉCC {u,{CES)E M KK 1e[^_ÐUxxt xuhx-x@ЉЉDPjZUVSuUM 9s"э2JtKIJuACJu[^: connect error apmU WVSS15 Ȅu =DMPt1S15S15ÈE֣ 5t fgDfE+]ɉ)ʉ)Уwց5S51thq?hq/hj j֠e[^_ÐU%PRFUUtBu8BBB1Ƀx tjRBp1ÐUS]t Ct{$u .xtSpss(C$C1]ÐUVS]u Et 81u}8t u C{ uC ,:C({$uC$D:jjs(C ЉC@C@ } ދC@ FvSXCpPC1҃x uRS‹CPtSR1Se[^ÐUuu juunknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data checkUWVS]{;E} uES Z$uvvv(wVwwwwRx|xxx"y,yC}HCCBtC C uSB;Bv C;uCJ}HCCEsNB))9t COu.E u C}SHCCBCC}SHCCBCCv}SHCCBCCHSHCCBSBC0} CfuC@\WSCpǃuC C@u}}SBPSrCx t Ct~}SHCCBC CtT}SHCCBC Ct*}SHCCBC Cu^}SHCCBSB9Bt CvuC@ e[^_ÐU WVSu ]߃}tUBt8t dSVjU;B0t CE@0PJtX)SVrUB1e[^_U WVS}tGu 8 t G@_uz΋GPw+:yuBt1 )ЉAKtv։)G_GPu#_wW_wG1e[^_ÐUEt@t@u P+     UVS]u UtC<ws v(F$Ѓ;uVs$CC C(C4C0C8tjjjЉCÃ0u G tE 8u GLVw(G$Љ؍e[^_Ðoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsUWVSu(Ejh v(F Љǃu WEEPU$RMQuhh hEPURÃ0uM9u%u F FLzWEPU$RMQu hh ju UMPcÃ0uE8uN}vEu Fk$u Ft FWv(F$ЉWv(F$1e[^_ÐUVSUM ]u1[^UEjjp(@ Љ…tEBE BEBEBinvalid literal/length codeinvalid distance codeU,WVSEXU UM IM@ EUzr4B09s)H MA,)E $D^,*`}} MUJ zUE PEM +AEUr4QRssCPCPEM ME @EUR UMyq4 A09s)HE EP,)U}t} CC CCK M9s0}jEMU EBU;}rӋEU#SJm)uBCtCBCi@, t Q M AUEP xEAE+AUMq4jE PQSU9s.}EMM EE;}rԋEU#Cm)CC CCC E9s-}EMU EBU;}rӋEU#SJm)tCBC 9@uC B‰S! M AUEP xEAE+AUMq4jE PQSU9s.} EMM EE;}rԋEU#C m)E+P(C 9s)ЋUJ,)Mu)E{}E@,E9u%UB0R(9t9s )HE M)M}utEp4URM QPEEp4P09s)H MA,)EMI,M9u MA(9t9s)JUE)E}"EUBUFMM;Q,uA(ECPS}MI,M9u%UB0R(9t9s )HE M)M}Ep4URM QPEEp4P09s)H MA,)EMI,M9u MA(9t9s)JUE)E}u>MUJ zUE PEM +AEUr4MQE P\ECFMUv EMUr4MQE PREUr4B09t8EMA yMU JE+BEUr4MQE PMUJ zUE PEM +AEUr4jEMA yMU JE+BEUr4j[UEP xM AE+AEUr4MQE P$MUJ zE @EU +BM Ep4URM QPUEP xM AE+AEUr4MQE PMUJ zE @EU +BM Ep4URM QPlUEP xEM AE+AUMq4EPU RQ4EMA yMU JE+BEUr4jM QRe[^_ÐUE up(@$invalid distance codeinvalid literal/length codeU,WVSEEURUMy qA4EA09Es +EHEUJ,+MMUUU UMU BUv#EMB)ƋEE#Z)΃wMU BUv#EMEB)ƋEE9s MM Me }E;urM#B))]UM+Q(9rU)ŠMBABAM2)ЉEEP,+U;]v+]䐐 EB@EMuMQ(MBAMKutE@uB‰M#UBZ+]9v)]My )Ɖq]EXEU+BM UEP4NM@u@B‰#E2J)ΊBUBUMM tPEX+]9v)]Uz )Ɖr]MYE+AEMJ4E@2X+]9v)]Uz )Ɖr]MYE+AEMJ4[}v } ?EX+]9v)]Uz )Ɖr]MYE+AEMJ41[^_U WVS}E @ Ew0G49w_,)U B9vÅt }uE)؋U BZG8tSVw<ЉG Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# a  n}www*CCHTTP server/var/www/sbin/nologin2\Wnamed*FFBIND Name Service Daemon/var/named/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3FaSanobody*Unprivileged user/nonexistent/sbin/nologin2bin*Binaries Commands and Source,,,//sbin/nologin1binrootCharlie &/root/bin/csh2rootCharlie &/root/bin/csh3e` daemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody |s2-D&Doperator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootCharlie &/root/bin/csh1root \Vto$$bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3Cbin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2# Disk geometry and partition layout tables. # Key: # dt controller type # ty type of disk (fixed, removeable, simulated) # d[0-4] drive-type-dependent parameters # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # sc #sectors/cylinder, ns*nt default # su #sectors/unit, sc*nc default # se sector size, DEV_BSIZE default # rm rpm, 3600 default # sf supports bad144-style bad sector forwarding # sk sector skew per track, default 0 # cs sector skew per cylinder, default 0 # hs headswitch time, default 0 # ts one-cylinder seek time, default 0 # il sector interleave (n:1), 1 default # bs boot block size, default BBSIZE # sb superblock size, default SBSIZE # o[a-p] partition offsets in sectors # p[a-p] partition sizes in sectors # b[a-p] partition block sizes in bytes # f[a-p] partition fragment sizes in bytes # t[a-p] partition types (filesystem, swap, etc) # # All partition sizes reserve space for bad sector tables. # (5 cylinders needed for maintenance + replacement sectors) # qp120at|Quantum Peripherals 120MB IDE:\ :dt=ESDI:ty=winchester:se#512:nt#9:ns#32:nc#813:sf: \ :pa#13824:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#13824:ob#13824:tb=swap: \ :pc#234144:oc#0: \ :ph#206496:oh#27648:th=4.2BSD:bh#4096:fh#512: pan60|Panasonic Laptop's 60MB IDE:\ :dt=ST506:ty=winchester:se#512:nt#13:ns#17:nc#565:\ :pa#13260:oa#0:ta=4.2BSD:ba#4096:fa#512:\ :pb#13260:ob#13260:tb=swap: \ :pc#124865:oc#0: \ :ph#97682:oh#26520:th=4.2BSD:bh#4096:fh#512: mk156|toshiba156|Toshiba MK156 156Mb:\ :dt=SCSI:ty=winchester:se#512:nt#10:ns#35:nc#825:\ :pa#15748:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#15748:ob#15748:tb=swap:\ :pc#288750:oc#0:\ :ph#257250:oh#31500:bh#4096:fh#512:th=4.2BSD: cp3100|Conner Peripherals 100MB IDE:\ :dt=ST506:ty=winchester:se#512:nt#8:ns#33:nc#766: \ :pa#12144:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#12144:ob#12144:tb=swap: \ :pc#202224:oc#0: \ :ph#177936:oh#24288:th=4.2BSD:bh#4096:fh#512: # a == root # b == swap # c == whole disk # e == /var # f == scratch # h == /usr cp3100new|Conner Peripherals 100MB IDE, with a different configuration:\ :dt=ST506:ty=winchester:se#512:nt#8:ns#33:nc#766: \ :pa#15840:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#24288:ob#15840:tb=swap: \ :pc#202224:oc#0: \ :pe#15840:oe#40128:te=4.2BSD:be#4096:fe#512: \ :pg#15840:og#55968:tg=4.2BSD:bg#4096:fg#512: \ :ph#130416:oh#71808:th=4.2BSD:bh#4096:fh#512: floppy288|3in|3.5in High Density Floppy, 2.88MB:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#36:nc#80:\ :pa#5760:oa#0:ba#4096:fa#512:ta=4.2BSD:fa#512: \ :pb#5760:ob#0:\ :pc#5760:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:fa#512: \ :pb#2880:ob#0:\ :pc#2880:oc#0: floppy5|5in|5.25in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#15:nc#80:\ :pa#2400:oa#0:ba#4096:fa#512:ta=4.2BSD:fa#512:\ :pb#2400:ob#0:bb#4096:fb#512:\ :pc#2400:oc#0:bc#4096:fc#512: maxtor4380|Maxtor XT4380E ESDI :\ :dt=ESDI:ty=winchester:se#512:nt#15:ns#36:nc#1222:sf: \ :pa#21600:oa#0:ta=4.2BSD:ba#4096:fa#512:\ :pb#21600:ob#21600:tb=swap: \ :pc#659880:oc#0: \ :pe#216000:oe#53200:te=4.2BSD:be#4096:fe#512: \ :ph#398520:oh#269200:th=4.2BSD:bh#4096:fh#512: miniscribe9380|compaq38|Miniscribe 9380 ESDI :\ :ty=winchester:dt=ESDI:se#512:nt#15:ns#35:nc#1223:rm#3600:sf: \ :pa#21000:oa#0:ba#8192:fa#1024:ta=4.2BSD: \ :pb#42000:ob#21000:tb=swap: \ :pc#642075:oc#0: \ :pe#21000:oe#63000:be#8192:fe#1024:te=4.2BSD: \ :ph#556500:oh#84000:bh#8192:fh#1024:th=4.2BSD: ida4|compaq88|Compaq IDA (4 drives) :\ :ty=winchester:dt=IDA:se#512:nt#16:ns#63:nc#1644:rm#3600:\ :pa#20160:oa#0:ba#8192:fa#1024:ta=4.2BSD: \ :pb#80640:ob#20160:tb=swap: \ :pc#1659168:oc#0: \ :pe#201600:oe#100800:be#8192:fe#1024:te=4.2BSD: \ :pf#20160:of#1310400:bf#8192:ff#1024:tf=4.2BSD: \ :ph#1008000:oh#302400:bh#8192:fh#1024:th=4.2BSD: \ :pg#302400:og#1330560:bg#4096:fg#512:tg=4.2BSD: fuji513|Fujitsu M22XXXX: \ :ty=winchester:dt=ESDI:se#512:nt#16:ns#63:nc#954:rm#3600:\ :pa#20160:oa#82656:ba#4096:fa#512:ta=4.2BSD:#!/bin/sh # # $OpenBSD: dhclient-script,v 1.5 2000/04/20 08:14:21 angelos Exp $ # if [ x$new_network_number != x ]; then echo New Network Number: $new_network_number fi if [ x$new_broadcast_address != x ]; then echo New Broadcast Address: $new_broadcast_address new_broadcast_arg="broadcast $new_broadcast_address" fi if [ x$old_broadcast_address != x ]; then old_broadcast_arg="broadcast $old_broadcast_address" fi if [ x$new_subnet_mask != x ]; then new_netmask_arg="netmask $new_subnet_mask" fi if [ x$old_subnet_mask != x ]; then old_netmask_arg="netmask $old_subnet_mask" fi if [ x$alias_subnet_mask != x ]; then alias_subnet_arg="netmask $alias_subnet_mask" fi if [ x$reason = xMEDIUM ]; then ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 exit 0 fi if [ x$reason = xPREINIT ]; then if [ x$alias_ip_address != x ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 \ broadcast 255.255.255.255 up exit 0 fi if [ x$reason = xARPCHECK ] || [ x$reason = xARPSEND ]; then exit 0; fi if [ x$reason = xBOUND ] || [ x$reason = xRENEW ] || \ [ x$reason = xREBIND ] || [ x$reason = xREBOOT ]; then if [ x$old_ip_address != x ] && [ x$alias_ip_address != x ] && \ [ x$alias_ip_address != x$old_ip_address ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi if [ x$old_ip_address != x ] && [ x$old_ip_address != x$new_ip_address ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete $old_ip_address 127.1 >/dev/null 2>&1 for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete $1 $2 shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -n -d \1/p' |sh fi if [ x$old_ip_address = x ] || [ x$old_ip_address != x$new_ip_address ] || \ [ x$reason = xBOUND ] || [ x$reason = xREBOOT ]; then ifconfig $interface inet $new_ip_address $new_netmask_arg \ $new_broadcast_arg $medium route add $new_ip_address 127.1 >/dev/null 2>&1 for router in $new_routers; do route add default $router >/dev/null 2>&1 done if [ "$new_static_routes" != "" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi fi if [ x$new_ip_address != x$alias_ip_address ] && [ x$alias_ip_address != x ]; then ifconfig $interface inet alias $alias_ip_address $alias_subnet_arg route add $alias_ip_address 127.0.0.1 fi if [ x$new_domain_name != x ]; then if [ -n "$new_domain_name_servers" ]; then echo search $new_domain_name >/etc/resolv.conf for nameserver in $new_domain_name_servers; do echo nameserver $nameserver >>/etc/resolv.conf done if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf fi exit 0 fi fi fi if [ x$reason = xEXPIRE ] || [ x$reason = xFAIL ]; then if [ x$alias_ip_address != x ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi if [ x$old_ip_address != x ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete $old_ip_address 127.1 >/dev/null 2>&1 for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete $1 $2 shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -n -d \1/p' \ |sh >/dev/null 2>&1 fi if [ x$alias_ip_address != x ]; then ifconfig $interface inet alias $alias_ip_address $alias_subnet_arg route add $alias_ip_address 127.0.0.1 fi exit 0 fi if [ x$reason = xTIMEOUT ]; then if [ x$alias_ip_address != x ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi ifconfig $interface inet $new_ip_address $new_netmask_arg \ $new_broadcast_arg $medium sleep 1 if [ "$new_routers" != "" ]; then set $new_routers if ping -q -c 1 -w 1 $1; then if [ x$new_ip_address != x$alias_ip_address ] && \ [ x$alias_ip_address != x ]; then ifconfig $interface inet alias $alias_ip_address $alias_subnet_arg route add $alias_ip_address 127.0.0.1 fi route add $new_ip_address 127.1 >/dev/null 2>&1 for router in $new_routers; do route add default $router >/dev/null 2>&1 done if [ "$new_static_routes" != "" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi if [ "$new_domain_name" != "" ]; then if [ -n "$new_domain_name_servers" ]; then echo search $new_domain_name >/etc/resolv.conf.std for nameserver in $new_domain_name_servers; do echo nameserver $nameserver >>/etc/resolv.conf.std done if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then rm -f /etc/resolv.conf fi mv /etc/resolv.conf.std /etc/resolv.conf exit 0 fi fi fi fi ifconfig $interface inet -alias $new_ip_address $medium for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete $1 $2 shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -n -d \1/p' \ |sh >/dev/null 2>&1 exit 1 fi exit 0 # # $OpenBSD: termcap.pcvt,v 1.1 1999/08/06 20:49:08 deraadt Exp $ # pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=llmmkkjjuuttvvwwqqxxnnoosspprr``aaffgg~~..--++\054\054hhII00yyzz:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: pcvt25|pcvt|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: # $OpenBSD: dot.profile,v 1.2 2000/01/30 01:21:20 deraadt Exp $ # $NetBSD: dot.profile,v 1.1 1995/12/18 22:54:43 pk Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export HISTFILE=/.sh_history umask 022 set -o emacs # emacs-style command line editing alias dmesg="cat /kern/msgbuf" # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # editors believed to be in $EDITBIN, smart and dumb defaults EDITBIN=/bin EDITUBIN=/usr/bin if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES # mount kernfs and re-mount the boot media (perhaps r/w) mount_kernfs /kern /kern mount_ffs -o update /dev/rd0a / # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? 9600 # Installing or upgrading? _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall, (U)pgrade or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi # $OpenBSD: install.md,v 1.7 1999/10/08 03:55:42 millert Exp $ # # # Copyright rc) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # # machine dependent section of installation/upgrade script. # # Machine-dependent install sets MDSETS=kernel md_set_term() { test -n "$TERM" && return echo -n "Specify terminal type [pcvt25]: " getresp pcvt25 TERM=$resp export TERM } md_makerootwritable() { : } md_machine_arch() { cat /kern/machine } md_get_diskdevs() { # return available disk devices cat /kern/msgbuf | egrep "^[sw]d[0-9]+ " | cutword 1 | sort -u } md_get_cddevs() { # return available CDROM devices cat /kern/msgbuf | egrep "^cd[0-9]+ " | cutword 1 | sort -u } md_get_partition_range() { # return range of valid partition letters echo [a-p] } md_questions() { echo echo -n "Do you expect to run the X Window System? [y] " getresp y case "$resp" in y*|Y*) xfree86=y ;; *) ;; esac echo } md_installboot() { echo Installing boot block... cp /usr/mdec/boot /mnt/boot /usr/mdec/installboot -v /mnt/boot /usr/mdec/biosboot ${1} if [ "$xfree86" = y ]; then echo echo "Enabling machdep.allowaperture. Read xf86(4) for more information." echo '1,$s/^#machdep\.allowaperture=1/machdep\.allowaperture=1 / w q' | ed /mnt/etc/sysctl.conf 2> /dev/null echo fi } md_native_fstype() { echo msdos } md_native_fsopts() { echo ro } md_checkfordisklabel() { # $1 is the disk to check local rval disklabel -r $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 _whole=$2 if [ -n "$_whole" ]; then echo echo Updating MBR based on BIOS geometry. fdisk -e ${_disk} << __EOC reinit update write quit __EOC else echo cat << __EOT A single OpenBSD partition with id 'A6' ('OpenBSD') should exist in the MBR. All of your OpenBSD partitions will be contained _within_ this partition, including your swap space. In the normal case it should be the only partition marked as active. (Unless you are using a multiple-OS booter, but you can adjust that later.) Furthermore, the MBR partitions must NOT overlap each other. [If this is a new install, you are most likely going to want to type the following fdisk commands: reinit, update, write, quit. Use the 'manual' command to read a full description.] The current partition information is: __EOT fdisk ${_disk} echo fdisk -e ${_disk} fi echo Here is the partition information you chose: echo fdisk ${_disk} echo } md_prep_disklabel() { local _disk=$1 echo -n 'Do you want to use the *entire* disk for OpenBSD? [no] ' getresp "no" case $resp in y*|Y*) md_prep_fdisk ${_disk} Y ;; *) md_prep_fdisk ${_disk} ;; esac cat << __EOT Inside the BIOS 'A6' ('OpenBSD') partition you just created, there resides an OpenBSD partition table which defines how this BIOS partition is to be split up. This table declares the offsets and sizes of your / partition, your swap space, and any other partitions you might create. (NOTE: The OpenBSD disk label offsets are absolute, ie. relative to the start of the disk... NOT relative to the start of the BIOS 'A6' partition). __EOT md_checkfordisklabel $_disk case $? in 0) ;; 1) echo WARNING: Disk $_disk has no label. You will be creating a new one. echo ;; 2) echo WARNING: Label on disk $_disk is corrupted. You will be repairing. echo ;; esac # display example cat << __EOT If this disk is shared with other operating systems, those operating systems should have a BIOS partition entry that spans the space they occupy completely. For safety, also make sure all OpenBSD file systems are within the offset and size specified in the 'A6' BIOS partition table. (By default, the disklabel editor will try to enforce this). If you are unsure of how to use multiple partitions properly (ie. separating /, /usr, /tmp, /var, /usr/local, and other things) just split the space into a root and swap partition for now. __EOT disklabel -f /tmp/fstab.${_disk} -E ${_disk} } md_welcome_banner() { { if [ "$MODE" = install ]; then cat << __EOT Welcome to the OpenBSD/i386 ${VERSION_MAJOR}.${VERSION_MINOR} installation program. This program is designed to help you put OpenBSD on your disk in a simple and rational way. __EOT else cat << __EOT Welcome to the OpenBSD/i386 ${VERSION_MAJOR}.${VERSION_MINOR} upgrade program. This program is designed to help you upgrade your OpenBSD system in a simple and rational way. As a reminder, installing the 'etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the 'etc' set into those files which already exist on your system. __EOT fi cat << __EOT As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. If you hit Control-C and restart the install, the install program will remember many of your old answers. __EOT } | more } md_not_going_to_install() { cat << __EOT OK, then. Enter 'halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __EOT } md_congrats() { local what; if [ "$MODE" = install ]; then what=installed else what=upgraded fi cat << __EOT CONGRATULATIONS! You have successfully $what OpenBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT } hostname() { case $# in 0) cat /kern/hostname ;; 1) echo "$1" > /kern/hostname ;; *) echo usage: hostname [name-of-host] esac } #!/bin/sh # $OpenBSD: install.sh,v 1.72 2000/05/07 17:08:26 millert Exp $ # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used thoughout FQDN= # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS $MDSETS" if [ "`df /`" = "`df /mnt`" ]; then # Good {morning,afternoon,evening,night}. echo ================================================== md_welcome_banner else echo "You seem to be trying to restart an interrupted installation!" echo echo "You can try to skip the disk preparation steps and continue," echo "otherwise you should reboot the miniroot and start over..." echo -n "Skip disk initialization? [n] " getresp "n" case "$resp" in y*|Y*) echo echo "Cool! Let's get to it..." echo ;; *) md_not_going_to_install exit ;; esac fi echo "You can run a shell command at any prompt via '!foo'" echo "or escape to a shell by simply typing '!'." echo # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. if [ "`df /`" = "`df /tmp`" ]; then md_makerootwritable fi # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` if [ "`df /`" = "`df /mnt`" ]; then # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while : ; do if [ "X${ROOTDISK}" = "X" ]; then while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done DISK=$ROOTDISK else DISK= while [ "X${DISK}" = "X" ]; do getanotherdisk done if [ "${DISK}" = "done" ]; then break fi fi # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${DISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. # Loop and get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << __get_filesystems_1 You will now have the opportunity to enter filesystem information for ${DISK}. You will be prompted for the mount point (full path, including the prepending '/' character) for each BSD partition on ${DISK}. Enter "none" to skip a partition or "done" when you are finished. __get_filesystems_1 if [ "${DISK}" = "${ROOTDISK}" ]; then echo echo "The following partitions will be used for the root filesystem and swap:" echo " ${ROOTDISK}a /" echo " ${ROOTDISK}b swap" echo "${ROOTDISK}a /" > ${FILESYSTEMS} fi # XXX - allow the user to name mount points on disks other than ROOTDISK # also allow a way to enter non-BSD partitions (but don't newfs!) # Get the list of BSD partitions and store sizes _npartitions=0 for _p in `disklabel ${DISK} 2>&1 | grep '^ *[a-p]:.*BSD' | sed 's/^ *\([a-p]\): *\([0-9][0-9]*\) .*/\1\2/'`; do _pp=`firstchar ${_p}` if [ "${DISK}" = "${ROOTDISK}" -a "$_pp" = "a" ]; then continue fi _ps=`echo ${_p} | sed 's/^.//'` _partitions[${_npartitions}]=${_pp} _psizes[${_npartitions}]=${_ps} # If the user assigned a mount point, use it. if [ -f /tmp/fstab.${DISK} ]; then _mount_points[${_npartitions}]=`sed -n "s:^/dev/$DISK$_pp[ ]*\([^ ]*\).*:\1:p" < /tmp/fstab.${DISK}` fi _npartitions=$(( ${_npartitions} + 1 )) done # Now prompt the user for the mount points. Loop until "done" echo _i=0 resp="X" while [ $_npartitions -gt 0 -a X${resp} != X"done" ]; do _pp=${_partitions[${_i}]} _ps=$(( ${_psizes[${_i}]} / 2 )) _mp=${_mount_points[${_i}]} # Get the mount point from the user while : ; do echo -n "Mount point for ${DISK}${_pp} (size=${_ps}k) [$_mp, RET, none, or done]? " getresp "$_mp" case "X${resp}" in X/*) _mount_points[${_i}]=$resp break ;; Xdone|X) break ;; Xnone) _mount_points[${_i}]= break;; *) echo "mount point must be an absolute path!";; esac done _i=$(( ${_i} + 1 )) if [ $_i -ge $_npartitions ]; then _i=0 fi done # Now write it out _i=0 while test $_i -lt $_npartitions; do if [ -n "${_mount_points[${_i}]}" ]; then echo "${DISK}${_partitions[${_i}]} ${_mount_points[${_i}]}" >> ${FILESYSTEMS} _mount_points[${_i}]= fi _i=$(( ${_i} + 1 )) done rm -f /tmp/fstab.${DISK} done echo echo "You have configured the following devices and mount points:" echo cat ${FILESYSTEMS} echo echo "============================================================" echo "The next step will overwrite any existing data on:" ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo ) < ${FILESYSTEMS} echo echo -n "Are you really sure that you're ready to proceed? [n] " getresp "n" case "$resp" in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs -q /dev/r${_device_name} done ) < ${FILESYSTEMS} else # Get the root device ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's/\/dev\/\([^ ]*\)[a-p] .*/\1/'` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done fi # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP, HTTP, or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) donetconfig ;; *) ;; esac if [ "`df /`" = "`df /mnt`" ]; then # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab # XXX We no longer do the following. It is not neccessary. It can be done # XXX after the install is complete. # # echo "The fstab is configured as follows:" # echo # cat /tmp/fstab # cat << \__fstab_config_1 # #You may wish to edit the fstab. You may also wish to take this opportunity to #place NFS mounts in the fstab (this would be especially useful if you plan to #keep '/usr' on an NFS server. #__fstab_config_1 # echo -n "Edit the fstab with ${EDITOR}? [n] " # getresp "n" # case "$resp" in # y*|Y*) # ${EDITOR} /tmp/fstab # ;; # # *) # ;; # esac # # echo munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow "-o async" fi mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done resp= # force one iteration echo echo 'Please enter the initial password that the root account will have.' while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp -n "${_password}" stty echo echo _password=$resp echo -n "Password (again): " stty -echo getresp "" stty echo echo if [ "${_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp= fi done md_questions install_sets $THESETS # XXX # XXX should loop until successful install or user abort # XXX if [ X"$ssl" != X1 ]; then resp= while [ X"${resp}" = X ]; do echo echo "Two OpenBSD libraries (libssl and libcrypto, based on OpenSSL) implement many" echo "cryptographic functions which are used by OpenBSD programs like ssh, httpd, and" echo "isakmpd. Due to patent licensing reasons, those libraries may not be included" echo "on the CD -- instead the base distribution contains libraries which have had" echo "the troublesome code removed -- the programs listed above will not be fully" echo "functional as a result. Libraries which _include_ the troublesome routines" echo "are available and can be FTP installed, as long as you meet the follow (legal)" echo "criteria:" echo " (1) Outside the USA, no restrictions apply. Use ssl${VERSION}.tar.gz." echo " (2) Inside the USA, non-commercial entities may install sslUSA${VERSION}.tar.gz." echo " (3) Commercial entities in the USA are left in the cold, due to how the" echo " licences work. (This is how the USA crypto export policy feels to the" echo " rest of the world.)" echo "" echo "If you do not install the ssl package now, it is easily installed at" echo "a later time (see the afterboot(8) and ssl(8) manual pages)." echo -n "Install (U)SA, (I)nternational, or (N)one? [none] " getresp none case "$resp" in u*|U*) THESETS=sslUSA ;; i*|I*) THESETS=ssl ;; n*|N*) echo "Not installing SSL+RSA shared libraries." THESETS= ;; *) echo "Invalid response: $resp" resp= ;; esac done if [ X"$THESETS" != X ]; then resp= while [ X"${resp}" = X ]; do echo -n "Install SSL+RSA libraries via (f)tp, (h)ttp, or (c)ancel? [ftp] " getresp ftp case "$resp" in f*|F*) # configure network if necessary test -n "$_didnet" || donetconfig install_url -ftp -reuse -minpat ${THESETS}'[0-9]*' resp=f ;; h*|H*) # configure network if necessary test -n "$_didnet" || donetconfig install_url -http -reuse -minpat ${THESETS}'[0-9]*' resp=h ;; c*|C*) echo "Not installing SSL+RSA shared libraries." ;; *) echo "Invalid response: $resp" resp= ;; esac done fi echo fi # Copy in configuration information and make devices in target root. echo cd /tmp echo -n "Copying " for file in fstab hostname.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "$file, " cp $file /mnt/etc/$file rm -f $file fi done echo " ...done." if [ -f /etc/dhclient.conf ]; then echo -n "Modifying dhclient.conf..." cat /etc/dhclient.conf >> /mnt/etc/dhclient.conf fi # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link." else echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime fi if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." exit fi echo -n "Making all device nodes (by running /dev/MAKEDEV all) ..." cd /mnt/dev sh MAKEDEV all echo "... done." cd / remount_fs /tmp/fstab.shadow md_installboot ${ROOTDISK} _encr=`echo ${_password} | /mnt/usr/bin/encrypt -b 7` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd dd if=/mnt/dev/urandom of=/mnt/var/db/host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 populateusrlocal test -x /mnt/install.site && /mnt/usr/sbin/chroot /mnt /install.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 #!/bin/sh # $OpenBSD: upgrade.sh,v 1.15 2000/05/12 06:02:13 deraadt Exp $ # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK= # filled in below trap "unmount_fs -check /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp= # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp= # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. We remove all but ufs/ffs. ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" -o \ "X${_fstype}" = X"ffs" ]; then if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab fi done ) < /mnt/etc/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. Note that this fstab is only for installation purposes, and will not be copied into the root filesystem. __fstab_config_1 echo -n "Edit the fstab with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check all of the filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets $THESETS # Get timezone info get_timezone # Fix up the fstab. echo -n "Converting ufs to ffs in /etc/fstab..." ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab done ) < /mnt/etc/fstab echo "done." echo -n "Would you like to edit the resulting fstab with ${EDITOR}? [y] " getresp "y" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime if [ -f /mnt/etc/sendmail.cf -a ! -f /mnt/etc/mail/sendmail.cf ]; then echo "Moving /etc/sendmail.cf -> /etc/mail/sendmail.cf" test -d /mnt/etc/mail || mkdir /mnt/etc/mail mv /mnt/etc/sendmail.cf /mnt/etc/mail/sendmail.cf ed - /mnt/etc/rc << \__rc_edit 1,$s/etc\/sendmail.cf/etc\/mail\/sendmail.cf/g w q __rc_edit fi echo -n "Making devices..." cd /mnt/dev sh MAKEDEV all echo "done." md_in#!/bin/sh # $OpenBSD: install.sub,v 1.153 2000/05/08 21:28:03 millert Exp $ # $NetBSD: install.sub,v 1.5.2.8 1996/09/02 23:25:02 pk Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation/upgrade script - common subroutines. ROOTDISK= # filled in below VERSION=27 VERSION_MAJOR=$(( $VERSION / 10 )) VERSION_MINOR=$(( $VERSION % 10 )) export VERSION VERSION_MAJOR VERSION_MINOR # extra "site" set can be provided by person doing install ALLSETS="base etc misc comp man game xbase xshare xfont xserv site" # install UPGRSETS="base misc comp man game xbase xshare xfont xserv site" # upgrade SNAPSETS="bin dev etc games man misc sbin \ usr.bin usr.binutils usr.games usr.include \ usr.lib usr.libexec usr.misc usr.sbin usr.share var" THESETS= # one of the above # Path searched for sets by install_sets on the local filesystems local_sets_dir= # decide upon an editor if [ "X$EDITOR" = X ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi export EDITOR fi # Please don't use the 1 of n form below, good idea, wrong implementation! # get a reponse with default[s] getresp() { local _shell_aware=0 local _no_shell=0 # -s option means exit after a shell (caller is shell-aware) if [ "$1" = "-s" ]; then _shell_aware=1 shift fi # -n option means don't try to run shell commands if [ "$1" = "-n" ]; then _no_shell=1 shift fi set -o noglob valid="false" while [ "X$valid" = "Xfalse" ]; do read resp if [ ${_no_shell} -eq 1 ]; then test -z "$resp" && resp=$1 else case "$resp" in "") resp=$1 ;; !) echo "Type 'exit' to return to install." sh test $_shell_aware -eq 0 && continue ;; !*) eval ${resp#?} test $_shell_aware -eq 0 && continue ;; esac fi if [ $# -gt 1 ]; then for i in $@; do if [ "X$resp" = "X$i" ]; then valid="true" fi done else valid="true" fi if [ "X$valid" = "Xfalse" ]; then echo "Try again: Enter one of [$@]" fi done set +o noglob } isin() { # test the first argument against the remaining ones, return succes on a match local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } addel() { # add first argument to list formed by the remaining arguments # adds to the tail if the element does not already exist local _a=$1 _seen= shift while [ $# != 0 ]; do echo "$1" if [ "$_a" = "$1" ]; then _seen="yes" fi shift done if [ "X$_seen" = "X" ]; then echo "$_a" fi } rmel() { # remove first argument from list formed by the remaining arguments local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1" fi shift done } cutword () { # read lines on stdin, return Nth element of each line, like cut(1) local _a _n _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 while read _a; do set -- $_a test "$1" = "" && break eval echo \$$_n done IFS="$_oifs" } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { # return first character of argument local _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } isnumeric() { local _a=$1 while [ ${#_a} != 0 ]; do case $_a in [0-9]*) ;; *) echo 0; return;; esac _a=${_a#?} done echo 1; return } get_ifdevs() { # return available network devices /sbin/ifconfig -a | egrep -v '^([[:space:]]|(lo|enc|gre|ppp|sl|tun|bridge)[[:digit:]])' | cutword -t: 1 } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir=$1 _file shift for _file in $* do if [ -f $_dir/${_file}${VERSION}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}${VERSION}.tgz ]; then return 0 fi # Special check for kernel if [ $_file = "kernel" -a -f $_dir/bsd ]; then return 0 fi done return 1 } list_has_sets() { # return true when the list $1 contains a set, given dir $2 for $3...$n local _list=$1 _file shift for _file in $* do if isin ${_file}${VERSION}.tar.gz $_list; then return 0 fi # Try for stupid msdos convention if isin ${_file}${VERSION}.tgz $_list; then return 0 fi # Special check for kernel if test $_file = "kernel" && isin bsd $_list; then return 0 fi done return 1 } ftp_list_files() { # log in via ftp to host $1 as user $2 with password $3 # and return a list of all files in the directory $4 on stdout local _host=$1 _user=$2 _pass=$3 _dir=$4 shift; shift; shift; shift ftp ${_ftp_active} -V -n $_host << __ptf user $_user $_pass cd $_dir ls quit __ptf } get_localdir() { # $1 is relative mountpoint local _mp=$1 _dir= while : ; do echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __EOT The directory \"$local_sets_dir\" does not exist, or does not hold any of the upgrade sets. __EOT echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir= break ;; esac fi done } getanotherdisk() { cat << __EOT Now you can select another disk to initialize. (Do not re-select a disk you have already entered information for). Available disks are: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which one? [done] " getresp "" if [ "X${resp}" = "X" ]; then DISK=done elif [ "X${resp}" = "Xdone" ]; then DISK=done elif isin $resp $_DKDEVS ; then DISK="$resp" else echo echo "The disk $resp does not exist." DISK= fi } getrootdisk() { cat << __EOT The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the boot program (especially on a PC with multiple disk controllers). Available disks are: __EOT local _defdsk; _DKDEVS=`md_get_diskdevs` _defdsk=`echo $_DKDEVS | cutlast` if [ "${_defdsk}" != "${_DKDEVS}" ]; then _defdsk= fi echo "$_DKDEVS" echo echo -n "Which disk is the root disk? [${_defdsk}] " getresp "${_defdsk}" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo echo "The disk $resp does not exist." ROOTDISK= fi } addhostent() { # $1 - IP address # $2 - symbolic name # Create an entry in the hosts table. If no host table # exists, create one. If the symbolic name already exists, # replace its entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/ $2.$FQDN $2\$/d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2.$FQDN $2" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface media directives # Create a hostname.* file for the interface. if [ "$3" = "dhcp" ]; then echo "dhcp NONE NONE NONE $5" > /tmp/hostname.$1 addhostent 127.0.0.1 $2 else echo "inet $3 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 fi } configurenetwork() { local _ifsdone= _ifs _ouranswer= _reprompt=1 _IFS=`get_ifdevs` resp= # force at least one iteration while [ "X${resp}" != X"done" ]; do if [ $_reprompt = 1 ]; then cat << __EOT You may configure the following network interfaces (the interfaces marked with [X] have been succesfully configured): __EOT for _ifs in $_IFS; do if [ "X${_ouranswer}" = "X" ]; then _ouranswer=$_ifs fi if isin $_ifs $_ifsdone ; then echo -n " [X] " else echo -n " [ ] " fi echo $_ifs done echo fi echo -n "Configure which interface? (or, enter 'done') [$_ouranswer] " getresp "$_ouranswer" case "$resp" in "done") ;; "") _reprompt=0 ;; *) _ifs=$resp _ouranswer="done" if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" else _ouranswer= fi else echo "Invalid response: \"$resp\" is not in list" fi _reprompt=1 ;; esac done } configure_ifs() { local _up _if_name=$1 _if_ip _if_mask local _if_symname _if_extra _hostname local _dhcp_prompt set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` _up=$1 _if_ip=$2 _if_mask=$3 if [ $_up = "UP" ]; then ifconfig $_if_name delete down fi if [ ! -x /sbin/dhclient ]; then echo "DHCP install not supported" echo else _dhcp_prompt=" (or 'dhcp')" fi # Get IP address resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "IP address${_dhcp_prompt} ? [$_if_ip] " getresp "$_if_ip" if [ ! -x /sbin/dhclient -a "X$resp" == "Xdhcp" ]; then resp= fi _if_ip=$resp done # Get symbolic name _hostname=`hostname` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Symbolic (host) name? [$_hostname] " getresp "$_hostname" _if_symname=$resp done # Get netmask if [ "$_if_ip" != "dhcp" ]; then resp= if [ "X${_if_mask}" = X"" ]; then _if_mask=255.255.255.0 fi while [ "X${resp}" = X"" ]; do echo -n "Netmask ? [$_if_mask] " getresp "$_if_mask" _if_mask=$resp done fi if [ -n "`ifconfig -m ${_if_name} | sed -n '/media/p'`" ]; then echo "Your use of the network interface may require non-default" echo "media directives. The default media is:" ifconfig -m ${_if_name} | sed -n ' /supported/D /media:/p' echo "This is a list of supported media:" ifconfig -m ${_if_name} | sed -n ' /media:/D s/^ // /media/p' echo "If the default is not satisfactory, and you wish to use another" echo "media, copy that line from above (e.g. \"media 100baseTX\")" echo -n "Media directives? [$_if_extra] " getresp "$_if_extra" if [ "X${resp}" != X"" ]; then _if_extra=$resp fi fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ "$_if_ip" = "dhcp" ]; then ifconfig ${_if_name} down ${_if_extra} cat > /etc/dhclient.conf << __EOT initial-interval 1; send host-name "$_hostname"; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "hostname-associated DHCP attempt for $_if_name failed..." ifconfig $_if_name delete down cat > /etc/dhclient.conf << __EOT initial-interval 1; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "free-roaming DHCP attempt for $_if_name failed." ifconfig $_if_name delete down return 1 else echo "DHCP attempt for $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else echo "DHCP configuration of $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else ifconfig ${_if_name} down if ifconfig ${_if_name} inet \ ${_if_ip} \ netmask ${_if_mask} ${_if_extra} up ; then addifconfig ${_if_name} ${_if_symname} ${_if_ip} ${_if_mask} "${_if_extra}" return 0 fi fi return 1 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Set up the hostname. if [ ! -f /mnt/etc/myname ]; then echo "ERROR: no /etc/myname!" return 1 fi hostname=`cat /mnt/etc/myname` hostname $hostname # configure all the interfaces which we know about. ( tmp="$IFS" IFS="$IFS." set -- `echo /mnt/etc/hostname*` IFS=$tmp unset tmp while [ $# -ge 2 ] ; do shift # get rid of "hostname" ( read af name mask bcaddr extras read dt dtaddr if [ ! -n "$name" ]; then echo "/etc/hostname.$1: invalid network configuration file" exit fi cmd="ifconfig $1 $af $name " if [ "${dt}" = "dest" ]; then cmd="$cmd $dtaddr"; fi if [ -n "$mask" ]; then cmd="$cmd netmask $mask"; fi if [ -n "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr"; fi cmd="$cmd $extras" $cmd ) < /mnt/etc/hostname.$1 shift done ) # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route add $hostname localhost # /etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route add default `cat /mnt/etc/mygate` fi # enable the resolver, if appropriate. if [ -f /mnt/etc/resolv.conf ]; then _resolver_enabled="TRUE" cp /mnt/etc/resolv.conf /tmp/resolv.conf.shadow fi # Display results... echo "Network interface configuration:" ifconfig -am echo if [ "X${_resolver_enabled}" = X"TRUE" ]; then route show echo echo "Resolver enabled." else route -n show echo echo "Resolver not enabled." fi return 0 } # Print the selector and get a response # The list of sets is passed in as $1, sets $resp get_selection() { local _next= _f _sets=$1 for _f in $_sets ; do if isin $_f $_setsdone ; then echo -n " [X] " _next= else echo -n " [ ] " if [ -z "$_next" ]; then _next=$_f fi fi echo $_f done # Get the name of the file. echo -n "File name? [$_next] " getresp "$_next" } # Do globbing on the selection and parse +/-, sets _get_files and _setsdone # (which must exist in the local namespace) as side effects. glob_selection() { local _selection="$1" _parent_dir="$2" _sets="$3" local _action _matched _tfile _f if [ "X${_selection}" = X"" ]; then return fi # Change +/- into add/remove _action=add case "$_selection" in +*) _selection="${_selection#?}" ;; -*) _selection="${_selection#?}" _action=remove ;; esac # Major hack to allow the user to select globbing patterns set -o noglob if [ X"$_selection" = X"all" ]; then _selection=* fi _tfile=/tmp/install_case.$$ # safe in single user mode cat >$_tfile << OOF case \$_f in $_selection) # Add/remove file to extraction list if [ "\$_action" = "add" ]; then _get_files=\`addel \${_f} \${_get_files}\` _setsdone=\`addel \${_f} \${_setsdone}\` elif [ "\$_action" = "remove" ]; then _get_files=\`rmel \${_f} \${_get_files}\` _setsdone=\`rmel \${_f} \${_setsdone}\` else echo "Unknown action: \$_action" fi _matched=\$(( \$_matched + 1 )) ;; esac OOF set +o noglob # Eww. _matched=0 for _f in $_sets; do . $_tfile done rm -f $_tfile if [ $_matched -eq 0 ]; then echo "File $_parent_dir/$_selection does not exist. Check to make" echo "sure you entered the information properly or enter 'list' for a file list." fi } install_url() { # Get several parameters from the user, and xfer # files from the server. # Note: _ftp_server_ip, _ftp_server_dir, _ftp_server_login, # _ftp_server_password, and _ftp_active must be global. local _sets _kernel _f _file_list _get_files _failed_files _osetsdone local _url_type _url_base _reuse _minpat # Parse arguments, shell style while test $# != 0; do case "$1" in -ftp) _url_type=ftp ;; -html) _url_type=html ;; -reuse) _reuse=1 ;; -minpat) shift; _minpat="$1" ;; esac shift done if [ X"${_minpat}" = X ]; then _minpat='base*.tar.gz|base*.tgz|man*.tar.gz|man*.tgz|etc*.tar.gz|etc*.tgz|bsd' fi echo echo "This is an automated ${_url_type}-based installation process. You will be asked" echo "questions and then the files will be retrieved iteratively via ftp(1)." echo # Reuse old values w/o prompting for anything? if [ X"$_reuse" = X"1" ]; then _reuse= if eval test X"\$_installed_via_${_url_type}" = X"1"; then echo -n "Use values from previous ${_url_type} install? [y] " getresp y case "$resp" in y*|Y*) _reuse=1;; esac fi fi if [ X"$_reuse" = X ]; then # Proxy the connections? if [ "X${_proxy_host}" = X"" ]; then _proxy_host=none fi echo -n "HTTP/FTP proxy URL? (e.g. \"http://proxy:8080\", or \"none\") [${_proxy_host}] " getresp "${_proxy_host}" if [ "X${resp}" = X"none" ]; then unset _proxy_host ftp_proxy http_proxy else _proxy_host=$resp export ftp_proxy=${_proxy_host} export http_proxy=${_proxy_host} fi if [ "${_url_type}" = "ftp" -a "X$ftp_proxy" = "X" ]; then # Use active mode ftp? (irrelevant if using a proxy) case "${_ftp_active}" in -A) resp=y ;; *) resp=n ;; esac echo "By default, ftp will attempt a passive connection and fall back to a normal" echo "(active) connection if that doesn't work. However, there are some very" echo "old ftp servers that claim to support passive mode, but really do not." echo "In this case, you should explicitly request an active session." echo -n "Do you want to use active ftp? [${resp}] " getresp "${resp}" case "$resp" in y*|Y*) _ftp_active=-A ;; *) unset _ftp_active ;; esac fi # Provide a list of possible servers test -z "$_ftp_getlist" && _ftp_getlist=y echo -n "Do you want a list of potential ${_url_type} servers? [${_ftp_getlist}] " getresp $_ftp_getlist case "$resp" in n*|N*) _ftp_getlist=n ;; *) _ftp_getlist=y ftphost=129.128.5.191 if [ "X${_resolver_enabled}" = X"TRUE" ]; then ftphost=ftp.openbsd.org fi ftp ${_ftp_active} -V -a -o /tmp/ftplist ftp://${ftphost}/pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/ftplist > /dev/null cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE ;; esac # Get server IP address resp= # force one iteration while [ "X${resp}" = X"" ]; do if [ -f /tmp/ftplist ]; then eval echo -n "Server IP address, hostname, or list#? [\$_${_url_type}_server_ip]\ " else eval echo -n "Server IP address, or hostname? [\$_${_url_type}_server_ip]\ " fi eval getresp "\$_${_url_type}_server_ip" if [ "X$resp" = "X?" -a -f /tmp/ftplist ]; then cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE resp= elif [ -n "$resp" -a `isnumeric $resp` -eq 1 -a ${resp:-0} -ge 1 \ -a -f /tmp/ftplist ]; then maxlines=`grep "^${_url_type}:" /tmp/ftplist | cat -n | sed -n -e '$p' | cutword 1` if [ $maxlines -lt $resp ]; then echo "There is no ${resp}th line in the list." resp= continue fi tline=`grep "^${_url_type}:" /tmp/ftplist | sed -n -e "${resp}p"` url=`echo $tline | sed -e "s/^${_url_type}:\/\///" | cutword -t' ' 1 | cutword -t' ' 1` host=`echo $url | cutword -t/ 1` path=`echo $url | sed -e "s/^${host}\///"` path="${path}/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" eval _${_url_type}_server_ip=$host eval _${_url_type}_server_dir=$path resp= # do it again, just to double check echo "Using $tline" else eval _${_url_type}_server_ip="$resp" fi done # Get server directory if [ "${_url_type}" = "ftp" -a "X${_ftp_server_dir}" = X"" ]; then # Default ftp dir _ftp_server_dir="pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do eval echo -n "Server directory? [\$_${_url_type}_server_dir]\ " eval getresp "\$_${_url_type}_server_dir" eval _${_url_type}_server_dir=$resp done if [ "${_url_type}" = "ftp" ]; then # Need default values even if we proxy ftp... if [ "X${_ftp_server_login}" = X"" ]; then _ftp_server_login=anonymous fi if [ "X${_ftp_server_password}" = X"" ]; then _ftp_server_password=root@`hostname`.${FQDN} fi # Get login name resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password unless anonymous if [ ${_ftp_server_login} != "anonymous" ]; then resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp -n "${_ftp_server_password}" stty echo echo _ftp_server_password=$resp done else # only used by ftp_list_files() _ftp_server_password=root@`hostname`.${FQDN} fi fi fi # Build up the base url since it is so nasty... if [ "${_url_type}" = "ftp" -a "${_ftp_server_login}" != "anonymous" ]; then eval _url_base=${_url_type}://${_ftp_server_login}:${_ftp_server_password}@\$_${_url_type}_server_ip/\$_${_url_type}_server_dir else eval _url_base=${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir fi # Get list of files from the server. # XXX - check for nil $_file_list and deal if [ "${_url_type}" = "ftp" -a "X${ftp_proxy}" = X"" ]; then _file_list=`ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_ftp_server_password" "$_ftp_server_dir"` else # Assumes index file is "index.txt" for http (or proxy) # We can't use index.html since the format is server-dependent _file_list=`ftp -o - -V ${_url_base}/index.txt | sed 's/ //'` fi _sets= if list_has_sets "$_file_list" $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if isin bsd $_file_list; then _kernel=bsd fi elif isin ${_f}${VERSION}.tar.gz $_file_list; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif isin ${_f}${VERSION}.tgz $_file_list; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else eval echo "There are no OpenBSD install sets available in \"\$_${_url_type}_server_dir\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets= _kernel= for _f in ${_file_list} ; do case "$_f" in *.tar.gz|*.tgz) _sets="$_sets ${_f}" esac done if [ "X${_sets}" = X"" ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo echo "${_file_list}" echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi # Yes, all those blackslashes really are necesary... eval echo "\\\\n"\ "You will now be asked for files to extract. In addition to the files listed,\\\\n"\ "you may select any file located at\\\\n"\ " \$_${_url_type}_server_ip:\$_${_url_type}_server_dir\\\\n"\ "You can also enter \'all\' to install all the standard sets, or \'list\' to list\\\\n"\ "the files available. When you are done selecting files, enter \'done\'. Some of\\\\n"\ "these sets are required for your ${MODE} and some are optional -- you will want\\\\n"\ "at least the base and bsd sets. Consult the installation notes if you are not\\\\n"\ "sure which sets are required!" _osetsdone="$_setsdone" # Set the minimal default for _f in $_sets $_kernel; do eval "case $_f in \ ${_minpat}) \ if ! isin \${_f} \${_setsdone}; then \ _get_files=\`addel \${_f} \${_get_files}\` ; \ _setsdone=\`addel \${_f} \${_setsdone}\` ; \ fi ;; \ esac" done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_sets $_kernel\" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi # Stash the fact that we configured and downloaded via this url method eval _installed_via_${_url_type}=1 echo echo "Fetching files via ${_url_type} may take a long time, especially over a slow network" echo -n "connection. Ready to download files? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Download the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files= echo for _f in $_get_files ; do echo "Getting ${_f} ..." if [ "X${_f}" = "Xssl${VERSION}.tgz" -o \ "X${_f}" = "XsslUSA${VERSION}.tgz" ]; then ( cd /mnt ; ftp ${_ftp_active} -o - -V -m ${_url_base}/${_f} | /mnt/usr/sbin/chroot /mnt /usr/sbin/pkg_add -I -) elif [ "X${_f}" = "X${_kernel}" ]; then ( cd /mnt ; ftp ${_ftp_active} -V -m ${_url_base}/${_f} ) else ( cd /mnt ; ftp ${_ftp_active} -o - -V -m ${_url_base}/${_f} | tar zxpf - ) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" elif [ "X${_f}" = "Xssl${VERSION}.tgz" -o \ "X${_f}" = "XsslUSA${VERSION}.tz" ]; then ssl=1 fi done # Give them the option of refetching failed files. _get_files= while test -n "${_failed_files}" ; do echo echo "The following files failed to transfer and extract correctly:" echo "Choose which one(s) to refetch or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" echo continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_failed_files\" done done } install_from_mounted_fs() { # $1 - directory containing installation sets local _sets= _kernel _f _get_files _failed_files _osetsdone if [ ! -d $1 ]; then echo "No such directory: $1" return fi if dir_has_sets $1 $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if [ -f $1/bsd ]; then _kernel=bsd fi elif [ -f $1/${_f}${VERSION}.tar.gz ]; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif [ -f $1/${_f}${VERSION}.tgz ]; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else echo "There are no OpenBSD install sets available in \"$1\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets= _kernel= _sets=`cd $1 ; echo *.tar.gz *.tgz` if [ "X${_sets}" = X'*.tar.gz *.tgz' ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo ( cd $1 && ls ) echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi echo "\n"\ "You will now be asked for files to extract. In addition to the\n"\ "files listed in the selector you may enter any file located in\n"\ "$1. You can also enter 'all' to install all the standard\n"\ "sets, or 'list' to list the files avilable in $1.\n"\ "When you are done selecting files, enter 'done'.\n"\ "Some of these sets are required for your ${MODE} and some are optional --\n"\ "You will want at least the base and bsd sets.\n"\ "Consult the installation notes if you are not sure which sets are required!" _osetsdone="$_setsdone" # Set a minimal default for _f in $_sets $_kernel; do case "$_f" in base*.tar.gz|base*.tgz|man*.tar.gz|man*.tgz|etc*.tar.gz|etc*.tgz|bsd) if ! isin ${_f} ${_setsdone}; then _get_files=`addel ${_f} ${_get_files}` _setsdone=`addel ${_f} ${_setsdone}` fi ;; esac done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) continue fi glob_selection "$resp" "$1" "$_sets $_kernel" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi echo echo -n "Ready to extract selected file sets? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Extract the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files= echo for _f in $_get_files ; do echo "$1/${_f}:" if [ "X${_f}" = "Xssl${VERSION}.tgz" -o \ "X${_f}" = "XsslUSA${VERSION}.tgz" ]; then ( cd /mnt ; ftp -o - -V -m file:$1/${_f} | /mnt/usr/sbin/chroot /mnt /usr/sbin/pkg_add -I -) elif [ "X${_f}" = "X${_kernel}" ]; then ftp -V -m -o /mnt/$_f file:$1/$_f else ftp -V -m -o - file:$1/$_f | (cd /mnt; tar -zxpf -) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" elif [ "X${_f}" = "Xssl${VERSION}.tgz" -o \ "X${_f}" = "XsslUSA${VERSION}.tgz" ]; then ssl=1 fi done # Give them the option of retrying failed files. _get_files= while test -n "${_failed_files}" ; do echo echo "The following files failed to extract correctly:" echo "Choose which one(s) to retry or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) echo continue fi glob_selection "$resp" "$1" "$_failed_files" done done } install_cdrom() { local _drive _range _part _fstype _directory _n # Get the cdrom device info _CDDEVS=`md_get_cddevs` if [ "X${_CDDEVS}" = X"" ]; then echo "No CD-ROM devices were found. Aborting." return fi cat << __EOT The following CD-ROM devices are installed on your system. Please make sure the CD is in the CD-ROM drive and select the device containing the CD with the installation sets: $_CDDEVS __EOT _drive=`echo $_CDDEVS | cutword 1` echo -n "Which CD-ROM contains the installation media? [$_drive] " getresp "$_drive" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # If it is an ISO9660 CD-ROM, we don't need to ask any other questions _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do # Try up to 6 times to access the CD if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive. Aborting." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else # Get partition from user _range=`md_get_partition_range` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n 'CD-ROM partition to mount (normally "c")? [c] ' getresp c case "$resp" in $_range) _part=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT There are two CD-ROM filesystem types currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done fi rm -f /tmp/label.$_drive # Mount the CD-ROM if ! mount -t ${_fstype} -o ro \ /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi # Get the directory where the file lives if [ "X${_directory}" = X"" ]; then _directory="/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive _def_partition _partition_range _partition _fstype local _fsopts _directory _md_fstype _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 0 fi fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [$_def_partition] " getresp "$_def_partition" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs __EOT _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ ! -z "$_md_fstype" ]; then echo " $_md_fstype" else _md_fstype="_undefined_" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [default] " getresp "default" case "$resp" in default) _fstype= _fsopts="ro" ;; ffs) _fstype="-t $resp" _fsopts="async,ro" ;; $_md_fstype) _fstype="-t $resp" _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Mount the disk if ! mount $_fstype -o $_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << __EOT The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi # Get the directory where the file lives resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP address or hostname? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport (only works with capable NFS server)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-T" ;; *) _nfs_tcp= ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi # Get the directory where the file lives resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_nfs_directory}] " getresp "${_nfs_directory}" done _nfs_directory=$resp install_from_mounted_fs /mnt2/${_nfs_directory} umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT _tape=`basename $TAPE` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=`basename $resp` TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= # force loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="tar -zxvpf -" ;; 2) _xcmd="tar -xvpf -" ;; *) echo "Invalid response: $resp." resp= # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediatly. # if [ ! -e /usr/share/zoneinfo -a ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath= fi cat << __EOT Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "MET" or "GMT-6". Other zones are grouped by continent or country, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific" or "Canada/Mountain". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __EOT if [ X$TZ = X ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#/usr/share/zoneinfo/} fi while : ; do echo -n "What timezone are you in? [\`?' for list] [$TZ] " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls -F ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone [\`?' for list]: " getresp "" case "$resp" in "?") ls -F ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then TZ="$_a" echo "You have selected timezone \"$_a\"". return fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } sane_install() { if [ ! -s /mnt/bsd ]; then cat << __EOT Warning, no kernel (/mnt/bsd) installed! You did not unpack a file set containing a kernel--this is needed to boot. Please note that the install kernel is *not* suitable for general use. __EOT elif [ ! -f /mnt/bin/cat ]; then cat << __EOT You still do not have a /bin/cat in your filesystem (i.e. a sample random file which you probably want). This seems to indicate that you are still missing important distribution files. __EOT elif [ ! -d /mnt/etc -o ! -d /mnt/usr/share/zoneinfo -o ! -d /mnt/dev ]; then cat << __EOT Something needed to complete the installation seems to be missing, did you forget to extract a required set? __EOT else return 0; fi cat << __EOT You will now be given the chance to install the missing set(s). You can enter '!' at the prompt to escape to a shell and fix things by hand if you wish. __EOT return 1 } install_sets() { local _yup="FALSE" _have_nfs # Can we do an NFS install? test -f /sbin/mount_nfs && _have_nfs=true # Ask the user which media to load the distribution from. cat << __EOT It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. You will have the chance to repeat this step or to extract sets from several places, so you don't have to try to load all the sets in one try and can recover from some errors. __EOT if [ "X$local_sets_dir" != "X" ]; then install_from_mounted_fs ${local_sets_dir} if [ X"$_setsdone" != X ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp= # force at least one iteration while [ X"${resp}" = X ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (h)ttp, (t)ape, (C)D-ROM" test -n "$_have_nfs" && echo -n ", (N)FS" echo -n " or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk resp=d ;; f*|F*) test -n "$_didnet" || donetconfig install_url -ftp resp=f ;; h*|H*) test -n "$_didnet" || donetconfig install_url -http resp=h ;; t*|T*) install_tape resp=t ;; c*|C*) install_cdrom resp=c ;; n*|N*) test -n "$_didnet" || donetconfig if [ -n "$_have_nfs" ]; then install_nfs resp=n else echo "Invalid response: $resp" resp= fi ;; *) echo "Invalid response: $resp" resp= ;; esac else _yup="FALSE" # So we'll ask next time fi # Perform sanity checks... if sane_install; then # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp= ;; *) ;; esac else # Not sane, don't exit loop. resp= fi done } munge_fstab() { local _fstab _fstab_shadow _dev _mp _fstype _rest # Now that the 'real' fstab is configured, we munge it into a 'shadow' # fstab which we'll use for mounting and unmounting all of the target # filesystems relative to /mnt. Mount all filesystems. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _rest; do # Skip comment lines case "$_dev" in \#*) continue;; *) ;; esac # and some filesystem types (like there are swap,kernfs,...) case "$_fstype" in ffs|ufs|nfs) ;; *) continue;; esac if [ "$_mp" = "/" ]; then echo $_dev /mnt $_fstype $_rest else echo $_dev /mnt$_mp $_fstype $_rest fi done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab=$1 local _async=$2 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done ) < $_fstab if [ "X${?}" != X"0" ]; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __EOT exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-check] local _check _fstab _pid if [ "$1" = "-check" ]; then _check=1 _fstab=$2 else _check=0 _fstab=$1 fi if [ ! \( -f $_fstab -a -s $_fstab \) ]; then echo "fstab empty" > /dev/tty return fi ( _devs= _mps= # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_m ps}" done echo -n "Unmounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "... Done." if [ $_check = 1 ]; then echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done fi echo "Done." ) < $_fstab } remount_fs() { ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 if ! mount -u -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done ) < $1 } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab=$1 ( _devs= _mps= while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } donetconfig() { _didnet=1 resp= # force at least one iteration _nam= if [ -f /tmp/myname ]; then _nam=`cat /tmp/myname` fi while [ "X${resp}" = X"" ]; do echo -n "Enter system hostname (short form, e.g. \"foo\"): [$_nam] " getresp "$_nam" done hostname $resp echo $resp > /tmp/myname resp= # force at least one iteration if [ -f /tmp/resolv.conf ]; then FQDN=`grep '^domain ' /tmp/resolv.conf | \ sed -e 's/^domain //'` fi while [ "X${resp}" = X"" ]; do echo -n "Enter DNS domain name (e.g. \"bar.com\"): [$FQDN] " getresp "$FQDN" done FQDN=$resp echo echo "If you have any devices being configured by a DHCP server" echo "it is recommended that you do not enter a default route or" echo "any name servers." echo configurenetwork resp=`route -n show | grep '^default' | sed -e 's/^default //' -e 's/ .*//'` if [ "X${resp}" = "X" ]; then resp=none if [ -f /tmp/mygate ]; then resp=`cat /etc/mygate` if [ "X${resp}" = "X" ]; then resp="none"; fi fi fi echo -n "Enter IP address of default route: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi resp="none" if [ -f /etc/resolv.conf ]; then resp= for n in `grep '^nameserver ' /etc/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done elif [ -f /tmp/resolv.conf ]; then resp= for n in `grep '^nameserver ' /tmp/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done fi echo -n "Enter IP address of primary nameserver: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then echo "search $FQDN" > /tmp/resolv.conf for n in `echo ${resp}`; do echo "nameserver $n" >> /tmp/resolv.conf done echo "lookup file bind" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi if [ ! -f /tmp/resolv.conf.shadow ]; then echo echo "The host table is as follows:" echo cat /tmp/hosts cat << __hosts_table_1 You may want to edit the host table in the event that you are doing an NFS installation or an FTP installation without a name server and want to refer to the server by name rather than by its numeric ip address. __hosts_table_1 echo -n "Would you like to edit the host table with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/hosts ;; *) ;; esac fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi }  . .. catchmod cpcpio( pax tar dd df ed ln lsmkdir mv rm sh kshsleep sttyffff1f1ff5€u f 1ہUt fHsffDښ>Қl>ʚ>࿚>บ>ౚD>࢚>> 4> p> >{ >q2hEYPYQYRYFvyjWI5# PQUVXZm`ZIBI:I2I*=="==" =="=="=="=="EH}lQ }^BX}P>03@`(#3@ (%5 EIQa!1AR#v3hRY)RJ7R@CR.q 3  xx!xPxUYYx`xaxpxq|xrsxsjxtaxXxNxDx:x0x"ixPQp_^L90*0$0#0 %0'0B$dB$d" " " |"@ `"pJ"p>"t2" t*" t" tk૙k૙k૙kkk૙k૙k k!k"푠홠[[XATC~XCtTEjBGaDGWIGMPGCQG9TG/UG%VGWGXGZGBLDLGLILMLPLFRTVUVVVPGjCR I>#1)#1!@# @#VPQn}owxdK@[LK@[@K0[5tcsg)#?,,,,,,,,8ukaWMC- ``@BCFGPpsw ^VOFO>O- O-20O%30O40O%@O- pOUOO>2O3O4O5O@OCOtOTO-0O0O!PO   {p`8TK9K'KKxx|hZT : 5/!"#$%r&\`V# VC9C1DXtqtPtX]h~s]i~a]x~V=,=''6w<0g`ZUZPLHL8L* L LL L LH"L6LOI"Pm`TF8*I t^"R#J&<'1( )0-.045T75<KP$$$|$n$Z$F$3 $'!$"$#$%$&$($pp pz0peqOq=q)qq q!q#q$q%qyqcqQq;q)qqqĄń!#$`aqV;ʄ*˄aaD/.0vvvv}}x}p@dOId@XdU 7%1++++s+T+ A+!4+%'+ + +++WiY  35U3Fz3tvm[mKm:m(mmmm b`QwUJP|pfYTvTvTvTvTvTv Tv!Tv0Tv1Tv2Tv4Tv5Tv6TvPTvQTvRTv Tv Tv Tv Tv Tv Tv Tv! Tv0 Tv1 Tv2 Tv@ TvA TvB TvP TvQ TvR Tv` Tva Tvb TvF?F8F1F*F!FFF  F F FFtxN] #]9#]=Irkg ka kX(kNN?81*1#1EW EXE!EEE"EaBfffffuf hfafTfJf @v1vP1vZS)"Z3M)Z8M)w w"ww@wwww!w"w#))9#enf\uJv8w&x3S1V 3S3S3S3S3S3S=3S3S3S3Sˆ3SÈ}3SЈh3SшS3S҈>3Sш)3S3S3S3Sտ3Sɿ3Sÿ3S฿3Sି3Sࢿ3S 3S!3S"3S{3Sq3SfHCUM <6J* JF*d99׾9о9ž9 ੾99999z9 m9 \9pJ9UE9U@9U69U19U,9U9U9U9U 9b9b9c9&c9p۽׽̽׽׽௽M yhd[U4B4&&&e&)ּ̼ i௼LLLqL]LIL5L!L LLLѻL༻L ਻LQLRL=pL=^//VG/ V1y&y&>y& y &y&y&˺y&ය# ऺ# # #P#`|#r#g#Y# O#@E#%:#`0#&##P#Pܹйॹ 2 2x 2g 2V 2H GA`=(`=`=`=`=`=`:g=`=۸`j=Ը`=ø`=೸`=૸`=ࣸ`=`=`=~xgM` g7`gaqַvʷషtT4ശ& शmqT480@0W0׵X0വsTC01aߴ״ϴ´൴୴ ziUA7-ݳӳɳ൳ࡳeQ=hijkٲŲ౲`aynycyTy= y6 y/y(y!yyy yرαı1ཱ1න2଱BࣱJPP@xP@ dJYHW2W]]രsss s yrm8e\ aVP=@OF~y14#    Lگů~zo U!?"#$+%() *+,-./V0ڮ1î23456789:s;]<g>H?9@*ABCDEFGHI׭J*K[LMN?OƭPQRTUVWX|YhZ)[`\Q]^A_.`=abcdefҬgǬhijklmnoxpiqcr[stu=v*wxy$z{|}~ޫʫƫwaT41hC۪ӪrbXG?0֩<}&t@.%1׽ϨBysmfYmNF@50.!ڧЧʧzkּtfm\A;-զͦth^S4 ץͥ ^  u a K<,> ܤˤ¤ !"u$f%W&Q')G*4++-#./01ߣ2٣3ȣ45678e9w:s<k=^>X?P@EA3BC*DEFGHUIJKLܢM͢NǢO¢PQRST~UnVdW^XRYZH[6]^'_ `a bcdԡefghitjQkEo.p%q rstuҠvΠwxy&z|~md^T4ӟ˟r{eV4!ߞԞtS4% }۝gʝ|p\G=(d˜ŜlY;&V K=I -9?MTٛ[\ś]~tuz7ibQTvZ[V`=="@3@(OIJ|KE3SW9tc)"JY.I@ #$sH6s#6@6 PH#6`OH#6`bF M#asM΁3swO 33i`J`c,c<3 #hM #h##acj3 Nv3 6-3PNPDF##Ɓ#a Jac6-3#hW`愀#愀sKa O#AObHFV#s)Bg#sw2|<LزjNgc-xfjn3|P`P##< #%aOo##$+fj 3cCM #a15l8?#a31 5 9=~-   x33|`B~`)1`C~"X<\"3%|>`> 3B~#:nl8?B~B؃|3/B؃|ă3&8+26##k#c 3|`  k#c-<4830| ` 3 #b cZ3cd# v3 3B##"#"(#"#"B#JaE#3 bG# 3 bC##D#sM3'##&KOO"va F$Hڀ#4#Ja@#AK`#I0I`w#]b#c3-c#Ja#APb#Ac̆_+gcz|#hH##c|#cJa6#Ac37 #c`c#|ocKARaN#Ac3 b#Acg#cc#|gc3@ bcc|+@c|@cC|g@c|#c3*c +3)Ccކ3 bڀc|{c3, .c,|3=gc D|#acrqpcrppqrqppcrppqrqppc##3H#HCڇ#c nCvwc nCvwc#tC@Dt$&$scuZF&JudNsc{cv3>gcc8+8+2 1 c26:>c26:>c8+@2@6@:@>cZ @]cs #ss#f ##bswhA###BT+PQ@?@DDDDDD?DD%HH :U>>W24 W 8T W@>lnH0<NdNTD$(2<KLhjprtvx XD  8@@KN[]ULJ G *026EZYb ir YVH   &0348D@\JbhhTUZ DWETX      "&*0468AXCHDUFLNR\rtwWH2W& Vj@ xV4!+Q Q += VK | (NH|IJFFGLC:D>EB &Lx&UJ`xxX +"&='Z0JP !*5i ** <Fv A8G Cq&=, C{(yITt Cq&+/CK @"&p^~b+H"4-!jyj} CF== q."2Lk(x)D4\+QgH$.(4&=>/n"2(x)D4\1W^ V#$ n#$ (#$LD2WDHLTt/HGH?@ #$ 7 K D4 (9D4&"&B[QFYE1D  x pm`)1pm J)BZ.h"2 %-mJI ! " H %mK J' 7N K D4 ()>S)6N%8mw&.LSS)bM)ZcWf~PɣlN%mUTLMM s."2t|k(  .     Lh 0     * wg oE.\"2Tkt(L,u]^ Ap84爦@ AE8@aPP4QQ[\:;` p,]^ Ea4_`[\E,:;(:;BX A8+.bv2+Rk(Lhh @  ~.h@h j,EԢAE@(PPN \ +kvzzZ9D54bbtzQ|  Cq!/>Qz '> p f!ajD.d/@YYu]0^]^d/aBiXe_1`UBX6-e_1` e:1; 8[0\XXYYz  8:Uw? :0;u XXz-N  lAl:; QQk5t vb DB < "b $b  * K+.0 D 2+R((+.P "2l k(L䌂n(#$  n(#$4 "2 @BbI  ZY jY(' y6( D= FG C{&DY 6 6 4F 6 C A 8= FG C{Q H  6 ThP H  A8 w&GA$x)'wAB& J1JP675GKuWVV(yNITb DHHV675G&!*x-U!GNJG  U80:u8`:b G** <F4vG-!U!j$JsW][W]W-W}?G  C= F R8df ER>v* <qbj>v* <qd/v* <{XXX X  l-SM *@/+n#$H L0#^(D9 L9&9?e:1;u prBiXU|!a&0u ]^- lRaBiXUUBX_0`@VV_`BiXU[0\VV[\ p!a@]0^,PP_0`4PP[0\PP:0;(PP |9 O#$'O?'|PO  e:1; U5U:; QQ| EA|9 #$ YY KO.~"2#$'O #$ W)5EY@6P?)M)5Z|]SSZ9 %&.@"2O#$'OBXpJ OJ?|MMZ9 %T%pss4lklZ9 cWf~0V\cWf~P0V\cWf~cWf~ XSMTf}}}|d/[\_`bZXBHwW #$ Y #$ )-YtlK ͠xUUr0 V rdd (`r UrCVcCPMllMWVXW  %  % %sI  % % %I %sJ W!DIKsZ' ? -L!@ A8TCXH,MY,VHH1H,1TrVTXH,MY,HH1TH,1TrVTCXBH,ZJFܓ}.iTMV@LX,}iWEX,VL og`$7( 7g,/'  odXfX<0x4P67=@>VP67  /  A78= FG C{ 8e1vHU5U!RyID'&@VyR}@^L!<R>R>?vHH* <@_FF* <F@JjHt:E,t tDžNE EhTlZ 4Z  &   UƯ D.<n"T .PH@ U>W>,2 8TW < W@>Dln0>tv|TNHDBEF ',|'^L@||X .'=(Z0L0 )-5i -- >EV A9H R'? R~(}ITy R'.1WCK @&tbk.H4+)r}r RE?? 2/2Us&|, ;4`.gWH(/,4'? Mz1v2&|,;4`!W^ V$# v$# &$#LD2QDHLTy 1HGH@@ $# 8 O ;4 &:;4''B[FYWF1D  x pu`,1`u J,Bc/l2 %+uJI ! " H %uO L' 8G O ;4 &,>\,6G%<u"j2U\ \,bV,Z~lWnYѨtG%u^4UV V 2x/2xs&  .     Pq 0      jo oE/`2Xsx&U",S fg A`9@ AF9Ŷ@hPP4QQ de <=` `, fg Fh4 CD deF <=( <= 0B+ T i A"9./p2.[s&U"qq P  .qPq ,FAF@(PP $  jp@UUXXYY  0 < +kvXXc:;54kk QlDTtX `0*B CD0ZBlDTT6C!DT*iTtTSX7 X ( 6T!iSzGbYR0 H 6TTNTpiXXX6T!iYYNTNiX ` "f)hrD.m1@YYSf*g NfpgŶm1h0ZB6C!D0B6+ 6C!D "6E4VH+)^)r$LsW][W]W+W@H  R? E R d f F[M{- >zbrM{- >zm1{- >z~XXX X  t+ \ V ->Q- >~{Vޒ 8G?DXM@1.v$#H L0#>"&;: U:':@6RM[M@{HH- >@_EF- >E@JrHy:E,y y"ϋNE EhTtg HZ 4Z &   ^ζ ;/4vT /HTL50dHHT h PAAര@p @xr`4```4`0P`tPPPP`]x`CPd``@4`0P`P`l@Pl@p@t@`@\`@`@`4x4`@4`@PXr ,P P4`@X@`]r H | ,P ,P P P4x4`@ @ @P4x4`@@ @PP rP_~4xxP^rp@tP|Pp@^r( @^j^z]x\P @^j \P]x\P@4j r 4r P dP xP P  P # @ 4xxP^r `x@|H`Hr 4P\`@`P`l@]r^r ^r( x]rP`t@Pt@`P\r `t@rt@P|@P |H`Hp@d@`~`d@]xP@`@ p ,P4x4`@Pr@ x`PP tjD@r@ PP``P0Xrg @@`|p@Xr 0@@`@@`pX_~ 4xxP]r  P@`P@4j r 4r P(rzP4r P@`P@4j r 4r P@`P@4j r 4r PP@`P@ r X@`@``@PP@`P@4j r 4r P@`P@ r X@`@``@PP|H`H]xP``l@@\`\PP`t@0P4`\r 0`ClPl``@P`BlPP 4x4x4`@X@`|@`@H`HPp4``pp`c@@4@BB{ij{{ { { {-1Zb eeBe eeeddeddedd WD2?2?   XD31  `kkj0HܩX\@P@/Pb \@x( _?0$47G<L<=l@4A  [1tBD##&&### && & JKJwtx CCDEFPFdF|FFGHHXȷl༾ HDXT0x((04lP||\  |ppp$% -|0$%-H=ABBBBBB@IRSXSTTUU\UUUV,VHV N4,ikiIpDp>p>p7p3p/p)pAwvAgv UvKvBv3vv vuoo,Xooooooooooo@ooooooo,}`oo~l,t}`oo8`ଁ`4Hoo4LtLtooLtt}ToЄ,(~LoଂoH~oodo,o~ ooȀoଃoooHഒoo 8` 4ఝࠚhyrV{=Pk5eGmUv9aWvH f0/h+ʷV)>Hⷾ'"=o;v(D c xUN8Θ˷"㦍0y#|ٔ/EC k^&UVr dmVeM- S Kf.w/RvTqp'{CIxT4:]b )UJ!az4ju v\}jBDugf=P? zڪ-1]Y+2Bc`<VbZy jBDo i%8?N,a72*0|:E)+WLfCŌKx\);5h!5h!5h! yr@@@Xpo,,%K4 l  @ `P0p5AgWpqvupppp pxpx,n +: !"#$%&'(),./012345679d<=pqrstuvwxyZ}[`ei\afj]bgch-z{n l@ !"#$%&'()./0123456_9|>=pqrstuvwxyZ~PSUiOaYjQTVKL-z{/_ ._ ._ ,_ *_ ,_ (_ &_ (_ $_ "_ _ _ _ _ _ _ _ _ _ _ _ _ _  _ _ _ _ _ _ _ _ _ _ ^ _ ^ ^ ^ ^ ^ ^ ._ ._ ._ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ._ ._ ._ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ~^ |^ z^ x^ v^ t^ r^ p^ n^ l^ j^ l^ h^ f^ h^ ^ ^ ^ d^ d^ d^ ._ ._ ._ b^ `^ ._ ^^ \^ Z^ X^ V^ T^ R^ P^ N^ L^ J^ H^ F^ D^ B^ @^ >^ <^ :^ 8^ d^ 6^ b^ 6^ 4^ `^ 4^ 2^ 0^ 2^ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ .^ .^ _ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ )^ )^ )^ $^ $^ $^ ._ ._ ._ ._ ._ ._ ^ ^ ^ ^ ^ ^ ^ ^ ^ ._ ._ ._ ^ ^ ^ ^ ^ ^ ] ] ] ] ] ] ._ ._ ._ ._ ._ ._ ] ] ] ._ ._ ._ _ ] _ _ ] _ (_ ] (_ ._ ._ ._ 2^ 2^ 2^ _ ] _ _ ] _ $_ ] $_ _ ] _ _ _ _ _ ] _ _ ] _ _ ] _ 4^ ] 4^ ^ ] ^ ^ ^ ^ ._ ._ ._ d^ ] d^ ._ ._ ._ ^ ^ ^ ._ ._ ._ `| |~ t | ~  |   | ` Ȃ }   D}   t} |  } ܀ 8 } < T ~  p ,~   X~ 8  ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._ ._  ) +: !"#$%&'(*V,-./012345V689EGKOHLPR7IMQSJN;<=>?@ABCDWXFT@oca31oAAAAEEEIIIIOOOOOOUUUYᅠaooo#(+2 $(,@ ` @` !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^  > x Y | " - - ' x  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ g !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^      }|{zyx eabcd_`^]\[>xZYXWVwUTnSRQPONMLKJIHGFYEDCvBA@fh~ |wvutsrqponmlkij4 G L S Z $lP@  TP`  #P( *P( *PP #PP *P(x $HTPq 5tMX t  ,!!0< ! !4 !!!!!!X$!&!Hl+!-!CCDEFPFdF|FFGHH5!5!5!5!w5!5!o5!k5!o5!e5!]5!k5!]5!e5!U5!Q5!I5!F5!>5!F5!65!F5!.5!F5!&5!#5!5!5!5!5!5!5!4!5!4!5!4!5!4!5!4!5!4!5!4!5!4!5!4!5!4!5!4!5!4!5!4!#5!4!#5!4!#5!4!#5!}4!#5!u4!r4!j4!r4!b4!r4!Z4!r4!R4!N4!F4!B4!:4!k5!:4!e5!24!k5!24!e5!*4!#5!"4!F5!4!F5!4!5! 4!4!3!B4!3!B4!3!B4!3!B4!3!B4!3!B4!3!B4!3!B4!3!B4!3!B4!3!B4!3!3!3!3!3!3!3!N4!3!N4!{3!N4!s3!N4!k3!r4!c3!r4![3!r4!S3!r4!K3!r4!C3!r4!;3!r4!33!r4!+3!r4!#3!r4!3!r4!3!r4! 3!3!2!3!2!3!2!3!2!2!2!2!2!Q5!2!Q5!2!Q5!2!Q5!|I!hJ!5!@HPX`bdhjlnprtuvY!(Z!$[!l[!H\!\!\]!8`]!x]!z!{!0}!~!}! ԏ!!T!d!P!dPA @ @R(0 -4>.X5CR @_@Kp{d"("P|#"c"v@ ""\  @dHtTp 0h?<&8<HdS-^ @i\ur(~ؒ\"X"\}!" @!/D=J=Uej"~"x F?lT8kDx!@|)5<HpW?h,?zH?/`" @$^"ē! @04 H#32Xp"<4LZ<ixE! @d V $@8p" (@`7 ,@ 0@$0;E H@P"\iT*"@j!\ hTXH,y{/"L,K?=cK("U P@`k"}-["$6d <` > `@  pE)`f6dC"M\v"Um]HeoJ{ d@ h@ l@DS>hZ@,""?l,"*x"="O!ai!jTx\mЄx<@ "9My`Do z4iWPxdD~!}!h @ (L5`sD|"Oak&|"H@! p@ܸ t@\- *O6QEO x@WT" `o( ygd?h TH"-R"Lg" fy"|E"!" "pI"@>!"|L"Л"!"&hM&`&>&=&& @&P&`''l%'1'@'LT'He'$rs'|'?'''T&'"'"''m'4'Hz (( @*( @8(N(Hc( @l($!y(((b( @( (I(?(̃?(xc"(() @)8,&),!5)G)T) @])\i)ع!y) ) )@)d))8) @)Q)T"** *>-*T6* @?*hxI* @Y*d*"p*<*Є* @* @*`*H* @*D *G* 8@*=+ XA +,+"/+"D+@"\+"t+"+@"+`"+ܮ"+"+!++0+d",,"+,< !6,`) A,`O, \AW,_,t l, pAw,h, A,,!,@ ,,,,",-=/ AE/lP/]/Pf/p/z/f"//)/ A/ A/L /8w/\V"/ /// A 0^"0$ 0*0P!70n@0 L0\0)f00t0w0 A04e000?0E?0 00 !A1=!1e&131<1"M1[1e1,!t1|C1\ 1 a11 !A1 !A111 P!A1"1< 2 2d_ 2c/2i82,f"@24N2Y^2o2T2L2_2Y282@"2"2@"3"3"/3"D3"Z3"q3"3m"3303G3 X!A33J3 \!A3|*3ܴ"4pz4;4`34d*F4<T4]4?i4{z484HD4|4U44lZ4e445 5p5u5.5Y"75|A5LK5u"V5|^5yp5>55545b 5j5"5h:55e"6`66%6=6G6V6i6e"q6\y6A"6L6 `!A6646"66@64a6 d!A7hr" 77d 7/7 h!A87LA7K7S78?f7 n7XS7p>77D7L70777v77 8W8 l!A!8=080?8@G8dM!V8|u^8"o8?z8888$"8 p!A8?8X8h8,8$;8"99!9X"29>9!N9kY9h9Qy90H9G9l9 t!A9tj9,9299,9 x!A9 !A:tK:?:q):?5:=:"G:0Y: "Ai:\w::_: "A:":p: "A:@":":":@";"); "A;; E;PT;g^; e; p; "A;`;X:"; "A;;;(;;lS;;;"<?<<H6.<;<I<R<i< "Aq<d<<!<{< <<2<0<h =P=*=,z7=P"A=đM=3W=d= (#As=}= 8=T=,=\"=TS"=Ĺ!=G?="=">"> #A">$"2>t?=> J>m!T>?_>h>Ps> #A>>lp>\>\>> #A>$$>أ>Z>u?$ ?? ?D1?dB? #AM?P"V?T^? #Aw??$K???X??6?2??Z?? $A@@]"@ +@|!:@L@ %AV@ H&Ac@\p@P@ P&A@`@?@d@h"@"@"@x A p&A A t&AA? A,+AX6A x&ABA4d"OA |&A_A fA8 pAHAAX"AD"AA &AA"A"A"B"B'B!3B;BIB^B!qBXBBBTWB sB Bx~B &AB?B <"B!C C\#Cd-.Cm8CGC &AYChC4CpC>!CCdClCTC4C CC &ACCD D &AD/DU"8D|IDXD@?cDH"vDK~D( D+DjD"D$D|;"D9DD81DD7E(1E8E "E>"+E؂?9E$?FE"REdA\EldE9"uE8E &ĔEE?E8?Et!E8E|E\cFxFV!+Fl;FKF0?[FrjFЩvFF &AF\"F0FFXHF"F &AF:F GG !G2G:GBGL MG [G0dG@rG zGܞ"GG &AG &AGkG("G Gt G?GHHd*Ht3H"JH"bH("vH"H"H|"H"H"H<"H"IWI8"6IЙ"NI &AWI_I BmICI IIHI &AII &AI &AI`JI &AJJ;!J,!,JM )HM YMjMx"uM8MaMc"MTM M"M$;MOMxMhMp N|0N 'A%N 'A1NANh"cN\\mN.~NNN@jN (ANNLN|ON0N0O )AOp?%OH#/O )AFOtRO_O]pO|OOAOOp!O(O(2O!O OoP^P P0Pئ:P?EP<"QPXj]P MiP "}PL[P,PE?P )AP,!P0oPPJPP-QQL$Q/Q9QMEQ"aQ"xQ@"Q"Q"Q"Q ^QQ?Q$RRW%Rp5RGRWR\!aR ?jRzRP"R"Rȸ?Rx!R=?ROR"R9"Rį?R> SBS (SN7Sh"CSMOSeSd"nST"SL8S(SFSS?S S )ASh]S'?S< ToT?$TXC4T|KDTTOT XTUfTquTR"~TTܳ"TT`T0TU?%U6:UXFUgVU L)AaUrU?U"UUx9U P)AU` UZUYUUU V\ V1V< +V>V X)AHV X+AOVWV"lV }Vث"Vԫ"VV"VV0VVVV"W,W̊?7W@BWDMWaXW~eWrWh?~W VW"WD?WWWW0e"WWO"W \+AX@"X@".XLa?Ka2Yana"yatava"aale"a?aX"e e&eneBe>e$"e "eЫ"e̫"ff4+f5"5f CfLfTftejf|xfpfhfl`ffX$!frff!f 4Af"glgg 4A,g?:gDz JgoRg\`gfvggg ggg/ggPg\gg"h !$h,h;h5JhLShdh 4A|hh 4Ahh?jAjjx kzky0kGAk\?JkWk" _kPghk"xkt k!klkk\k>k4ukk4l(NllT),l^7l"Dl 4ANlflApll"l"l lGl 5Alܫ"lP lDlLm0; m 5Am0?%m /mdImPQmDdm`smЩ!mmm"mȢmPmFm!mXm}n 5A$n1nX?n$hJnRnkZnNnnԗnn`qnhn 5Ann 5An nandTo$Mo>oL#o2",o"7o0eAo"Po]o>eo1roTo 5Ao o4)oxoo>oRohoo>o,ppI&p 5A.p,N>pT<Fp"QpB!cpDrpDtpp#p}p`^p0}p"p=p@* pqp" qq 5A#qTL+q)8qHq`r"Lq`-"^q$'"pq4"qX"q"q!q!qQqyq qhq"rr)rP<3r؟?rXOr5!\rjr0 ur(r"r"r"r؊r"rfrr"rFr/ s<9sR4sGsNWsCks 5AxssUsDssss|stsesct?t,t75tS"@t 5ADtXtkt!wt1!tttlth"ttet4t,t u"u !$u1u:u1!Lu]u<muH|uu@u ؎Aup uu"uu u0"u,"u vv8(vH?Avu"Evn!Qv [vx cvYwvvM!v;v@vvnvvp!v ܎AvDv`  w AwL "wG5wX">wlr"BwLp"Lw AYw awx iwlAzwwxw\u"w?wIw wwzwH4w wax!x3*xn:xgIxySx$]xh ex Atxxx2xmxD!x\!xؓxx"y4A#y=2yIKy WyvyVyy Ay@y|fyH!y#yyL y`zܾ z"z")z<^6z@zNzضZzP#gz7szuzPp"zlzl"z Az Nzz\z{${L{`#{XN.{<";{ AD{$tR{[{ c{HUq{<z{{~{{P{{@ !{`]{ { A{H |؝ ||#|E-|`k7|U@|L|xr"[|xbm|| A|8N|~|h||L |p|l% |O|h|\}$}"'}0} +"N}t[},i}\s}H{}@!}h,"}<"}@"}!}!}\@!}~:~<$ "~85~44F~XZ~L\j~-t~HL|~8~`~^~TI~,?~?~<~="~ ~8~d?ȷr*ę4 A?PgI Q,`Ok@yHt Ar"p! %tCJܶ"L  ̕%6GtT_oTzH> ऀx!ಀA!࿀!̀ ?׀h?g([+4=-L0XiT~u= Tශ A ǁH ρP"݁ A"|T"7 A$ 3te?TI`"a"z"D"ୂ"Ă"ۂ"" ""4,?"W0"p}! ԚAࠃ<ୃ ؚAฃd=˃lՃ ܚA, D?8d+:TET^0o\{xԢ-ࣄhఄPคh8ʄ܊?ӄ> A̽ X2ЅE!PЪ"X `ܛkz A4TĿ+ಅ ཅ Ņd ͅU܅ A@G ! A"1ZD!UX?`hltX"} A($2੆Tආ࿆l}̆PMنlU4!,H1;IRwL W ]o ywi"sઈ ?ై@ ่pĈӈ߈ Ax`? ? PA"6B` O XAa"n0nvL!"উl"ಉ7lj ω'؉"(  '"4\R;z!D Lp[Xltl |p `AஊชyŠܵ"ӊKފ  ( p"!<&2T?=hM]m Awઋ!ซlˋܱ"܋h`?x[LI3|=\"L p"Xܷ"npz4dࠌ ਌0෌ A4`ό"׌D2 AXk! Pd!/BLJ$[![Y!m?|:"8Mࡍ"഍"Ǎx=ڍ! ntdH" A?8!(X 6Ю!I+_Lpsy  Ax଎๎P"ÎTӎ?ڎsd A !)5?KZX`Do@pY >এා<ǏՏ"`upw Ad,e8"AWĪd l4 |0ࡐh?ஐ?ຐ?Ɛ!Ӑ"$IT S.lBCW4cHmXA{xB॑഑L"໑qϑOڑĺf(85ED$LpX\exnd"uĐ?঒LoඒjĒ ؛AВ[ْԤ8"d. ܛAhw!"1:AN"[)gLpX^tও೓ A˓AӓsޓTp"4 \& [,7(?BNV<ft"u:|`dD8 Aঔ0?๔”ДTh"! o D&|"9E AVԚb"p(yM9]\kgfprxt w 0A DAଙ\y!༙̙0/ܙ|L+4\""2?O;\@Ee o,s\:ग़y௚azyf lL୛|y!ཛ HAɛٛx/,?Q")"7 LAA<K$eZf PAn~{tx XA$࢜?ੜ༜,}ǜ2՜ ߜ?; xA |A$-dF<NH%[h a8"l"zpM A Aౝp"!͝ޝ Ap" g" A(1"8p??O?[lwpfp","৞&"พ "ʞt"ܞT" q  0HZ97DuPad r A૟|༟ "Ɵ:ԟ1f A" , >3p"B,KH"X8_a$"k Ar  A࣠ Aౠ ຠDp"ŠPΠ(Yנ$>ޠ 4x\^j(;7"I28jG\8!n `AV"ਥล@mɥ xAץp A$<5x'?IUd]qx" ࠦ୦෦ A AǦ<Ӧ<ަp @A:?4 P?(A'< 2ؓ=kLPeеptY~H:XEx7১|"౧B§ͧ`[٧ HAxD(?0#  `A&X"3?Q hA_phg~<nఫPྫĉҫ,x߫U "$"{(s54!ANY |AgDq AzN P࡬બzຬlVѬެHd(&+9'BP#IXHdNp~ \भn!భ8!$ʭ Aӭܸ""Jh# ? )5<CLP0Z$ds Az Q८H!మX.ʮ"ۮg"\"2ИT"@`'d 5 A=?F[?N*Yh JwE>H# ९-೯`"཯Xɯ Aկ`߯"? [?!)8!;ıIZ\f?m{"jࡰ#೰,jȰذ>{ԥ1 Ё?'09 AB[Ml W,_ As|s AV@?઱ೱYྱ<"ȱ AϱTݱ8"tY'u"0 A>tFPT A^n"#!iॲ@௲4๲H_ò ĪAвdN!޲\ԯX$ )9\G`!`!jZ|"̮4ࡳ0>ଳTำų4γ?ճ|!GA"P(p"4?p Hlp[# d ȪAmw|Ԁ? "਴$"෴ ̪AȴwӴ!ݴ?4| &P*t6 ЪAQx[kT"s"a"h௵$`˵dڵtȴ 4og"8)d6 =Hc JRLBc'qZ  P࠶੶D౶<5ʶ<3ԶP ۶ i تAM#98B"FTakE=g"D "ஷ"÷Ps̷t"ط8"߷I?l"1 p*1h!B!PxaPpDwzSTHR स<ସ"സҸlx 0 *Ȫ!@@VN_pw ~]࠹(ਹ.ูh ù~˹UعId"8b"  @ x/HJ(Z<emxu{lvu"ॺ୺෺@DϺںb5 A кf#L", 3\^?@5N"V"e6x A ^"DxCॻLM஻0ൻ!ɻ@ػL<L<$ A2?@P(JW!kr| AP"࠼L"฼Ƽe"ͼrۼ A@!h A܂,H 3gFP]$mb}dC>ࣽPಽ\!࿽ͽo Խd(L?  $ 0,; AJ\PFrP"! TA"@p";!& U <dF'<: XABOOȰe tn {"|? \A"ԯ?3xek (W#@_.<H<GR$Y@h+u ppT `A!,^",! "" $_"'X4x=Bt"O\ds|h" hA  A4tQTF"!R) I9tHdQ Zfe/oK|Шtd A&Z?  A(*~5ARNg As!},H XASD_ lHwğUԍ1?i `A ? .L=pQ) ZP!j\a<X)dl16A?h(0"2D?="G|"Ywglt hA{*pEH"dr"j3""! #'8^"2!FPd=\h0s$*?d,iZ|  Y,?5^JxT`c$pĂ?x ȀHk! ! 9TD"$"+:BM lA[~ip*t pA{x5( xA<-?h?U"2"Q"k |AxxgCD \"To?t , 0" T `".8"ALQ?[g@ t[| A\X? A Ax(" A`krȥ'#`!< >P8dz w3D`"@!T""  Z?<!#f,;$\ElR|`k}w\"l 0 AxZZ?H?_ HV$lv6kMH_ln8`\"" A A?d ,8xd~!1@@,"I AQ`"do A A A AL4< "Ը?D (A lJ)9K\!ZH}jd zЏ1Lh#8,<)RP!) BYP`kt}s !}(ud% `??8> 0AX"\"$B?.5=XV"gpv"ܰ"  DAL wp@d"#0:<!DOp)bcq"PH~eg"H HAp4p"4DN AVk^XiuP[|x"x"PTmLX( p;Z?E?(h7L @N`UM_̏"h|r"rܪ|\ؼ A'?T?,?x\@-)06\r" A$8!9H?D .T xh8}  !  ApN`t",d(D 1h=0GT(_iYu $h"f!<\X p",!Kآ('p"1e!: F`VTgOs0l"8!: A A,8!8h"p08 @dHX(jwlAN! TD"Ч") L%H6T?=EUz\Led"lz$ A|, A@4 | !I "(o!/:XQGFS"_h$q` zdp"H '؞td d# 5,"8k!@ T}[!m~uL Adg"duPW8`L  A , A<XJ AS_9?py( "\^"a"! !>tU,Lh"4D ?deHX^R\"dr  ?"Tg" 0A @A0?"*~2ȶ< "DܮP`$"i"n Au,P p"?? d? AYl$0?8JdW4 `?ivPL>lL|ȕ"&!@